F363468

General Info

Members Datasets Scaffolds Average Seq Length
252 182 504 130

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0585305|Ga0466967_0585305_156_587
Length 143
Sequence VSPTDTEEEQLFGITVRDHMMVAHSFRGEVFGPAQRLHGATFVVDATFRRAELDADDLVVDIGLATTALQAVLGELTYRNLDDDPAFAGRNTSTEFLAKVVADRLAERVAAGELGEGARGLEGIAVTLHESHVAWATYERSLP

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
72 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
73 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
74 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
75 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
88 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
95 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
96 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
97 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
162 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
163 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
164 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
165 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
168 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
169 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
170 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
171 2855683550 Micromonospora sp. RP3T Isolate Unclassified
172 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
173 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
174 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
175 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
176 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
177 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
178 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
179 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
180 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
181 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
182 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.65
Metatranscriptomes 0
Isolates 6.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0
Rhizoplane 11.11
Rhizosphere 78.17
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0585305 3300045976 Bacteria 1100
2 JGI25160J50197_1016933 3300003354 Bacteria 2329
3 Ga0070680_100979545 3300005336 Bacteria 730
4 Ga0070682_100227980 3300005337 Bacteria 1330
5 Ga0068868_100108531 3300005338 Bacteria 2253
6 Ga0068868_100809466 3300005338 Bacteria 846
7 Ga0070687_100974483 3300005343 Bacteria 613
8 Ga0070668_100001303 3300005347 Bacteria 17835
9 Ga0070671_100008313 3300005355 Bacteria 8308
10 Ga0070674_101327869 3300005356 Bacteria 642
11 Ga0070667_100464772 3300005367 Bacteria 1157
12 Ga0070714_100143264 3300005435 Bacteria 2147
13 Ga0070714_100339355 3300005435 Bacteria 1409
14 Ga0070710_10272669 3300005437 Unclassified 1095
15 Ga0070711_100038658 3300005439 Bacteria 3210
16 Ga0070700_100288913 3300005441 Bacteria 1192
17 Ga0070663_100016144 3300005455 Bacteria 4839
18 Ga0070663_100953308 3300005455 Bacteria 744
19 Ga0070678_100460923 3300005456 Bacteria 1115
20 Ga0070662_100848096 3300005457 Bacteria 778
21 Ga0068867_100278941 3300005459 Bacteria 1370
22 Ga0070665_100099503 3300005548 Bacteria 2912
23 Ga0068854_100695822 3300005578 Bacteria 877
24 Ga0068854_100845466 3300005578 Bacteria 801
25 Ga0068856_101857789 3300005614 Bacteria 614
26 Ga0068852_101269588 3300005616 Bacteria 758
27 Ga0068866_10154587 3300005718 Bacteria 1332
28 Ga0068860_100055235 3300005843 Bacteria 3775
29 Ga0081539_10043342 3300005985 Bacteria 2610
30 Ga0070717_10276059 3300006028 Bacteria 1489
31 Ga0070712_100036999 3300006175 Bacteria 3324
32 Ga0070712_100172621 3300006175 Bacteria 1679
33 Ga0070712_100821245 3300006175 Bacteria 798
34 Ga0075428_100000676 3300006844 Bacteria 35056
35 Ga0075428_100327544 3300006844 Bacteria 1646
36 Ga0075428_100349872 3300006844 Bacteria 1586
37 Ga0075430_101193357 3300006846 Bacteria 626
38 Ga0075431_100009630 3300006847 Bacteria 9704
39 Ga0075429_100230419 3300006880 Bacteria 1622
40 Ga0075429_100987336 3300006880 Bacteria 736
41 Ga0068865_100728506 3300006881 Bacteria 850
42 Ga0105245_10070679 3300009098 Bacteria 3168
43 Ga0114129_10019558 3300009147 Bacteria 9642
44 Ga0105243_10030021 3300009148 Bacteria 4183
45 Ga0105241_11307664 3300009174 Bacteria 691
46 Ga0105242_10035871 3300009176 Bacteria 3976
47 Ga0105237_11591707 3300009545 Bacteria 660
48 Ga0105249_10133349 3300009553 Bacteria 2374
49 Ga0105246_11644555 3300011119 Bacteria 608
50 Ga0157374_11455033 3300013296 Bacteria 708
51 Ga0157372_10646563 3300013307 Bacteria 1232
52 Ga0157372_10794517 3300013307 Bacteria 1100
53 Ga0157380_10111323 3300014326 Bacteria 2301
54 Ga0157380_10369026 3300014326 Bacteria 1350
55 Ga0157377_11437244 3300014745 Bacteria 545
56 Ga0157379_10248822 3300014968 Bacteria 1613
57 Ga0157376_11002872 3300014969 Bacteria 857
58 Ga0207692_10404657 3300025898 Bacteria 852
59 Ga0207642_10229200 3300025899 Bacteria 1043
60 Ga0207699_10695667 3300025906 Bacteria 744
61 Ga0207699_10768841 3300025906 Bacteria 707
62 Ga0207671_11165208 3300025914 Bacteria 604
63 Ga0207693_10000956 3300025915 Bacteria 25897
64 Ga0207693_10033604 3300025915 Bacteria 4046
65 Ga0207693_10259721 3300025915 Bacteria 1362
66 Ga0207663_10012395 3300025916 Bacteria 4609
67 Ga0207650_11220066 3300025925 Bacteria 640
68 Ga0207700_10218211 3300025928 Bacteria 1615
69 Ga0207664_10707686 3300025929 Bacteria 906
70 Ga0207644_10006093 3300025931 Bacteria 7864
71 Ga0207690_10807679 3300025932 Bacteria 775
72 Ga0207669_11617751 3300025937 Bacteria 553
73 Ga0207689_10842171 3300025942 Bacteria 774
74 Ga0207668_10029882 3300025972 Bacteria 3576
75 Ga0207668_10329116 3300025972 Bacteria 1270
76 Ga0207668_10678238 3300025972 Bacteria 904
77 Ga0207640_10328356 3300025981 Bacteria 1221
78 Ga0207640_10757538 3300025981 Bacteria 838
79 Ga0207658_10395288 3300025986 Bacteria 1214
80 Ga0207677_10483204 3300026023 Bacteria 1068
81 Ga0207677_10743674 3300026023 Bacteria 873
82 Ga0207678_10000283 3300026067 Bacteria 46141
83 Ga0207678_10406506 3300026067 Bacteria 1179
84 Ga0207702_11883048 3300026078 Bacteria 589
85 Ga0207702_12253006 3300026078 Bacteria 533
86 Ga0207641_10474844 3300026088 Bacteria 1211
87 Ga0207641_10709924 3300026088 Bacteria 991
88 Ga0207674_10338349 3300026116 Bacteria 1455
89 Ga0207675_101980003 3300026118 Bacteria 600
90 Ga0268266_10030791 3300028379 Bacteria 4557
91 Ga0268264_10041949 3300028381 Bacteria 3786
92 Ga0268264_10174481 3300028381 Bacteria 1947
93 Ga0316176_1131813 3300030732 Bacteria 1915
94 Ga0314311_1110018 3300030733 Bacteria 10834
95 Ga0316178_1037456 3300030735 Bacteria 1365
96 Ga0316180_1016297 3300030736 Bacteria 1579
97 Ga0316181_1080891 3300030744 Bacteria 764
98 Ga0307408_100565812 3300031548 Bacteria 1005
99 Ga0307516_10010221 3300031730 Bacteria 10347
100 Ga0307413_11735073 3300031824 Bacteria 557
101 Ga0307518_10004324 3300031838 Bacteria 10186
102 Ga0307410_10147567 3300031852 Bacteria 1747
103 Ga0307410_10461486 3300031852 Bacteria 1038
104 Ga0307406_10189562 3300031901 Bacteria 1504
105 Ga0307409_101350569 3300031995 Bacteria 738
106 Ga0307409_102677821 3300031995 Bacteria 527
107 Ga0307416_102069546 3300032002 Bacteria 671
108 Ga0307415_100380797 3300032126 Bacteria 1198
109 Ga0307415_100498615 3300032126 Bacteria 1064
110 Ga0307507_10005422 3300033179 Bacteria 20976
111 Ga0373923_0069493 3300035111 Bacteria 1510
112 Ga0373956_0001217 3300035119 Bacteria 10658
113 Ga0373957_0359917 3300035120 Bacteria 622
114 Ga0373943_0978814 3300035170 Bacteria 507
115 Ga0373946_0331918 3300035171 Bacteria 757
116 Ga0373925_0324495 3300037068 Bacteria 1246
117 Ga0373925_0896933 3300037068 Bacteria 731
118 Ga0436364_0024877 3300037853 Bacteria 2820
119 Ga0436365_0948091 3300039437 Bacteria 9769
120 Ga0451793_0158493 3300041452 Bacteria 757
121 Ga0451800_1226994 3300041459 Bacteria 528
122 Ga0451802_1336335 3300041460 Bacteria 588
123 Ga0466969_0076956 3300044656 Bacteria 1597
124 Ga0466965_0000262 3300044683 Bacteria 17117
125 Ga0466965_0004824 3300044683 Bacteria 6018
126 Ga0466965_0122706 3300044683 Bacteria 1343
127 Ga0466965_0169550 3300044683 Bacteria 1148
128 Ga0466965_0278995 3300044683 Bacteria 902
129 Ga0466965_0674994 3300044683 Bacteria 591
130 Ga0466966_0583194 3300044684 Bacteria 673
131 Ga0466966_0799433 3300044684 Bacteria 569
132 Ga0466961_0021388 3300044693 Bacteria 4164
133 Ga0466961_0177178 3300044693 Bacteria 1324
134 Ga0466961_0292660 3300044693 Bacteria 996
135 Ga0466961_0467647 3300044693 Bacteria 763
136 Ga0466963_0601917 3300044694 Bacteria 776
137 Ga0466963_0692568 3300044694 Bacteria 719
138 Ga0466963_0725839 3300044694 Bacteria 701
139 Ga0466963_0837724 3300044694 Bacteria 648
140 Ga0466963_1197060 3300044694 Bacteria 534
141 Ga0466964_0119624 3300044706 Bacteria 1186
142 Ga0466971_0242274 3300044719 Bacteria 858
143 Ga0466970_0020717 3300044765 Bacteria 3419
144 Ga0466970_0025653 3300044765 Bacteria 3087
145 Ga0466970_0453772 3300044765 Bacteria 735
146 Ga0466957_0460419 3300044842 Bacteria 877
147 Ga0466957_1319807 3300044842 Bacteria 524
148 Ga0466960_0017104 3300044901 Bacteria 3156
149 Ga0466960_0022205 3300044901 Bacteria 2834
150 Ga0466960_0035097 3300044901 Bacteria 2341
151 Ga0466960_0325823 3300044901 Bacteria 871
152 Ga0466959_0386751 3300045049 Bacteria 952
153 Ga0466958_0096989 3300045836 Bacteria 1829
154 Ga0466958_0128568 3300045836 Bacteria 1589
155 Ga0466967_0030320 3300045976 Bacteria 4537
156 Ga0466967_0039848 3300045976 Bacteria 4042
157 Ga0466967_0470173 3300045976 Bacteria 1231
158 Ga0466967_0775808 3300045976 Bacteria 951
159 Ga0466967_1079582 3300045976 Bacteria 800
160 Ga0466967_1408720 3300045976 Bacteria 694
161 Ga0495592_0150119 3300046454 Bacteria 1612
162 Ga0495603_0143985 3300046455 Bacteria 1386
163 Ga0495641_0269355 3300046461 Unclassified 766
164 Ga0495650_0009599 3300046471 Bacteria 5488
165 Ga0495594_0043891 3300046499 Bacteria 2452
166 Ga0495667_0764155 3300046559 Bacteria 597
167 Ga0495613_0725017 3300046689 Bacteria 653
168 Ga0495581_0440668 3300047315 Bacteria 759
169 Ga0495674_0710805 3300047319 Bacteria 788
170 Ga0495680_0022405 3300047322 Bacteria 5264
171 Ga0495684_0056623 3300047471 Bacteria 2988
172 Ga0495684_0114170 3300047471 Bacteria 2036
173 Ga0496100_0083061 3300048903 Bacteria 2167
174 Ga0496100_0557554 3300048903 Bacteria 887
175 Ga0496101_0006805 3300048904 Bacteria 7375
176 Ga0496102_0032772 3300048905 Bacteria 4669
177 Ga0496102_0105980 3300048905 Bacteria 2616
178 Ga0496103_0081462 3300048906 Bacteria 2036
179 Ga0496103_0723306 3300048906 Bacteria 630
180 Ga0496104_0017547 3300048907 Bacteria 6520
181 Ga0496104_0700530 3300048907 Bacteria 920
182 Ga0496104_0788428 3300048907 Bacteria 856
183 Ga0496104_1491809 3300048907 Bacteria 579
184 Ga0496105_0034433 3300048908 Bacteria 4165
185 Ga0496106_0001850 3300048909 Bacteria 15841
186 Ga0496106_1390384 3300048909 Bacteria 543
187 Ga0496107_0036501 3300048910 Bacteria 3525
188 Ga0496108_0015623 3300048911 Bacteria 6192
189 Ga0496109_0007930 3300048912 Bacteria 9000
190 Ga0496110_0058086 3300048913 Bacteria 3407
191 Ga0496111_0072467 3300048914 Bacteria 2507
192 Ga0496112_0161698 3300048915 Bacteria 2206
193 Ga0496112_0298720 3300048915 Bacteria 1556
194 Ga0496112_0376550 3300048915 Bacteria 1361
195 Ga0496113_0336784 3300048916 Bacteria 1210
196 Ga0496114_0091935 3300048917 Bacteria 2577
197 Ga0496115_0072125 3300048918 Bacteria 2801
198 Ga0496118_0124826 3300048921 Bacteria 1669
199 Ga0496119_0000333 3300048922 Bacteria 65888
200 Ga0496120_0015310 3300048923 Bacteria 5065
201 Ga0496125_0655940 3300048928 Bacteria 564
202 Ga0496126_0046227 3300048929 Bacteria 3995
203 Ga0501031_0163983 3300049568 Bacteria 1453
204 Ga0501031_0352885 3300049568 Bacteria 952
205 Ga0501036_0308170 3300049572 Bacteria 1324
206 Ga0501036_1309364 3300049572 Bacteria 589
207 Ga0501037_0322895 3300049573 Bacteria 1069
208 Ga0501038_0208656 3300049574 Bacteria 1564
209 Ga0501038_0615143 3300049574 Bacteria 821
210 Ga0501039_0201008 3300049575 Bacteria 1567
211 Ga0501047_0008540 3300049581 Bacteria 9662
212 Ga0501047_0215309 3300049581 Bacteria 1778
213 Ga0501047_0938331 3300049581 Bacteria 678
214 Ga0501048_0825741 3300049582 Bacteria 666
215 Ga0501070_0597715 3300049586 Bacteria 880
216 Ga0501071_0256543 3300049587 Bacteria 1320
217 Ga0501072_0090730 3300049588 Bacteria 2426
218 Ga0501075_0191932 3300049591 Bacteria 1558
219 Ga0501079_1013070 3300049741 Bacteria 654
220 Ga0501035_0063916 3300049822 Bacteria 3272
221 Ga0501044_0716455 3300049823 Bacteria 885
222 Ga0501044_1063839 3300049823 Bacteria 679
223 Ga0501044_1276127 3300049823 Bacteria 601
224 nmdc:mga05p37_1265163_c1 3300050507 Bacteria 756
225 nmdc:mga09592_585706_c1 3300050508 Bacteria 957
226 nmdc:mga0qj67_467392_c1 3300050509 Bacteria 1015
227 nmdc:mga0qj67_51972_c1 3300050509 Bacteria 3242
228 nmdc:mga06r32_25610_c1 3300050510 Bacteria 5490
229 nmdc:mga0n895_875940_c1 3300050512 Bacteria 884
230 nmdc:mga0rr50_1858476_c1 3300050513 Bacteria 506
231 Ga0500646_0000049 3300053090 Bacteria 33050
232 Ga0500583_0007422 3300053092 Bacteria 3860
233 Ga0500641_0070936 3300053096 Bacteria 1466
234 Ga0500588_0007390 3300053146 Bacteria 2532
235 Ga0500633_0144054 3300053160 Bacteria 892
236 Ga0466962_0200897 3300061719 Bacteria 974
237 2558906221 2558860112 Bacteria 9931328
238 2586063882 2585427649 Bacteria 9053857
239 2776370202 2775506925 Bacteria 7237746
240 2809586871 2808606522 Bacteria 9488490
241 2855684414 2855683550 Bacteria 7134265
242 2863074183 2863067949 Bacteria 8541735
243 2867302573 2867302475 Bacteria 7087181
244 2870786389 2870782633 Bacteria 9624083
245 2915358926 2915358134 Bacteria 6050864
246 2915775609 2915768154 Bacteria 8424322
247 2917739614 2917736166 Bacteria 9690793
248 2990089805 2990088156 Bacteria 6657676
249 2997452248 2997451912 Bacteria 8492419
250 8053950557 8053945823 Bacteria 8962862
251 8054472433 8054472261 Bacteria 7464355
252 8055071886 8055066027 Bacteria 9479577
253 Ga0466967_0585305
254 JGI25160J50197_1016933
255 Ga0070680_100979545
256 Ga0070682_100227980
257 Ga0068868_100108531
258 Ga0068868_100809466
259 Ga0070687_100974483
260 Ga0070668_100001303
261 Ga0070671_100008313
262 Ga0070674_101327869
263 Ga0070667_100464772
264 Ga0070714_100143264
265 Ga0070714_100339355
266 Ga0070710_10272669
267 Ga0070711_100038658
268 Ga0070700_100288913
269 Ga0070663_100016144
270 Ga0070663_100953308
271 Ga0070678_100460923
272 Ga0070662_100848096
273 Ga0068867_100278941
274 Ga0070665_100099503
275 Ga0068854_100695822
276 Ga0068854_100845466
277 Ga0068856_101857789
278 Ga0068852_101269588
279 Ga0068866_10154587
280 Ga0068860_100055235
281 Ga0081539_10043342
282 Ga0070717_10276059
283 Ga0070712_100036999
284 Ga0070712_100172621
285 Ga0070712_100821245
286 Ga0075428_100000676
287 Ga0075428_100327544
288 Ga0075428_100349872
289 Ga0075430_101193357
290 Ga0075431_100009630
291 Ga0075429_100230419
292 Ga0075429_100987336
293 Ga0068865_100728506
294 Ga0105245_10070679
295 Ga0114129_10019558
296 Ga0105243_10030021
297 Ga0105241_11307664
298 Ga0105242_10035871
299 Ga0105237_11591707
300 Ga0105249_10133349
301 Ga0105246_11644555
302 Ga0157374_11455033
303 Ga0157372_10646563
304 Ga0157372_10794517
305 Ga0157380_10111323
306 Ga0157380_10369026
307 Ga0157377_11437244
308 Ga0157379_10248822
309 Ga0157376_11002872
310 Ga0207692_10404657
311 Ga0207642_10229200
312 Ga0207699_10695667
313 Ga0207699_10768841
314 Ga0207671_11165208
315 Ga0207693_10000956
316 Ga0207693_10033604
317 Ga0207693_10259721
318 Ga0207663_10012395
319 Ga0207650_11220066
320 Ga0207700_10218211
321 Ga0207664_10707686
322 Ga0207644_10006093
323 Ga0207690_10807679
324 Ga0207669_11617751
325 Ga0207689_10842171
326 Ga0207668_10029882
327 Ga0207668_10329116
328 Ga0207668_10678238
329 Ga0207640_10328356
330 Ga0207640_10757538
331 Ga0207658_10395288
332 Ga0207677_10483204
333 Ga0207677_10743674
334 Ga0207678_10000283
335 Ga0207678_10406506
336 Ga0207702_11883048
337 Ga0207702_12253006
338 Ga0207641_10474844
339 Ga0207641_10709924
340 Ga0207674_10338349
341 Ga0207675_101980003
342 Ga0268266_10030791
343 Ga0268264_10041949
344 Ga0268264_10174481
345 Ga0316176_1131813
346 Ga0314311_1110018
347 Ga0316178_1037456
348 Ga0316180_1016297
349 Ga0316181_1080891
350 Ga0307408_100565812
351 Ga0307516_10010221
352 Ga0307413_11735073
353 Ga0307518_10004324
354 Ga0307410_10147567
355 Ga0307410_10461486
356 Ga0307406_10189562
357 Ga0307409_101350569
358 Ga0307409_102677821
359 Ga0307416_102069546
360 Ga0307415_100380797
361 Ga0307415_100498615
362 Ga0307507_10005422
363 Ga0373923_0069493
364 Ga0373956_0001217
365 Ga0373957_0359917
366 Ga0373943_0978814
367 Ga0373946_0331918
368 Ga0373925_0324495
369 Ga0373925_0896933
370 Ga0436364_0024877
371 Ga0436365_0948091
372 Ga0451793_0158493
373 Ga0451800_1226994
374 Ga0451802_1336335
375 Ga0466969_0076956
376 Ga0466965_0000262
377 Ga0466965_0004824
378 Ga0466965_0122706
379 Ga0466965_0169550
380 Ga0466965_0278995
381 Ga0466965_0674994
382 Ga0466966_0583194
383 Ga0466966_0799433
384 Ga0466961_0021388
385 Ga0466961_0177178
386 Ga0466961_0292660
387 Ga0466961_0467647
388 Ga0466963_0601917
389 Ga0466963_0692568
390 Ga0466963_0725839
391 Ga0466963_0837724
392 Ga0466963_1197060
393 Ga0466964_0119624
394 Ga0466971_0242274
395 Ga0466970_0020717
396 Ga0466970_0025653
397 Ga0466970_0453772
398 Ga0466957_0460419
399 Ga0466957_1319807
400 Ga0466960_0017104
401 Ga0466960_0022205
402 Ga0466960_0035097
403 Ga0466960_0325823
404 Ga0466959_0386751
405 Ga0466958_0096989
406 Ga0466958_0128568
407 Ga0466967_0030320
408 Ga0466967_0039848
409 Ga0466967_0470173
410 Ga0466967_0775808
411 Ga0466967_1079582
412 Ga0466967_1408720
413 Ga0495592_0150119
414 Ga0495603_0143985
415 Ga0495641_0269355
416 Ga0495650_0009599
417 Ga0495594_0043891
418 Ga0495667_0764155
419 Ga0495613_0725017
420 Ga0495581_0440668
421 Ga0495674_0710805
422 Ga0495680_0022405
423 Ga0495684_0056623
424 Ga0495684_0114170
425 Ga0496100_0083061
426 Ga0496100_0557554
427 Ga0496101_0006805
428 Ga0496102_0032772
429 Ga0496102_0105980
430 Ga0496103_0081462
431 Ga0496103_0723306
432 Ga0496104_0017547
433 Ga0496104_0700530
434 Ga0496104_0788428
435 Ga0496104_1491809
436 Ga0496105_0034433
437 Ga0496106_0001850
438 Ga0496106_1390384
439 Ga0496107_0036501
440 Ga0496108_0015623
441 Ga0496109_0007930
442 Ga0496110_0058086
443 Ga0496111_0072467
444 Ga0496112_0161698
445 Ga0496112_0298720
446 Ga0496112_0376550
447 Ga0496113_0336784
448 Ga0496114_0091935
449 Ga0496115_0072125
450 Ga0496118_0124826
451 Ga0496119_0000333
452 Ga0496120_0015310
453 Ga0496125_0655940
454 Ga0496126_0046227
455 Ga0501031_0163983
456 Ga0501031_0352885
457 Ga0501036_0308170
458 Ga0501036_1309364
459 Ga0501037_0322895
460 Ga0501038_0208656
461 Ga0501038_0615143
462 Ga0501039_0201008
463 Ga0501047_0008540
464 Ga0501047_0215309
465 Ga0501047_0938331
466 Ga0501048_0825741
467 Ga0501070_0597715
468 Ga0501071_0256543
469 Ga0501072_0090730
470 Ga0501075_0191932
471 Ga0501079_1013070
472 Ga0501035_0063916
473 Ga0501044_0716455
474 Ga0501044_1063839
475 Ga0501044_1276127
476 nmdc:mga05p37_1265163_c1
477 nmdc:mga09592_585706_c1
478 nmdc:mga0qj67_467392_c1
479 nmdc:mga0qj67_51972_c1
480 nmdc:mga06r32_25610_c1
481 nmdc:mga0n895_875940_c1
482 nmdc:mga0rr50_1858476_c1
483 Ga0500646_0000049
484 Ga0500583_0007422
485 Ga0500641_0070936
486 Ga0500588_0007390
487 Ga0500633_0144054
488 Ga0466962_0200897
489 2558906221
490 2586063882
491 2776370202
492 2809586871
493 2855684414
494 2863074183
495 2867302573
496 2870786389
497 2915358926
498 2915775609
499 2917739614
500 2990089805
501 2997452248
502 8053950557
503 8054472433
504 8055071886

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

13

141

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9765 2 132
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9621 2 132
2oba-assembly1.cif.gz_D pseudomonas aeruginosa 6-pyruvoyl tetrahydrobiopterin synthase 0.8586 2 128
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8509 2 130
2dtt-assembly2.cif.gz_D crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8451 2 130
ID Description Score Start End Superfamily
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9792 2 132 3.30.479.10
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9575 2 132 3.30.479.10
2dttD00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8451 2 130 3.30.479.10
af_Q58668_4_160_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8301 9 132 3.30.479.10
2dttD00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.823 2 130 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A7D6C5J4-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9872 1 132 GO:0046872
GO:0070497
AF-A0A840VRJ5-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9861 4 132 GO:0016829
GO:0046872
AF-A0A1Q9SV15-F1-model_v4 deleted 0.9833 1 132
AF-C9ZBP0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.983 2 132 GO:0046872
GO:0070497
AF-A0A318W0Z4-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9828 1 132 GO:0046872
GO:0070497

Map