F363350
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 252 | 136 | 252 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300031824|Ga0307413_10588444|Ga0307413_105884442 |
| Length | 154 |
| Sequence | MRTKLILVPLLLCSGPAFAQAAAPVAPPRPAPDAGEQMQRVLNDPVMADRLANMVQALSKSFLNLPAGEIQAAAEGRKPTRAERRMTVRDMGRQGDPNFERDFERQIANSKPMIEQSMRALSQALPAMMKGMEDAGKALERAAANMPDPTYPKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 64 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 100 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 102 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 103 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 104 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 105 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 107 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 108 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 109 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 110 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 111 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 112 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 113 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 116 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 117 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 118 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 119 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 120 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 121 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 122 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 123 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 124 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 130 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 134 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 135 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 136 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.4 |
| Nodule | 0 |
| Rhizoplane | 1.19 |
| Rhizosphere | 97.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10074555 | 3300001989 | Bacteria | 1050 |
| 2 | JGI24737J22298_10020359 | 3300001990 | Bacteria | 2118 |
| 3 | JGI24737J22298_10219395 | 3300001990 | Bacteria | 561 |
| 4 | Ga0065715_10111701 | 3300005293 | Bacteria | 2562 |
| 5 | Ga0070658_10027425 | 3300005327 | Bacteria | 4571 |
| 6 | Ga0070658_10111311 | 3300005327 | Bacteria | 2269 |
| 7 | Ga0070658_10134920 | 3300005327 | Bacteria | 2058 |
| 8 | Ga0070658_10628354 | 3300005327 | Bacteria | 931 |
| 9 | Ga0070676_10135126 | 3300005328 | Bacteria | 1564 |
| 10 | Ga0070670_100554815 | 3300005331 | Bacteria | 1025 |
| 11 | Ga0070670_101039161 | 3300005331 | Unclassified | 746 |
| 12 | Ga0068869_101377063 | 3300005334 | Bacteria | 624 |
| 13 | Ga0070666_10264471 | 3300005335 | Bacteria | 1220 |
| 14 | Ga0070666_10271464 | 3300005335 | Bacteria | 1204 |
| 15 | Ga0070666_10340691 | 3300005335 | Bacteria | 1071 |
| 16 | Ga0068868_100471712 | 3300005338 | Bacteria | 1095 |
| 17 | Ga0068868_100626240 | 3300005338 | Bacteria | 956 |
| 18 | Ga0070660_100579035 | 3300005339 | Bacteria | 938 |
| 19 | Ga0070660_101282526 | 3300005339 | Unclassified | 621 |
| 20 | Ga0070660_101555943 | 3300005339 | Bacteria | 562 |
| 21 | Ga0070660_101640509 | 3300005339 | Unclassified | 547 |
| 22 | Ga0070660_101936603 | 3300005339 | Unclassified | 502 |
| 23 | Ga0070661_100027492 | 3300005344 | Bacteria | 4096 |
| 24 | Ga0070661_100546187 | 3300005344 | Bacteria | 932 |
| 25 | Ga0070661_101104533 | 3300005344 | Unclassified | 661 |
| 26 | Ga0070669_100060182 | 3300005353 | Bacteria | 2790 |
| 27 | Ga0070669_100710992 | 3300005353 | Bacteria | 849 |
| 28 | Ga0070669_101325138 | 3300005353 | Unclassified | 624 |
| 29 | Ga0070675_100044712 | 3300005354 | Bacteria | 3621 |
| 30 | Ga0070675_100899750 | 3300005354 | Bacteria | 811 |
| 31 | Ga0070671_100038062 | 3300005355 | Bacteria | 3992 |
| 32 | Ga0070671_100052997 | 3300005355 | Bacteria | 3373 |
| 33 | Ga0070671_100898841 | 3300005355 | Bacteria | 773 |
| 34 | Ga0070671_101073915 | 3300005355 | Bacteria | 706 |
| 35 | Ga0070673_100796303 | 3300005364 | Bacteria | 872 |
| 36 | Ga0070673_100971639 | 3300005364 | Bacteria | 790 |
| 37 | Ga0070659_100373695 | 3300005366 | Bacteria | 1199 |
| 38 | Ga0070667_100001884 | 3300005367 | Bacteria | 18622 |
| 39 | Ga0070667_100098420 | 3300005367 | Bacteria | 2524 |
| 40 | Ga0070667_101899843 | 3300005367 | Bacteria | 560 |
| 41 | Ga0070714_100772112 | 3300005435 | Bacteria | 930 |
| 42 | Ga0070714_100999915 | 3300005435 | Bacteria | 814 |
| 43 | Ga0070663_100424125 | 3300005455 | Bacteria | 1091 |
| 44 | Ga0070663_100568521 | 3300005455 | Bacteria | 950 |
| 45 | Ga0070663_101131707 | 3300005455 | Unclassified | 685 |
| 46 | Ga0070662_100698469 | 3300005457 | Bacteria | 858 |
| 47 | Ga0068867_100178552 | 3300005459 | Bacteria | 1687 |
| 48 | Ga0070679_100429898 | 3300005530 | Bacteria | 1265 |
| 49 | Ga0070679_100529210 | 3300005530 | Bacteria | 1123 |
| 50 | Ga0068853_100270865 | 3300005539 | Bacteria | 1563 |
| 51 | Ga0070696_100806917 | 3300005546 | Bacteria | 773 |
| 52 | Ga0070665_101098490 | 3300005548 | Bacteria | 807 |
| 53 | Ga0068855_100521038 | 3300005563 | Bacteria | 1290 |
| 54 | Ga0070664_100467363 | 3300005564 | Bacteria | 1159 |
| 55 | Ga0068857_101422226 | 3300005577 | Bacteria | 675 |
| 56 | Ga0068854_100428257 | 3300005578 | Bacteria | 1100 |
| 57 | Ga0068856_100389811 | 3300005614 | Bacteria | 1413 |
| 58 | Ga0068859_100003695 | 3300005617 | Bacteria | 15598 |
| 59 | Ga0068859_100029607 | 3300005617 | Bacteria | 5494 |
| 60 | Ga0068864_100000445 | 3300005618 | Bacteria | 35742 |
| 61 | Ga0068864_100254137 | 3300005618 | Bacteria | 1633 |
| 62 | Ga0068861_101562020 | 3300005719 | Unclassified | 649 |
| 63 | Ga0068863_100002582 | 3300005841 | Bacteria | 17960 |
| 64 | Ga0068863_100010123 | 3300005841 | Bacteria | 9169 |
| 65 | Ga0068863_100371787 | 3300005841 | Bacteria | 1395 |
| 66 | Ga0068858_100007090 | 3300005842 | Bacteria | 10881 |
| 67 | Ga0068858_100223249 | 3300005842 | Bacteria | 1785 |
| 68 | Ga0068860_100006703 | 3300005843 | Bacteria | 11558 |
| 69 | Ga0068860_100619532 | 3300005843 | Bacteria | 1089 |
| 70 | Ga0068862_100123543 | 3300005844 | Bacteria | 2284 |
| 71 | Ga0097621_100027619 | 3300006237 | Bacteria | 4465 |
| 72 | Ga0068871_100569341 | 3300006358 | Bacteria | 1027 |
| 73 | Ga0075428_100065031 | 3300006844 | Bacteria | 3994 |
| 74 | Ga0075431_100069522 | 3300006847 | Bacteria | 3633 |
| 75 | Ga0068865_100289681 | 3300006881 | Bacteria | 1307 |
| 76 | Ga0097620_100003694 | 3300006931 | Bacteria | 15598 |
| 77 | Ga0097620_100029606 | 3300006931 | Bacteria | 5494 |
| 78 | Ga0105250_10012462 | 3300009092 | Bacteria | 3509 |
| 79 | Ga0105245_11335451 | 3300009098 | Bacteria | 766 |
| 80 | Ga0114129_11689447 | 3300009147 | Bacteria | 773 |
| 81 | Ga0105241_10907430 | 3300009174 | Bacteria | 819 |
| 82 | Ga0105248_10000621 | 3300009177 | Bacteria | 40351 |
| 83 | Ga0105248_10011069 | 3300009177 | Bacteria | 9949 |
| 84 | Ga0105248_10065954 | 3300009177 | Bacteria | 4065 |
| 85 | Ga0105249_10131827 | 3300009553 | Bacteria | 2387 |
| 86 | Ga0105249_11031942 | 3300009553 | Bacteria | 891 |
| 87 | Ga0105239_11829137 | 3300010375 | Unclassified | 704 |
| 88 | Ga0105246_12081918 | 3300011119 | Bacteria | 549 |
| 89 | Ga0157371_10259804 | 3300013102 | Bacteria | 1252 |
| 90 | Ga0157369_10630839 | 3300013105 | Bacteria | 1106 |
| 91 | Ga0157374_10693305 | 3300013296 | Bacteria | 1031 |
| 92 | Ga0157378_10209398 | 3300013297 | Bacteria | 1848 |
| 93 | Ga0157378_10499001 | 3300013297 | Bacteria | 1215 |
| 94 | Ga0163162_10048909 | 3300013306 | Bacteria | 4237 |
| 95 | Ga0157372_10777951 | 3300013307 | Bacteria | 1113 |
| 96 | Ga0157372_10893068 | 3300013307 | Bacteria | 1031 |
| 97 | Ga0157375_10123503 | 3300013308 | Bacteria | 2701 |
| 98 | Ga0157375_11029396 | 3300013308 | Bacteria | 962 |
| 99 | Ga0157375_11677068 | 3300013308 | Unclassified | 752 |
| 100 | Ga0163163_10000282 | 3300014325 | Bacteria | 50623 |
| 101 | Ga0157380_10192545 | 3300014326 | Bacteria | 1802 |
| 102 | Ga0157379_10065938 | 3300014968 | Bacteria | 3237 |
| 103 | Ga0163161_10476670 | 3300017792 | Bacteria | 1012 |
| 104 | Ga0213876_10006881 | 3300021384 | Bacteria | 6199 |
| 105 | Ga0207656_10102542 | 3300025321 | Bacteria | 1313 |
| 106 | Ga0207696_1023227 | 3300025711 | Bacteria | 1958 |
| 107 | Ga0207680_10813931 | 3300025903 | Bacteria | 670 |
| 108 | Ga0207647_10124360 | 3300025904 | Bacteria | 1519 |
| 109 | Ga0207645_10066613 | 3300025907 | Bacteria | 2302 |
| 110 | Ga0207645_10123736 | 3300025907 | Bacteria | 1680 |
| 111 | Ga0207705_10005025 | 3300025909 | Bacteria | 9921 |
| 112 | Ga0207705_10113919 | 3300025909 | Bacteria | 2000 |
| 113 | Ga0207705_10148997 | 3300025909 | Bacteria | 1752 |
| 114 | Ga0207657_10019305 | 3300025919 | Bacteria | 6477 |
| 115 | Ga0207657_10100604 | 3300025919 | Bacteria | 2400 |
| 116 | Ga0207657_10144669 | 3300025919 | Bacteria | 1940 |
| 117 | Ga0207657_10524251 | 3300025919 | Bacteria | 927 |
| 118 | Ga0207649_10026064 | 3300025920 | Bacteria | 3416 |
| 119 | Ga0207649_10204211 | 3300025920 | Bacteria | 1398 |
| 120 | Ga0207652_10254622 | 3300025921 | Bacteria | 1583 |
| 121 | Ga0207652_10395106 | 3300025921 | Bacteria | 1248 |
| 122 | Ga0207652_11039372 | 3300025921 | Bacteria | 719 |
| 123 | Ga0207650_10261108 | 3300025925 | Bacteria | 1405 |
| 124 | Ga0207650_10591109 | 3300025925 | Bacteria | 933 |
| 125 | Ga0207659_10035314 | 3300025926 | Bacteria | 3454 |
| 126 | Ga0207659_10682373 | 3300025926 | Bacteria | 879 |
| 127 | Ga0207687_10852961 | 3300025927 | Bacteria | 778 |
| 128 | Ga0207644_10036165 | 3300025931 | Bacteria | 3465 |
| 129 | Ga0207644_10054207 | 3300025931 | Bacteria | 2887 |
| 130 | Ga0207644_10390462 | 3300025931 | Bacteria | 1136 |
| 131 | Ga0207644_10499145 | 3300025931 | Bacteria | 1004 |
| 132 | Ga0207690_10526985 | 3300025932 | Bacteria | 958 |
| 133 | Ga0207690_11542768 | 3300025932 | Bacteria | 555 |
| 134 | Ga0207706_10021306 | 3300025933 | Bacteria | 5823 |
| 135 | Ga0207706_10699151 | 3300025933 | Bacteria | 866 |
| 136 | Ga0207711_10000440 | 3300025941 | Bacteria | 43290 |
| 137 | Ga0207711_10006806 | 3300025941 | Bacteria | 9606 |
| 138 | Ga0207711_10071863 | 3300025941 | Bacteria | 3004 |
| 139 | Ga0207689_10279388 | 3300025942 | Bacteria | 1383 |
| 140 | Ga0207679_10772213 | 3300025945 | Bacteria | 875 |
| 141 | Ga0207679_11156937 | 3300025945 | Bacteria | 710 |
| 142 | Ga0207667_10689025 | 3300025949 | Bacteria | 1025 |
| 143 | Ga0207651_10055251 | 3300025960 | Bacteria | 2726 |
| 144 | Ga0207712_10087735 | 3300025961 | Bacteria | 2282 |
| 145 | Ga0207658_10001550 | 3300025986 | Bacteria | 17809 |
| 146 | Ga0207658_10001869 | 3300025986 | Bacteria | 15760 |
| 147 | Ga0207658_10744975 | 3300025986 | Bacteria | 887 |
| 148 | Ga0207658_11003022 | 3300025986 | Bacteria | 762 |
| 149 | Ga0207677_10310340 | 3300026023 | Bacteria | 1307 |
| 150 | Ga0207677_10527239 | 3300026023 | Bacteria | 1026 |
| 151 | Ga0207703_10005250 | 3300026035 | Bacteria | 10446 |
| 152 | Ga0207639_10449943 | 3300026041 | Bacteria | 1169 |
| 153 | Ga0207678_10004385 | 3300026067 | Bacteria | 12694 |
| 154 | Ga0207678_10013251 | 3300026067 | Bacteria | 7235 |
| 155 | Ga0207678_10044233 | 3300026067 | Bacteria | 3852 |
| 156 | Ga0207678_10203533 | 3300026067 | Bacteria | 1693 |
| 157 | Ga0207702_10324458 | 3300026078 | Bacteria | 1467 |
| 158 | Ga0207641_10000330 | 3300026088 | Bacteria | 58123 |
| 159 | Ga0207641_10292776 | 3300026088 | Bacteria | 1535 |
| 160 | Ga0207648_10024712 | 3300026089 | Bacteria | 5359 |
| 161 | Ga0207676_10001166 | 3300026095 | Bacteria | 19777 |
| 162 | Ga0207676_10237325 | 3300026095 | Bacteria | 1633 |
| 163 | Ga0207674_10142348 | 3300026116 | Bacteria | 2357 |
| 164 | Ga0207674_10297030 | 3300026116 | Bacteria | 1564 |
| 165 | Ga0207675_102003620 | 3300026118 | Unclassified | 596 |
| 166 | Ga0207698_10368239 | 3300026142 | Bacteria | 1363 |
| 167 | Ga0207698_10670090 | 3300026142 | Bacteria | 1029 |
| 168 | Ga0268265_10076666 | 3300028380 | Bacteria | 2623 |
| 169 | Ga0268265_10264304 | 3300028380 | Bacteria | 1531 |
| 170 | Ga0268265_11605060 | 3300028380 | Bacteria | 655 |
| 171 | Ga0268264_10029534 | 3300028381 | Bacteria | 4491 |
| 172 | Ga0268264_11334621 | 3300028381 | Bacteria | 727 |
| 173 | Ga0307408_100660884 | 3300031548 | Bacteria | 935 |
| 174 | Ga0307408_100834996 | 3300031548 | Bacteria | 839 |
| 175 | Ga0307408_101648420 | 3300031548 | Bacteria | 610 |
| 176 | Ga0307405_10140703 | 3300031731 | Bacteria | 1682 |
| 177 | Ga0307405_10182778 | 3300031731 | Bacteria | 1507 |
| 178 | Ga0307405_10267062 | 3300031731 | Bacteria | 1281 |
| 179 | Ga0307405_10762381 | 3300031731 | Bacteria | 807 |
| 180 | Ga0307413_10010356 | 3300031824 | Bacteria | 4518 |
| 181 | Ga0307413_10146696 | 3300031824 | Bacteria | 1639 |
| 182 | Ga0307413_10588444 | 3300031824 | Bacteria | 909 |
| 183 | Ga0307410_10009569 | 3300031852 | Bacteria | 5444 |
| 184 | Ga0307410_10319261 | 3300031852 | Bacteria | 1232 |
| 185 | Ga0307410_11283751 | 3300031852 | Bacteria | 640 |
| 186 | Ga0307406_10082795 | 3300031901 | Bacteria | 2138 |
| 187 | Ga0307406_10230634 | 3300031901 | Bacteria | 1382 |
| 188 | Ga0307406_10609224 | 3300031901 | Bacteria | 901 |
| 189 | Ga0307407_10333919 | 3300031903 | Bacteria | 1068 |
| 190 | Ga0307407_10663428 | 3300031903 | Bacteria | 782 |
| 191 | Ga0307412_10405627 | 3300031911 | Bacteria | 1111 |
| 192 | Ga0307412_10531879 | 3300031911 | Bacteria | 984 |
| 193 | Ga0307409_100030739 | 3300031995 | Bacteria | 3864 |
| 194 | Ga0307409_100053010 | 3300031995 | Bacteria | 3114 |
| 195 | Ga0307409_100636976 | 3300031995 | Bacteria | 1058 |
| 196 | Ga0307409_101006466 | 3300031995 | Bacteria | 852 |
| 197 | Ga0307416_101070536 | 3300032002 | Bacteria | 910 |
| 198 | Ga0307416_101635783 | 3300032002 | Bacteria | 749 |
| 199 | Ga0307416_103136054 | 3300032002 | Bacteria | 553 |
| 200 | Ga0307414_10140445 | 3300032004 | Bacteria | 1890 |
| 201 | Ga0307414_10416208 | 3300032004 | Bacteria | 1171 |
| 202 | Ga0307414_11069062 | 3300032004 | Bacteria | 744 |
| 203 | Ga0307411_10041177 | 3300032005 | Bacteria | 2937 |
| 204 | Ga0307411_10184343 | 3300032005 | Bacteria | 1587 |
| 205 | Ga0307411_10216731 | 3300032005 | Bacteria | 1482 |
| 206 | Ga0307411_10317696 | 3300032005 | Bacteria | 1256 |
| 207 | Ga0307415_100066045 | 3300032126 | Bacteria | 2523 |
| 208 | Ga0307415_100206340 | 3300032126 | Bacteria | 1564 |
| 209 | Ga0307415_100442979 | 3300032126 | Bacteria | 1121 |
| 210 | Ga0307415_100503456 | 3300032126 | Bacteria | 1059 |
| 211 | Ga0307415_101118166 | 3300032126 | Bacteria | 738 |
| 212 | Ga0395900_0039439 | 3300037418 | Bacteria | 4866 |
| 213 | Ga0395900_0385642 | 3300037418 | Bacteria | 1368 |
| 214 | Ga0395900_0584078 | 3300037418 | Bacteria | 1059 |
| 215 | Ga0395900_1319226 | 3300037418 | Bacteria | 635 |
| 216 | Ga0395898_0295268 | 3300037466 | Bacteria | 1546 |
| 217 | Ga0395898_0664825 | 3300037466 | Bacteria | 984 |
| 218 | Ga0395898_1141100 | 3300037466 | Bacteria | 712 |
| 219 | Ga0395905_0053330 | 3300037471 | Bacteria | 3785 |
| 220 | Ga0395905_0288349 | 3300037471 | Bacteria | 1528 |
| 221 | Ga0395905_0294597 | 3300037471 | Bacteria | 1509 |
| 222 | Ga0395905_0307091 | 3300037471 | Bacteria | 1474 |
| 223 | Ga0395905_0308985 | 3300037471 | Bacteria | 1469 |
| 224 | Ga0395901_0436898 | 3300038443 | Bacteria | 1340 |
| 225 | Ga0395901_0509402 | 3300038443 | Bacteria | 1224 |
| 226 | Ga0395901_1033808 | 3300038443 | Bacteria | 795 |
| 227 | Ga0395901_1089322 | 3300038443 | Bacteria | 770 |
| 228 | Ga0436365_1326608 | 3300039437 | Bacteria | 11233 |
| 229 | Ga0436363_0421745 | 3300039450 | Bacteria | 4588 |
| 230 | Ga0450917_002524 | 3300042120 | Bacteria | 1309 |
| 231 | Ga0450889_002176 | 3300042144 | Bacteria | 1969 |
| 232 | Ga0450889_018337 | 3300042144 | Bacteria | 765 |
| 233 | Ga0439458_0035585 | 3300042157 | Bacteria | 1197 |
| 234 | Ga0450908_029156 | 3300042184 | Bacteria | 960 |
| 235 | Ga0466965_0196609 | 3300044683 | Bacteria | 1068 |
| 236 | Ga0466960_0197683 | 3300044901 | Bacteria | 1097 |
| 237 | Ga0466967_1965687 | 3300045976 | Bacteria | 581 |
| 238 | Ga0495585_0101120 | 3300046492 | Bacteria | 1542 |
| 239 | Ga0495633_0048378 | 3300046558 | Bacteria | 2008 |
| 240 | Ga0495668_0029543 | 3300046616 | Bacteria | 3096 |
| 241 | Ga0495659_0020748 | 3300046664 | Bacteria | 2210 |
| 242 | Ga0495659_0530200 | 3300046664 | Bacteria | 518 |
| 243 | Ga0495670_0171783 | 3300046691 | Bacteria | 1142 |
| 244 | Ga0495670_0381950 | 3300046691 | Bacteria | 760 |
| 245 | Ga0496107_0299221 | 3300048910 | Bacteria | 1197 |
| 246 | Ga0496108_0487270 | 3300048911 | Bacteria | 1077 |
| 247 | Ga0496109_0109315 | 3300048912 | Bacteria | 2570 |
| 248 | Ga0501069_0188932 | 3300049585 | Bacteria | 1192 |
| 249 | Ga0501233_115371 | 3300049668 | Bacteria | 721 |
| 250 | Ga0501257_037142 | 3300049686 | Bacteria | 1188 |
| 251 | nmdc:mga00v17_680619_c1 | 3300050491 | Unclassified | 660 |
| 252 | nmdc:mga06r32_26847_c1 | 3300050510 | Bacteria | 5373 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005335 | Ga0070666_10271464 | Ga0070666_102714642 | 104 |
| 2 | 3300028380 | Ga0268265_11605060 | Ga0268265_116050602 | 105 |
| 3 | 3300006881 | Ga0068865_100289681 | Ga0068865_1002896811 | 106 |
| 4 | 3300042144 | Ga0450889_018337 | Ga0450889_018337_245_598 | 107 |
| 5 | 3300005293 | Ga0065715_10111701 | Ga0065715_101117013 | 109 |
| 6 | 3300031901 | Ga0307406_10230634 | Ga0307406_102306342 | 109 |
| 7 | 3300032002 | Ga0307416_101635783 | Ga0307416_1016357832 | 109 |
| 8 | 3300050491 | nmdc:mga00v17_680619_c1 | nmdc:mga00v17_680619_c1_158_586 | 109 |
| 9 | 3300014326 | Ga0157380_10192545 | Ga0157380_101925452 | 112 |
| 10 | 3300005353 | Ga0070669_101325138 | Ga0070669_1013251381 | 114 |
| 11 | 3300005844 | Ga0068862_100123543 | Ga0068862_1001235432 | 114 |
| 12 | 3300006237 | Ga0097621_100027619 | Ga0097621_1000276195 | 114 |
| 13 | 3300006358 | Ga0068871_100569341 | Ga0068871_1005693412 | 114 |
| 14 | 3300028380 | Ga0268265_10264304 | Ga0268265_102643043 | 114 |
| 15 | 3300046616 | Ga0495668_0029543 | Ga0495668_0029543_456_881 | 114 |
| 16 | 3300048911 | Ga0496108_0487270 | Ga0496108_0487270_446_892 | 114 |
| 17 | 3300005334 | Ga0068869_101377063 | Ga0068869_1013770631 | 115 |
| 18 | 3300005530 | Ga0070679_100529210 | Ga0070679_1005292101 | 115 |
| 19 | 3300025907 | Ga0207645_10066613 | Ga0207645_100666133 | 115 |
| 20 | 3300025921 | Ga0207652_10254622 | Ga0207652_102546222 | 115 |
| 21 | 3300025931 | Ga0207644_10390462 | Ga0207644_103904622 | 115 |
| 22 | 3300025945 | Ga0207679_10772213 | Ga0207679_107722132 | 115 |
| 23 | 3300046664 | Ga0495659_0530200 | Ga0495659_0530200_26_409 | 115 |
| 24 | 3300013308 | Ga0157375_11677068 | Ga0157375_116770681 | 116 |
| 25 | 3300025903 | Ga0207680_10813931 | Ga0207680_108139311 | 116 |
| 26 | 3300005338 | Ga0068868_100626240 | Ga0068868_1006262402 | 117 |
| 27 | 3300005364 | Ga0070673_100796303 | Ga0070673_1007963032 | 117 |
| 28 | 3300025920 | Ga0207649_10204211 | Ga0207649_102042112 | 117 |
| 29 | 3300025933 | Ga0207706_10021306 | Ga0207706_100213062 | 117 |
| 30 | 3300026142 | Ga0207698_10670090 | Ga0207698_106700901 | 117 |
| 31 | 3300031903 | Ga0307407_10333919 | Ga0307407_103339192 | 117 |
| 32 | 3300037466 | Ga0395898_0664825 | Ga0395898_0664825_185_643 | 117 |
| 33 | 3300005335 | Ga0070666_10340691 | Ga0070666_103406911 | 118 |
| 34 | 3300005344 | Ga0070661_101104533 | Ga0070661_1011045331 | 118 |
| 35 | 3300005355 | Ga0070671_100898841 | Ga0070671_1008988411 | 118 |
| 36 | 3300005539 | Ga0068853_100270865 | Ga0068853_1002708652 | 118 |
| 37 | 3300009174 | Ga0105241_10907430 | Ga0105241_109074301 | 118 |
| 38 | 3300013307 | Ga0157372_10893068 | Ga0157372_108930682 | 118 |
| 39 | 3300025919 | Ga0207657_10019305 | Ga0207657_100193058 | 118 |
| 40 | 3300025932 | Ga0207690_10526985 | Ga0207690_105269852 | 118 |
| 41 | 3300025945 | Ga0207679_11156937 | Ga0207679_111569371 | 118 |
| 42 | 3300026116 | Ga0207674_10142348 | Ga0207674_101423482 | 118 |
| 43 | 3300037418 | Ga0395900_1319226 | Ga0395900_1319226_177_605 | 118 |
| 44 | 3300037466 | Ga0395898_0295268 | Ga0395898_0295268_93_521 | 118 |
| 45 | 3300037471 | Ga0395905_0308985 | Ga0395905_0308985_237_665 | 118 |
| 46 | 3300038443 | Ga0395901_1033808 | Ga0395901_1033808_152_610 | 118 |
| 47 | 3300049585 | Ga0501069_0188932 | Ga0501069_0188932_254_697 | 118 |
| 48 | 3300005331 | Ga0070670_100554815 | Ga0070670_1005548152 | 119 |
| 49 | 3300005354 | Ga0070675_100044712 | Ga0070675_1000447123 | 119 |
| 50 | 3300013297 | Ga0157378_10499001 | Ga0157378_104990012 | 119 |
| 51 | 3300013308 | Ga0157375_10123503 | Ga0157375_101235032 | 119 |
| 52 | 3300025925 | Ga0207650_10261108 | Ga0207650_102611082 | 119 |
| 53 | 3300025926 | Ga0207659_10035314 | Ga0207659_100353143 | 119 |
| 54 | 3300026067 | Ga0207678_10044233 | Ga0207678_100442335 | 119 |
| 55 | 3300048912 | Ga0496109_0109315 | Ga0496109_0109315_703_1152 | 119 |
| 56 | 3300005327 | Ga0070658_10111311 | Ga0070658_101113112 | 121 |
| 57 | 3300005546 | Ga0070696_100806917 | Ga0070696_1008069171 | 121 |
| 58 | 3300025909 | Ga0207705_10148997 | Ga0207705_101489972 | 121 |
| 59 | 3300031548 | Ga0307408_100660884 | Ga0307408_1006608842 | 121 |
| 60 | 3300031731 | Ga0307405_10182778 | Ga0307405_101827782 | 121 |
| 61 | 3300031824 | Ga0307413_10010356 | Ga0307413_100103563 | 121 |
| 62 | 3300031824 | Ga0307413_10146696 | Ga0307413_101466962 | 121 |
| 63 | 3300031852 | Ga0307410_10319261 | Ga0307410_103192611 | 121 |
| 64 | 3300031852 | Ga0307410_11283751 | Ga0307410_112837512 | 121 |
| 65 | 3300031901 | Ga0307406_10609224 | Ga0307406_106092242 | 121 |
| 66 | 3300031903 | Ga0307407_10663428 | Ga0307407_106634281 | 121 |
| 67 | 3300031911 | Ga0307412_10405627 | Ga0307412_104056272 | 121 |
| 68 | 3300032005 | Ga0307411_10317696 | Ga0307411_103176962 | 121 |
| 69 | 3300032126 | Ga0307415_100503456 | Ga0307415_1005034561 | 121 |
| 70 | 3300037418 | Ga0395900_0039439 | Ga0395900_0039439_3661_4125 | 121 |
| 71 | 3300037418 | Ga0395900_0385642 | Ga0395900_0385642_497_952 | 121 |
| 72 | 3300037471 | Ga0395905_0294597 | Ga0395905_0294597_701_1165 | 121 |
| 73 | 3300037471 | Ga0395905_0307091 | Ga0395905_0307091_971_1426 | 121 |
| 74 | 3300038443 | Ga0395901_0436898 | Ga0395901_0436898_806_1270 | 121 |
| 75 | 3300044683 | Ga0466965_0196609 | Ga0466965_0196609_16_429 | 121 |
| 76 | 3300038443 | Ga0395901_0509402 | Ga0395901_0509402_11_439 | 122 |
| 77 | 3300046664 | Ga0495659_0020748 | Ga0495659_0020748_953_1378 | 122 |
| 78 | 3300005338 | Ga0068868_100471712 | Ga0068868_1004717122 | 123 |
| 79 | 3300005353 | Ga0070669_100060182 | Ga0070669_1000601823 | 123 |
| 80 | 3300005355 | Ga0070671_100038062 | Ga0070671_1000380624 | 123 |
| 81 | 3300005364 | Ga0070673_100971639 | Ga0070673_1009716391 | 123 |
| 82 | 3300005367 | Ga0070667_100001884 | Ga0070667_10000188418 | 123 |
| 83 | 3300005455 | Ga0070663_100568521 | Ga0070663_1005685212 | 123 |
| 84 | 3300005457 | Ga0070662_100698469 | Ga0070662_1006984691 | 123 |
| 85 | 3300005563 | Ga0068855_100521038 | Ga0068855_1005210382 | 123 |
| 86 | 3300005617 | Ga0068859_100003695 | Ga0068859_1000036959 | 123 |
| 87 | 3300005618 | Ga0068864_100000445 | Ga0068864_10000044523 | 123 |
| 88 | 3300005841 | Ga0068863_100002582 | Ga0068863_10000258212 | 123 |
| 89 | 3300005842 | Ga0068858_100007090 | Ga0068858_1000070908 | 123 |
| 90 | 3300005843 | Ga0068860_100006703 | Ga0068860_1000067035 | 123 |
| 91 | 3300006931 | Ga0097620_100003694 | Ga0097620_1000036949 | 123 |
| 92 | 3300009092 | Ga0105250_10012462 | Ga0105250_100124622 | 123 |
| 93 | 3300009177 | Ga0105248_10000621 | Ga0105248_100006217 | 123 |
| 94 | 3300009553 | Ga0105249_10131827 | Ga0105249_101318272 | 123 |
| 95 | 3300011119 | Ga0105246_12081918 | Ga0105246_120819181 | 123 |
| 96 | 3300013306 | Ga0163162_10048909 | Ga0163162_100489093 | 123 |
| 97 | 3300014325 | Ga0163163_10000282 | Ga0163163_1000028239 | 123 |
| 98 | 3300014968 | Ga0157379_10065938 | Ga0157379_100659382 | 123 |
| 99 | 3300017792 | Ga0163161_10476670 | Ga0163161_104766701 | 123 |
| 100 | 3300025711 | Ga0207696_1023227 | Ga0207696_10232272 | 123 |
| 101 | 3300025931 | Ga0207644_10054207 | Ga0207644_100542073 | 123 |
| 102 | 3300025933 | Ga0207706_10699151 | Ga0207706_106991512 | 123 |
| 103 | 3300025941 | Ga0207711_10000440 | Ga0207711_1000044011 | 123 |
| 104 | 3300025942 | Ga0207689_10279388 | Ga0207689_102793882 | 123 |
| 105 | 3300025949 | Ga0207667_10689025 | Ga0207667_106890252 | 123 |
| 106 | 3300025960 | Ga0207651_10055251 | Ga0207651_100552514 | 123 |
| 107 | 3300025961 | Ga0207712_10087735 | Ga0207712_100877352 | 123 |
| 108 | 3300025986 | Ga0207658_10001550 | Ga0207658_1000155018 | 123 |
| 109 | 3300026023 | Ga0207677_10310340 | Ga0207677_103103402 | 123 |
| 110 | 3300026035 | Ga0207703_10005250 | Ga0207703_100052508 | 123 |
| 111 | 3300026067 | Ga0207678_10203533 | Ga0207678_102035332 | 123 |
| 112 | 3300026088 | Ga0207641_10000330 | Ga0207641_1000033043 | 123 |
| 113 | 3300026095 | Ga0207676_10001166 | Ga0207676_100011668 | 123 |
| 114 | 3300028380 | Ga0268265_10076666 | Ga0268265_100766664 | 123 |
| 115 | 3300028381 | Ga0268264_10029534 | Ga0268264_100295344 | 123 |
| 116 | 3300031731 | Ga0307405_10762381 | Ga0307405_107623812 | 123 |
| 117 | 3300031901 | Ga0307406_10082795 | Ga0307406_100827953 | 123 |
| 118 | 3300032126 | Ga0307415_100066045 | Ga0307415_1000660453 | 123 |
| 119 | 3300037418 | Ga0395900_0584078 | Ga0395900_0584078_428_856 | 123 |
| 120 | 3300038443 | Ga0395901_1089322 | Ga0395901_1089322_126_554 | 123 |
| 121 | 3300042184 | Ga0450908_029156 | Ga0450908_029156_108_536 | 123 |
| 122 | 3300044901 | Ga0466960_0197683 | Ga0466960_0197683_419_850 | 123 |
| 123 | 3300005327 | Ga0070658_10027425 | Ga0070658_100274252 | 124 |
| 124 | 3300013307 | Ga0157372_10777951 | Ga0157372_107779512 | 124 |
| 125 | 3300025909 | Ga0207705_10113919 | Ga0207705_101139192 | 124 |
| 126 | 3300042120 | Ga0450917_002524 | Ga0450917_002524_808_1224 | 124 |
| 127 | 3300042144 | Ga0450889_002176 | Ga0450889_002176_939_1355 | 124 |
| 128 | 3300042157 | Ga0439458_0035585 | Ga0439458_0035585_346_762 | 124 |
| 129 | 3300049668 | Ga0501233_115371 | Ga0501233_115371_211_675 | 124 |
| 130 | 3300001990 | JGI24737J22298_10020359 | JGI24737J22298_100203591 | 126 |
| 131 | 3300005327 | Ga0070658_10134920 | Ga0070658_101349202 | 126 |
| 132 | 3300005327 | Ga0070658_10628354 | Ga0070658_106283542 | 126 |
| 133 | 3300005339 | Ga0070660_100579035 | Ga0070660_1005790351 | 126 |
| 134 | 3300005339 | Ga0070660_101282526 | Ga0070660_1012825261 | 126 |
| 135 | 3300005339 | Ga0070660_101555943 | Ga0070660_1015559431 | 126 |
| 136 | 3300005339 | Ga0070660_101936603 | Ga0070660_1019366031 | 126 |
| 137 | 3300005344 | Ga0070661_100027492 | Ga0070661_1000274926 | 126 |
| 138 | 3300005366 | Ga0070659_100373695 | Ga0070659_1003736952 | 126 |
| 139 | 3300005435 | Ga0070714_100772112 | Ga0070714_1007721122 | 126 |
| 140 | 3300005455 | Ga0070663_101131707 | Ga0070663_1011317071 | 126 |
| 141 | 3300005530 | Ga0070679_100429898 | Ga0070679_1004298982 | 126 |
| 142 | 3300005548 | Ga0070665_101098490 | Ga0070665_1010984902 | 126 |
| 143 | 3300005564 | Ga0070664_100467363 | Ga0070664_1004673632 | 126 |
| 144 | 3300005577 | Ga0068857_101422226 | Ga0068857_1014222261 | 126 |
| 145 | 3300005614 | Ga0068856_100389811 | Ga0068856_1003898112 | 126 |
| 146 | 3300010375 | Ga0105239_11829137 | Ga0105239_118291371 | 126 |
| 147 | 3300013102 | Ga0157371_10259804 | Ga0157371_102598042 | 126 |
| 148 | 3300013105 | Ga0157369_10630839 | Ga0157369_106308392 | 126 |
| 149 | 3300013296 | Ga0157374_10693305 | Ga0157374_106933052 | 126 |
| 150 | 3300025904 | Ga0207647_10124360 | Ga0207647_101243602 | 126 |
| 151 | 3300025909 | Ga0207705_10005025 | Ga0207705_1000502511 | 126 |
| 152 | 3300025919 | Ga0207657_10100604 | Ga0207657_101006041 | 126 |
| 153 | 3300025919 | Ga0207657_10144669 | Ga0207657_101446694 | 126 |
| 154 | 3300025920 | Ga0207649_10026064 | Ga0207649_100260642 | 126 |
| 155 | 3300025921 | Ga0207652_10395106 | Ga0207652_103951062 | 126 |
| 156 | 3300025932 | Ga0207690_11542768 | Ga0207690_115427682 | 126 |
| 157 | 3300026023 | Ga0207677_10527239 | Ga0207677_105272392 | 126 |
| 158 | 3300026041 | Ga0207639_10449943 | Ga0207639_104499432 | 126 |
| 159 | 3300026078 | Ga0207702_10324458 | Ga0207702_103244582 | 126 |
| 160 | 3300026116 | Ga0207674_10297030 | Ga0207674_102970302 | 126 |
| 161 | 3300026142 | Ga0207698_10368239 | Ga0207698_103682392 | 126 |
| 162 | 3300005435 | Ga0070714_100999915 | Ga0070714_1009999152 | 127 |
| 163 | 3300031548 | Ga0307408_100834996 | Ga0307408_1008349961 | 127 |
| 164 | 3300031548 | Ga0307408_101648420 | Ga0307408_1016484201 | 127 |
| 165 | 3300031995 | Ga0307409_100053010 | Ga0307409_1000530103 | 127 |
| 166 | 3300032004 | Ga0307414_10140445 | Ga0307414_101404452 | 127 |
| 167 | 3300032005 | Ga0307411_10216731 | Ga0307411_102167311 | 127 |
| 168 | 3300045976 | Ga0466967_1965687 | Ga0466967_1965687_73_519 | 127 |
| 169 | 3300006844 | Ga0075428_100065031 | Ga0075428_1000650312 | 128 |
| 170 | 3300009147 | Ga0114129_11689447 | Ga0114129_116894472 | 128 |
| 171 | 3300031995 | Ga0307409_101006466 | Ga0307409_1010064662 | 128 |
| 172 | 3300006847 | Ga0075431_100069522 | Ga0075431_1000695223 | 129 |
| 173 | 3300025931 | Ga0207644_10499145 | Ga0207644_104991452 | 129 |
| 174 | 3300031731 | Ga0307405_10140703 | Ga0307405_101407032 | 129 |
| 175 | 3300031731 | Ga0307405_10267062 | Ga0307405_102670621 | 129 |
| 176 | 3300031911 | Ga0307412_10531879 | Ga0307412_105318791 | 129 |
| 177 | 3300031995 | Ga0307409_100636976 | Ga0307409_1006369761 | 129 |
| 178 | 3300032002 | Ga0307416_101070536 | Ga0307416_1010705362 | 129 |
| 179 | 3300032002 | Ga0307416_103136054 | Ga0307416_1031360541 | 129 |
| 180 | 3300032004 | Ga0307414_11069062 | Ga0307414_110690621 | 129 |
| 181 | 3300032005 | Ga0307411_10041177 | Ga0307411_100411773 | 129 |
| 182 | 3300032126 | Ga0307415_100206340 | Ga0307415_1002063402 | 129 |
| 183 | 3300032126 | Ga0307415_101118166 | Ga0307415_1011181661 | 129 |
| 184 | 3300037471 | Ga0395905_0288349 | Ga0395905_0288349_493_918 | 129 |
| 185 | 3300046492 | Ga0495585_0101120 | Ga0495585_0101120_352_777 | 129 |
| 186 | 3300046691 | Ga0495670_0171783 | Ga0495670_0171783_507_938 | 129 |
| 187 | 3300050510 | nmdc:mga06r32_26847_c1 | nmdc:mga06r32_26847_c1_2735_3166 | 129 |
| 188 | 3300005328 | Ga0070676_10135126 | Ga0070676_101351262 | 130 |
| 189 | 3300005353 | Ga0070669_100710992 | Ga0070669_1007109922 | 130 |
| 190 | 3300005354 | Ga0070675_100899750 | Ga0070675_1008997502 | 130 |
| 191 | 3300005459 | Ga0068867_100178552 | Ga0068867_1001785522 | 130 |
| 192 | 3300005618 | Ga0068864_100254137 | Ga0068864_1002541372 | 130 |
| 193 | 3300005841 | Ga0068863_100371787 | Ga0068863_1003717872 | 130 |
| 194 | 3300009098 | Ga0105245_11335451 | Ga0105245_113354512 | 130 |
| 195 | 3300025321 | Ga0207656_10102542 | Ga0207656_101025421 | 130 |
| 196 | 3300025907 | Ga0207645_10123736 | Ga0207645_101237362 | 130 |
| 197 | 3300025921 | Ga0207652_11039372 | Ga0207652_110393721 | 130 |
| 198 | 3300025926 | Ga0207659_10682373 | Ga0207659_106823732 | 130 |
| 199 | 3300025927 | Ga0207687_10852961 | Ga0207687_108529612 | 130 |
| 200 | 3300025986 | Ga0207658_11003022 | Ga0207658_110030222 | 130 |
| 201 | 3300026067 | Ga0207678_10004385 | Ga0207678_100043852 | 130 |
| 202 | 3300026088 | Ga0207641_10292776 | Ga0207641_102927762 | 130 |
| 203 | 3300026089 | Ga0207648_10024712 | Ga0207648_100247123 | 130 |
| 204 | 3300026095 | Ga0207676_10237325 | Ga0207676_102373253 | 130 |
| 205 | 3300001989 | JGI24739J22299_10074555 | JGI24739J22299_100745552 | 131 |
| 206 | 3300001990 | JGI24737J22298_10219395 | JGI24737J22298_102193951 | 131 |
| 207 | 3300005331 | Ga0070670_101039161 | Ga0070670_1010391612 | 131 |
| 208 | 3300005335 | Ga0070666_10264471 | Ga0070666_102644712 | 131 |
| 209 | 3300005339 | Ga0070660_101640509 | Ga0070660_1016405091 | 131 |
| 210 | 3300005344 | Ga0070661_100546187 | Ga0070661_1005461872 | 131 |
| 211 | 3300005355 | Ga0070671_100052997 | Ga0070671_1000529973 | 131 |
| 212 | 3300005355 | Ga0070671_101073915 | Ga0070671_1010739152 | 131 |
| 213 | 3300005367 | Ga0070667_100098420 | Ga0070667_1000984202 | 131 |
| 214 | 3300005367 | Ga0070667_101899843 | Ga0070667_1018998431 | 131 |
| 215 | 3300005455 | Ga0070663_100424125 | Ga0070663_1004241252 | 131 |
| 216 | 3300005578 | Ga0068854_100428257 | Ga0068854_1004282572 | 131 |
| 217 | 3300005617 | Ga0068859_100029607 | Ga0068859_1000296073 | 131 |
| 218 | 3300005719 | Ga0068861_101562020 | Ga0068861_1015620202 | 131 |
| 219 | 3300005841 | Ga0068863_100010123 | Ga0068863_10001012311 | 131 |
| 220 | 3300005842 | Ga0068858_100223249 | Ga0068858_1002232491 | 131 |
| 221 | 3300005843 | Ga0068860_100619532 | Ga0068860_1006195322 | 131 |
| 222 | 3300006931 | Ga0097620_100029606 | Ga0097620_1000296066 | 131 |
| 223 | 3300009177 | Ga0105248_10011069 | Ga0105248_100110694 | 131 |
| 224 | 3300009177 | Ga0105248_10065954 | Ga0105248_100659545 | 131 |
| 225 | 3300009553 | Ga0105249_11031942 | Ga0105249_110319421 | 131 |
| 226 | 3300013297 | Ga0157378_10209398 | Ga0157378_102093981 | 131 |
| 227 | 3300013308 | Ga0157375_11029396 | Ga0157375_110293961 | 131 |
| 228 | 3300021384 | Ga0213876_10006881 | Ga0213876_100068816 | 131 |
| 229 | 3300025919 | Ga0207657_10524251 | Ga0207657_105242512 | 131 |
| 230 | 3300025925 | Ga0207650_10591109 | Ga0207650_105911091 | 131 |
| 231 | 3300025931 | Ga0207644_10036165 | Ga0207644_100361653 | 131 |
| 232 | 3300025941 | Ga0207711_10006806 | Ga0207711_1000680610 | 131 |
| 233 | 3300025941 | Ga0207711_10071863 | Ga0207711_100718634 | 131 |
| 234 | 3300025986 | Ga0207658_10001869 | Ga0207658_100018695 | 131 |
| 235 | 3300025986 | Ga0207658_10744975 | Ga0207658_107449752 | 131 |
| 236 | 3300026067 | Ga0207678_10013251 | Ga0207678_100132514 | 131 |
| 237 | 3300026118 | Ga0207675_102003620 | Ga0207675_1020036201 | 131 |
| 238 | 3300028381 | Ga0268264_11334621 | Ga0268264_113346211 | 131 |
| 239 | 3300031824 | Ga0307413_10588444 | Ga0307413_105884442 | 131 |
| 240 | 3300031852 | Ga0307410_10009569 | Ga0307410_100095695 | 131 |
| 241 | 3300031995 | Ga0307409_100030739 | Ga0307409_1000307393 | 131 |
| 242 | 3300032004 | Ga0307414_10416208 | Ga0307414_104162081 | 131 |
| 243 | 3300032005 | Ga0307411_10184343 | Ga0307411_101843432 | 131 |
| 244 | 3300032126 | Ga0307415_100442979 | Ga0307415_1004429792 | 131 |
| 245 | 3300037466 | Ga0395898_1141100 | Ga0395898_1141100_206_670 | 131 |
| 246 | 3300037471 | Ga0395905_0053330 | Ga0395905_0053330_1999_2439 | 131 |
| 247 | 3300039437 | Ga0436365_1326608 | Ga0436365_1326608_2119_2544 | 131 |
| 248 | 3300039450 | Ga0436363_0421745 | Ga0436363_0421745_230_655 | 131 |
| 249 | 3300046558 | Ga0495633_0048378 | Ga0495633_0048378_858_1304 | 131 |
| 250 | 3300046691 | Ga0495670_0381950 | Ga0495670_0381950_130_576 | 131 |
| 251 | 3300048910 | Ga0496107_0299221 | Ga0496107_0299221_305_736 | 131 |
| 252 | 3300049686 | Ga0501257_037142 | Ga0501257_037142_513_977 | 131 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar