F363350

General Info

Members Datasets Scaffolds Average Seq Length
252 136 252 132

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10588444|Ga0307413_105884442
Length 154
Sequence MRTKLILVPLLLCSGPAFAQAAAPVAPPRPAPDAGEQMQRVLNDPVMADRLANMVQALSKSFLNLPAGEIQAAAEGRKPTRAERRMTVRDMGRQGDPNFERDFERQIANSKPMIEQSMRALSQALPAMMKGMEDAGKALERAAANMPDPTYPKR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
118 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
119 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
120 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
134 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 1.19
Rhizosphere 97.22
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10074555 3300001989 Bacteria 1050
2 JGI24737J22298_10020359 3300001990 Bacteria 2118
3 JGI24737J22298_10219395 3300001990 Bacteria 561
4 Ga0065715_10111701 3300005293 Bacteria 2562
5 Ga0070658_10027425 3300005327 Bacteria 4571
6 Ga0070658_10111311 3300005327 Bacteria 2269
7 Ga0070658_10134920 3300005327 Bacteria 2058
8 Ga0070658_10628354 3300005327 Bacteria 931
9 Ga0070676_10135126 3300005328 Bacteria 1564
10 Ga0070670_100554815 3300005331 Bacteria 1025
11 Ga0070670_101039161 3300005331 Unclassified 746
12 Ga0068869_101377063 3300005334 Bacteria 624
13 Ga0070666_10264471 3300005335 Bacteria 1220
14 Ga0070666_10271464 3300005335 Bacteria 1204
15 Ga0070666_10340691 3300005335 Bacteria 1071
16 Ga0068868_100471712 3300005338 Bacteria 1095
17 Ga0068868_100626240 3300005338 Bacteria 956
18 Ga0070660_100579035 3300005339 Bacteria 938
19 Ga0070660_101282526 3300005339 Unclassified 621
20 Ga0070660_101555943 3300005339 Bacteria 562
21 Ga0070660_101640509 3300005339 Unclassified 547
22 Ga0070660_101936603 3300005339 Unclassified 502
23 Ga0070661_100027492 3300005344 Bacteria 4096
24 Ga0070661_100546187 3300005344 Bacteria 932
25 Ga0070661_101104533 3300005344 Unclassified 661
26 Ga0070669_100060182 3300005353 Bacteria 2790
27 Ga0070669_100710992 3300005353 Bacteria 849
28 Ga0070669_101325138 3300005353 Unclassified 624
29 Ga0070675_100044712 3300005354 Bacteria 3621
30 Ga0070675_100899750 3300005354 Bacteria 811
31 Ga0070671_100038062 3300005355 Bacteria 3992
32 Ga0070671_100052997 3300005355 Bacteria 3373
33 Ga0070671_100898841 3300005355 Bacteria 773
34 Ga0070671_101073915 3300005355 Bacteria 706
35 Ga0070673_100796303 3300005364 Bacteria 872
36 Ga0070673_100971639 3300005364 Bacteria 790
37 Ga0070659_100373695 3300005366 Bacteria 1199
38 Ga0070667_100001884 3300005367 Bacteria 18622
39 Ga0070667_100098420 3300005367 Bacteria 2524
40 Ga0070667_101899843 3300005367 Bacteria 560
41 Ga0070714_100772112 3300005435 Bacteria 930
42 Ga0070714_100999915 3300005435 Bacteria 814
43 Ga0070663_100424125 3300005455 Bacteria 1091
44 Ga0070663_100568521 3300005455 Bacteria 950
45 Ga0070663_101131707 3300005455 Unclassified 685
46 Ga0070662_100698469 3300005457 Bacteria 858
47 Ga0068867_100178552 3300005459 Bacteria 1687
48 Ga0070679_100429898 3300005530 Bacteria 1265
49 Ga0070679_100529210 3300005530 Bacteria 1123
50 Ga0068853_100270865 3300005539 Bacteria 1563
51 Ga0070696_100806917 3300005546 Bacteria 773
52 Ga0070665_101098490 3300005548 Bacteria 807
53 Ga0068855_100521038 3300005563 Bacteria 1290
54 Ga0070664_100467363 3300005564 Bacteria 1159
55 Ga0068857_101422226 3300005577 Bacteria 675
56 Ga0068854_100428257 3300005578 Bacteria 1100
57 Ga0068856_100389811 3300005614 Bacteria 1413
58 Ga0068859_100003695 3300005617 Bacteria 15598
59 Ga0068859_100029607 3300005617 Bacteria 5494
60 Ga0068864_100000445 3300005618 Bacteria 35742
61 Ga0068864_100254137 3300005618 Bacteria 1633
62 Ga0068861_101562020 3300005719 Unclassified 649
63 Ga0068863_100002582 3300005841 Bacteria 17960
64 Ga0068863_100010123 3300005841 Bacteria 9169
65 Ga0068863_100371787 3300005841 Bacteria 1395
66 Ga0068858_100007090 3300005842 Bacteria 10881
67 Ga0068858_100223249 3300005842 Bacteria 1785
68 Ga0068860_100006703 3300005843 Bacteria 11558
69 Ga0068860_100619532 3300005843 Bacteria 1089
70 Ga0068862_100123543 3300005844 Bacteria 2284
71 Ga0097621_100027619 3300006237 Bacteria 4465
72 Ga0068871_100569341 3300006358 Bacteria 1027
73 Ga0075428_100065031 3300006844 Bacteria 3994
74 Ga0075431_100069522 3300006847 Bacteria 3633
75 Ga0068865_100289681 3300006881 Bacteria 1307
76 Ga0097620_100003694 3300006931 Bacteria 15598
77 Ga0097620_100029606 3300006931 Bacteria 5494
78 Ga0105250_10012462 3300009092 Bacteria 3509
79 Ga0105245_11335451 3300009098 Bacteria 766
80 Ga0114129_11689447 3300009147 Bacteria 773
81 Ga0105241_10907430 3300009174 Bacteria 819
82 Ga0105248_10000621 3300009177 Bacteria 40351
83 Ga0105248_10011069 3300009177 Bacteria 9949
84 Ga0105248_10065954 3300009177 Bacteria 4065
85 Ga0105249_10131827 3300009553 Bacteria 2387
86 Ga0105249_11031942 3300009553 Bacteria 891
87 Ga0105239_11829137 3300010375 Unclassified 704
88 Ga0105246_12081918 3300011119 Bacteria 549
89 Ga0157371_10259804 3300013102 Bacteria 1252
90 Ga0157369_10630839 3300013105 Bacteria 1106
91 Ga0157374_10693305 3300013296 Bacteria 1031
92 Ga0157378_10209398 3300013297 Bacteria 1848
93 Ga0157378_10499001 3300013297 Bacteria 1215
94 Ga0163162_10048909 3300013306 Bacteria 4237
95 Ga0157372_10777951 3300013307 Bacteria 1113
96 Ga0157372_10893068 3300013307 Bacteria 1031
97 Ga0157375_10123503 3300013308 Bacteria 2701
98 Ga0157375_11029396 3300013308 Bacteria 962
99 Ga0157375_11677068 3300013308 Unclassified 752
100 Ga0163163_10000282 3300014325 Bacteria 50623
101 Ga0157380_10192545 3300014326 Bacteria 1802
102 Ga0157379_10065938 3300014968 Bacteria 3237
103 Ga0163161_10476670 3300017792 Bacteria 1012
104 Ga0213876_10006881 3300021384 Bacteria 6199
105 Ga0207656_10102542 3300025321 Bacteria 1313
106 Ga0207696_1023227 3300025711 Bacteria 1958
107 Ga0207680_10813931 3300025903 Bacteria 670
108 Ga0207647_10124360 3300025904 Bacteria 1519
109 Ga0207645_10066613 3300025907 Bacteria 2302
110 Ga0207645_10123736 3300025907 Bacteria 1680
111 Ga0207705_10005025 3300025909 Bacteria 9921
112 Ga0207705_10113919 3300025909 Bacteria 2000
113 Ga0207705_10148997 3300025909 Bacteria 1752
114 Ga0207657_10019305 3300025919 Bacteria 6477
115 Ga0207657_10100604 3300025919 Bacteria 2400
116 Ga0207657_10144669 3300025919 Bacteria 1940
117 Ga0207657_10524251 3300025919 Bacteria 927
118 Ga0207649_10026064 3300025920 Bacteria 3416
119 Ga0207649_10204211 3300025920 Bacteria 1398
120 Ga0207652_10254622 3300025921 Bacteria 1583
121 Ga0207652_10395106 3300025921 Bacteria 1248
122 Ga0207652_11039372 3300025921 Bacteria 719
123 Ga0207650_10261108 3300025925 Bacteria 1405
124 Ga0207650_10591109 3300025925 Bacteria 933
125 Ga0207659_10035314 3300025926 Bacteria 3454
126 Ga0207659_10682373 3300025926 Bacteria 879
127 Ga0207687_10852961 3300025927 Bacteria 778
128 Ga0207644_10036165 3300025931 Bacteria 3465
129 Ga0207644_10054207 3300025931 Bacteria 2887
130 Ga0207644_10390462 3300025931 Bacteria 1136
131 Ga0207644_10499145 3300025931 Bacteria 1004
132 Ga0207690_10526985 3300025932 Bacteria 958
133 Ga0207690_11542768 3300025932 Bacteria 555
134 Ga0207706_10021306 3300025933 Bacteria 5823
135 Ga0207706_10699151 3300025933 Bacteria 866
136 Ga0207711_10000440 3300025941 Bacteria 43290
137 Ga0207711_10006806 3300025941 Bacteria 9606
138 Ga0207711_10071863 3300025941 Bacteria 3004
139 Ga0207689_10279388 3300025942 Bacteria 1383
140 Ga0207679_10772213 3300025945 Bacteria 875
141 Ga0207679_11156937 3300025945 Bacteria 710
142 Ga0207667_10689025 3300025949 Bacteria 1025
143 Ga0207651_10055251 3300025960 Bacteria 2726
144 Ga0207712_10087735 3300025961 Bacteria 2282
145 Ga0207658_10001550 3300025986 Bacteria 17809
146 Ga0207658_10001869 3300025986 Bacteria 15760
147 Ga0207658_10744975 3300025986 Bacteria 887
148 Ga0207658_11003022 3300025986 Bacteria 762
149 Ga0207677_10310340 3300026023 Bacteria 1307
150 Ga0207677_10527239 3300026023 Bacteria 1026
151 Ga0207703_10005250 3300026035 Bacteria 10446
152 Ga0207639_10449943 3300026041 Bacteria 1169
153 Ga0207678_10004385 3300026067 Bacteria 12694
154 Ga0207678_10013251 3300026067 Bacteria 7235
155 Ga0207678_10044233 3300026067 Bacteria 3852
156 Ga0207678_10203533 3300026067 Bacteria 1693
157 Ga0207702_10324458 3300026078 Bacteria 1467
158 Ga0207641_10000330 3300026088 Bacteria 58123
159 Ga0207641_10292776 3300026088 Bacteria 1535
160 Ga0207648_10024712 3300026089 Bacteria 5359
161 Ga0207676_10001166 3300026095 Bacteria 19777
162 Ga0207676_10237325 3300026095 Bacteria 1633
163 Ga0207674_10142348 3300026116 Bacteria 2357
164 Ga0207674_10297030 3300026116 Bacteria 1564
165 Ga0207675_102003620 3300026118 Unclassified 596
166 Ga0207698_10368239 3300026142 Bacteria 1363
167 Ga0207698_10670090 3300026142 Bacteria 1029
168 Ga0268265_10076666 3300028380 Bacteria 2623
169 Ga0268265_10264304 3300028380 Bacteria 1531
170 Ga0268265_11605060 3300028380 Bacteria 655
171 Ga0268264_10029534 3300028381 Bacteria 4491
172 Ga0268264_11334621 3300028381 Bacteria 727
173 Ga0307408_100660884 3300031548 Bacteria 935
174 Ga0307408_100834996 3300031548 Bacteria 839
175 Ga0307408_101648420 3300031548 Bacteria 610
176 Ga0307405_10140703 3300031731 Bacteria 1682
177 Ga0307405_10182778 3300031731 Bacteria 1507
178 Ga0307405_10267062 3300031731 Bacteria 1281
179 Ga0307405_10762381 3300031731 Bacteria 807
180 Ga0307413_10010356 3300031824 Bacteria 4518
181 Ga0307413_10146696 3300031824 Bacteria 1639
182 Ga0307413_10588444 3300031824 Bacteria 909
183 Ga0307410_10009569 3300031852 Bacteria 5444
184 Ga0307410_10319261 3300031852 Bacteria 1232
185 Ga0307410_11283751 3300031852 Bacteria 640
186 Ga0307406_10082795 3300031901 Bacteria 2138
187 Ga0307406_10230634 3300031901 Bacteria 1382
188 Ga0307406_10609224 3300031901 Bacteria 901
189 Ga0307407_10333919 3300031903 Bacteria 1068
190 Ga0307407_10663428 3300031903 Bacteria 782
191 Ga0307412_10405627 3300031911 Bacteria 1111
192 Ga0307412_10531879 3300031911 Bacteria 984
193 Ga0307409_100030739 3300031995 Bacteria 3864
194 Ga0307409_100053010 3300031995 Bacteria 3114
195 Ga0307409_100636976 3300031995 Bacteria 1058
196 Ga0307409_101006466 3300031995 Bacteria 852
197 Ga0307416_101070536 3300032002 Bacteria 910
198 Ga0307416_101635783 3300032002 Bacteria 749
199 Ga0307416_103136054 3300032002 Bacteria 553
200 Ga0307414_10140445 3300032004 Bacteria 1890
201 Ga0307414_10416208 3300032004 Bacteria 1171
202 Ga0307414_11069062 3300032004 Bacteria 744
203 Ga0307411_10041177 3300032005 Bacteria 2937
204 Ga0307411_10184343 3300032005 Bacteria 1587
205 Ga0307411_10216731 3300032005 Bacteria 1482
206 Ga0307411_10317696 3300032005 Bacteria 1256
207 Ga0307415_100066045 3300032126 Bacteria 2523
208 Ga0307415_100206340 3300032126 Bacteria 1564
209 Ga0307415_100442979 3300032126 Bacteria 1121
210 Ga0307415_100503456 3300032126 Bacteria 1059
211 Ga0307415_101118166 3300032126 Bacteria 738
212 Ga0395900_0039439 3300037418 Bacteria 4866
213 Ga0395900_0385642 3300037418 Bacteria 1368
214 Ga0395900_0584078 3300037418 Bacteria 1059
215 Ga0395900_1319226 3300037418 Bacteria 635
216 Ga0395898_0295268 3300037466 Bacteria 1546
217 Ga0395898_0664825 3300037466 Bacteria 984
218 Ga0395898_1141100 3300037466 Bacteria 712
219 Ga0395905_0053330 3300037471 Bacteria 3785
220 Ga0395905_0288349 3300037471 Bacteria 1528
221 Ga0395905_0294597 3300037471 Bacteria 1509
222 Ga0395905_0307091 3300037471 Bacteria 1474
223 Ga0395905_0308985 3300037471 Bacteria 1469
224 Ga0395901_0436898 3300038443 Bacteria 1340
225 Ga0395901_0509402 3300038443 Bacteria 1224
226 Ga0395901_1033808 3300038443 Bacteria 795
227 Ga0395901_1089322 3300038443 Bacteria 770
228 Ga0436365_1326608 3300039437 Bacteria 11233
229 Ga0436363_0421745 3300039450 Bacteria 4588
230 Ga0450917_002524 3300042120 Bacteria 1309
231 Ga0450889_002176 3300042144 Bacteria 1969
232 Ga0450889_018337 3300042144 Bacteria 765
233 Ga0439458_0035585 3300042157 Bacteria 1197
234 Ga0450908_029156 3300042184 Bacteria 960
235 Ga0466965_0196609 3300044683 Bacteria 1068
236 Ga0466960_0197683 3300044901 Bacteria 1097
237 Ga0466967_1965687 3300045976 Bacteria 581
238 Ga0495585_0101120 3300046492 Bacteria 1542
239 Ga0495633_0048378 3300046558 Bacteria 2008
240 Ga0495668_0029543 3300046616 Bacteria 3096
241 Ga0495659_0020748 3300046664 Bacteria 2210
242 Ga0495659_0530200 3300046664 Bacteria 518
243 Ga0495670_0171783 3300046691 Bacteria 1142
244 Ga0495670_0381950 3300046691 Bacteria 760
245 Ga0496107_0299221 3300048910 Bacteria 1197
246 Ga0496108_0487270 3300048911 Bacteria 1077
247 Ga0496109_0109315 3300048912 Bacteria 2570
248 Ga0501069_0188932 3300049585 Bacteria 1192
249 Ga0501233_115371 3300049668 Bacteria 721
250 Ga0501257_037142 3300049686 Bacteria 1188
251 nmdc:mga00v17_680619_c1 3300050491 Unclassified 660
252 nmdc:mga06r32_26847_c1 3300050510 Bacteria 5373

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005335 Ga0070666_10271464 Ga0070666_102714642 104
2 3300028380 Ga0268265_11605060 Ga0268265_116050602 105
3 3300006881 Ga0068865_100289681 Ga0068865_1002896811 106
4 3300042144 Ga0450889_018337 Ga0450889_018337_245_598 107
5 3300005293 Ga0065715_10111701 Ga0065715_101117013 109
6 3300031901 Ga0307406_10230634 Ga0307406_102306342 109
7 3300032002 Ga0307416_101635783 Ga0307416_1016357832 109
8 3300050491 nmdc:mga00v17_680619_c1 nmdc:mga00v17_680619_c1_158_586 109
9 3300014326 Ga0157380_10192545 Ga0157380_101925452 112
10 3300005353 Ga0070669_101325138 Ga0070669_1013251381 114
11 3300005844 Ga0068862_100123543 Ga0068862_1001235432 114
12 3300006237 Ga0097621_100027619 Ga0097621_1000276195 114
13 3300006358 Ga0068871_100569341 Ga0068871_1005693412 114
14 3300028380 Ga0268265_10264304 Ga0268265_102643043 114
15 3300046616 Ga0495668_0029543 Ga0495668_0029543_456_881 114
16 3300048911 Ga0496108_0487270 Ga0496108_0487270_446_892 114
17 3300005334 Ga0068869_101377063 Ga0068869_1013770631 115
18 3300005530 Ga0070679_100529210 Ga0070679_1005292101 115
19 3300025907 Ga0207645_10066613 Ga0207645_100666133 115
20 3300025921 Ga0207652_10254622 Ga0207652_102546222 115
21 3300025931 Ga0207644_10390462 Ga0207644_103904622 115
22 3300025945 Ga0207679_10772213 Ga0207679_107722132 115
23 3300046664 Ga0495659_0530200 Ga0495659_0530200_26_409 115
24 3300013308 Ga0157375_11677068 Ga0157375_116770681 116
25 3300025903 Ga0207680_10813931 Ga0207680_108139311 116
26 3300005338 Ga0068868_100626240 Ga0068868_1006262402 117
27 3300005364 Ga0070673_100796303 Ga0070673_1007963032 117
28 3300025920 Ga0207649_10204211 Ga0207649_102042112 117
29 3300025933 Ga0207706_10021306 Ga0207706_100213062 117
30 3300026142 Ga0207698_10670090 Ga0207698_106700901 117
31 3300031903 Ga0307407_10333919 Ga0307407_103339192 117
32 3300037466 Ga0395898_0664825 Ga0395898_0664825_185_643 117
33 3300005335 Ga0070666_10340691 Ga0070666_103406911 118
34 3300005344 Ga0070661_101104533 Ga0070661_1011045331 118
35 3300005355 Ga0070671_100898841 Ga0070671_1008988411 118
36 3300005539 Ga0068853_100270865 Ga0068853_1002708652 118
37 3300009174 Ga0105241_10907430 Ga0105241_109074301 118
38 3300013307 Ga0157372_10893068 Ga0157372_108930682 118
39 3300025919 Ga0207657_10019305 Ga0207657_100193058 118
40 3300025932 Ga0207690_10526985 Ga0207690_105269852 118
41 3300025945 Ga0207679_11156937 Ga0207679_111569371 118
42 3300026116 Ga0207674_10142348 Ga0207674_101423482 118
43 3300037418 Ga0395900_1319226 Ga0395900_1319226_177_605 118
44 3300037466 Ga0395898_0295268 Ga0395898_0295268_93_521 118
45 3300037471 Ga0395905_0308985 Ga0395905_0308985_237_665 118
46 3300038443 Ga0395901_1033808 Ga0395901_1033808_152_610 118
47 3300049585 Ga0501069_0188932 Ga0501069_0188932_254_697 118
48 3300005331 Ga0070670_100554815 Ga0070670_1005548152 119
49 3300005354 Ga0070675_100044712 Ga0070675_1000447123 119
50 3300013297 Ga0157378_10499001 Ga0157378_104990012 119
51 3300013308 Ga0157375_10123503 Ga0157375_101235032 119
52 3300025925 Ga0207650_10261108 Ga0207650_102611082 119
53 3300025926 Ga0207659_10035314 Ga0207659_100353143 119
54 3300026067 Ga0207678_10044233 Ga0207678_100442335 119
55 3300048912 Ga0496109_0109315 Ga0496109_0109315_703_1152 119
56 3300005327 Ga0070658_10111311 Ga0070658_101113112 121
57 3300005546 Ga0070696_100806917 Ga0070696_1008069171 121
58 3300025909 Ga0207705_10148997 Ga0207705_101489972 121
59 3300031548 Ga0307408_100660884 Ga0307408_1006608842 121
60 3300031731 Ga0307405_10182778 Ga0307405_101827782 121
61 3300031824 Ga0307413_10010356 Ga0307413_100103563 121
62 3300031824 Ga0307413_10146696 Ga0307413_101466962 121
63 3300031852 Ga0307410_10319261 Ga0307410_103192611 121
64 3300031852 Ga0307410_11283751 Ga0307410_112837512 121
65 3300031901 Ga0307406_10609224 Ga0307406_106092242 121
66 3300031903 Ga0307407_10663428 Ga0307407_106634281 121
67 3300031911 Ga0307412_10405627 Ga0307412_104056272 121
68 3300032005 Ga0307411_10317696 Ga0307411_103176962 121
69 3300032126 Ga0307415_100503456 Ga0307415_1005034561 121
70 3300037418 Ga0395900_0039439 Ga0395900_0039439_3661_4125 121
71 3300037418 Ga0395900_0385642 Ga0395900_0385642_497_952 121
72 3300037471 Ga0395905_0294597 Ga0395905_0294597_701_1165 121
73 3300037471 Ga0395905_0307091 Ga0395905_0307091_971_1426 121
74 3300038443 Ga0395901_0436898 Ga0395901_0436898_806_1270 121
75 3300044683 Ga0466965_0196609 Ga0466965_0196609_16_429 121
76 3300038443 Ga0395901_0509402 Ga0395901_0509402_11_439 122
77 3300046664 Ga0495659_0020748 Ga0495659_0020748_953_1378 122
78 3300005338 Ga0068868_100471712 Ga0068868_1004717122 123
79 3300005353 Ga0070669_100060182 Ga0070669_1000601823 123
80 3300005355 Ga0070671_100038062 Ga0070671_1000380624 123
81 3300005364 Ga0070673_100971639 Ga0070673_1009716391 123
82 3300005367 Ga0070667_100001884 Ga0070667_10000188418 123
83 3300005455 Ga0070663_100568521 Ga0070663_1005685212 123
84 3300005457 Ga0070662_100698469 Ga0070662_1006984691 123
85 3300005563 Ga0068855_100521038 Ga0068855_1005210382 123
86 3300005617 Ga0068859_100003695 Ga0068859_1000036959 123
87 3300005618 Ga0068864_100000445 Ga0068864_10000044523 123
88 3300005841 Ga0068863_100002582 Ga0068863_10000258212 123
89 3300005842 Ga0068858_100007090 Ga0068858_1000070908 123
90 3300005843 Ga0068860_100006703 Ga0068860_1000067035 123
91 3300006931 Ga0097620_100003694 Ga0097620_1000036949 123
92 3300009092 Ga0105250_10012462 Ga0105250_100124622 123
93 3300009177 Ga0105248_10000621 Ga0105248_100006217 123
94 3300009553 Ga0105249_10131827 Ga0105249_101318272 123
95 3300011119 Ga0105246_12081918 Ga0105246_120819181 123
96 3300013306 Ga0163162_10048909 Ga0163162_100489093 123
97 3300014325 Ga0163163_10000282 Ga0163163_1000028239 123
98 3300014968 Ga0157379_10065938 Ga0157379_100659382 123
99 3300017792 Ga0163161_10476670 Ga0163161_104766701 123
100 3300025711 Ga0207696_1023227 Ga0207696_10232272 123
101 3300025931 Ga0207644_10054207 Ga0207644_100542073 123
102 3300025933 Ga0207706_10699151 Ga0207706_106991512 123
103 3300025941 Ga0207711_10000440 Ga0207711_1000044011 123
104 3300025942 Ga0207689_10279388 Ga0207689_102793882 123
105 3300025949 Ga0207667_10689025 Ga0207667_106890252 123
106 3300025960 Ga0207651_10055251 Ga0207651_100552514 123
107 3300025961 Ga0207712_10087735 Ga0207712_100877352 123
108 3300025986 Ga0207658_10001550 Ga0207658_1000155018 123
109 3300026023 Ga0207677_10310340 Ga0207677_103103402 123
110 3300026035 Ga0207703_10005250 Ga0207703_100052508 123
111 3300026067 Ga0207678_10203533 Ga0207678_102035332 123
112 3300026088 Ga0207641_10000330 Ga0207641_1000033043 123
113 3300026095 Ga0207676_10001166 Ga0207676_100011668 123
114 3300028380 Ga0268265_10076666 Ga0268265_100766664 123
115 3300028381 Ga0268264_10029534 Ga0268264_100295344 123
116 3300031731 Ga0307405_10762381 Ga0307405_107623812 123
117 3300031901 Ga0307406_10082795 Ga0307406_100827953 123
118 3300032126 Ga0307415_100066045 Ga0307415_1000660453 123
119 3300037418 Ga0395900_0584078 Ga0395900_0584078_428_856 123
120 3300038443 Ga0395901_1089322 Ga0395901_1089322_126_554 123
121 3300042184 Ga0450908_029156 Ga0450908_029156_108_536 123
122 3300044901 Ga0466960_0197683 Ga0466960_0197683_419_850 123
123 3300005327 Ga0070658_10027425 Ga0070658_100274252 124
124 3300013307 Ga0157372_10777951 Ga0157372_107779512 124
125 3300025909 Ga0207705_10113919 Ga0207705_101139192 124
126 3300042120 Ga0450917_002524 Ga0450917_002524_808_1224 124
127 3300042144 Ga0450889_002176 Ga0450889_002176_939_1355 124
128 3300042157 Ga0439458_0035585 Ga0439458_0035585_346_762 124
129 3300049668 Ga0501233_115371 Ga0501233_115371_211_675 124
130 3300001990 JGI24737J22298_10020359 JGI24737J22298_100203591 126
131 3300005327 Ga0070658_10134920 Ga0070658_101349202 126
132 3300005327 Ga0070658_10628354 Ga0070658_106283542 126
133 3300005339 Ga0070660_100579035 Ga0070660_1005790351 126
134 3300005339 Ga0070660_101282526 Ga0070660_1012825261 126
135 3300005339 Ga0070660_101555943 Ga0070660_1015559431 126
136 3300005339 Ga0070660_101936603 Ga0070660_1019366031 126
137 3300005344 Ga0070661_100027492 Ga0070661_1000274926 126
138 3300005366 Ga0070659_100373695 Ga0070659_1003736952 126
139 3300005435 Ga0070714_100772112 Ga0070714_1007721122 126
140 3300005455 Ga0070663_101131707 Ga0070663_1011317071 126
141 3300005530 Ga0070679_100429898 Ga0070679_1004298982 126
142 3300005548 Ga0070665_101098490 Ga0070665_1010984902 126
143 3300005564 Ga0070664_100467363 Ga0070664_1004673632 126
144 3300005577 Ga0068857_101422226 Ga0068857_1014222261 126
145 3300005614 Ga0068856_100389811 Ga0068856_1003898112 126
146 3300010375 Ga0105239_11829137 Ga0105239_118291371 126
147 3300013102 Ga0157371_10259804 Ga0157371_102598042 126
148 3300013105 Ga0157369_10630839 Ga0157369_106308392 126
149 3300013296 Ga0157374_10693305 Ga0157374_106933052 126
150 3300025904 Ga0207647_10124360 Ga0207647_101243602 126
151 3300025909 Ga0207705_10005025 Ga0207705_1000502511 126
152 3300025919 Ga0207657_10100604 Ga0207657_101006041 126
153 3300025919 Ga0207657_10144669 Ga0207657_101446694 126
154 3300025920 Ga0207649_10026064 Ga0207649_100260642 126
155 3300025921 Ga0207652_10395106 Ga0207652_103951062 126
156 3300025932 Ga0207690_11542768 Ga0207690_115427682 126
157 3300026023 Ga0207677_10527239 Ga0207677_105272392 126
158 3300026041 Ga0207639_10449943 Ga0207639_104499432 126
159 3300026078 Ga0207702_10324458 Ga0207702_103244582 126
160 3300026116 Ga0207674_10297030 Ga0207674_102970302 126
161 3300026142 Ga0207698_10368239 Ga0207698_103682392 126
162 3300005435 Ga0070714_100999915 Ga0070714_1009999152 127
163 3300031548 Ga0307408_100834996 Ga0307408_1008349961 127
164 3300031548 Ga0307408_101648420 Ga0307408_1016484201 127
165 3300031995 Ga0307409_100053010 Ga0307409_1000530103 127
166 3300032004 Ga0307414_10140445 Ga0307414_101404452 127
167 3300032005 Ga0307411_10216731 Ga0307411_102167311 127
168 3300045976 Ga0466967_1965687 Ga0466967_1965687_73_519 127
169 3300006844 Ga0075428_100065031 Ga0075428_1000650312 128
170 3300009147 Ga0114129_11689447 Ga0114129_116894472 128
171 3300031995 Ga0307409_101006466 Ga0307409_1010064662 128
172 3300006847 Ga0075431_100069522 Ga0075431_1000695223 129
173 3300025931 Ga0207644_10499145 Ga0207644_104991452 129
174 3300031731 Ga0307405_10140703 Ga0307405_101407032 129
175 3300031731 Ga0307405_10267062 Ga0307405_102670621 129
176 3300031911 Ga0307412_10531879 Ga0307412_105318791 129
177 3300031995 Ga0307409_100636976 Ga0307409_1006369761 129
178 3300032002 Ga0307416_101070536 Ga0307416_1010705362 129
179 3300032002 Ga0307416_103136054 Ga0307416_1031360541 129
180 3300032004 Ga0307414_11069062 Ga0307414_110690621 129
181 3300032005 Ga0307411_10041177 Ga0307411_100411773 129
182 3300032126 Ga0307415_100206340 Ga0307415_1002063402 129
183 3300032126 Ga0307415_101118166 Ga0307415_1011181661 129
184 3300037471 Ga0395905_0288349 Ga0395905_0288349_493_918 129
185 3300046492 Ga0495585_0101120 Ga0495585_0101120_352_777 129
186 3300046691 Ga0495670_0171783 Ga0495670_0171783_507_938 129
187 3300050510 nmdc:mga06r32_26847_c1 nmdc:mga06r32_26847_c1_2735_3166 129
188 3300005328 Ga0070676_10135126 Ga0070676_101351262 130
189 3300005353 Ga0070669_100710992 Ga0070669_1007109922 130
190 3300005354 Ga0070675_100899750 Ga0070675_1008997502 130
191 3300005459 Ga0068867_100178552 Ga0068867_1001785522 130
192 3300005618 Ga0068864_100254137 Ga0068864_1002541372 130
193 3300005841 Ga0068863_100371787 Ga0068863_1003717872 130
194 3300009098 Ga0105245_11335451 Ga0105245_113354512 130
195 3300025321 Ga0207656_10102542 Ga0207656_101025421 130
196 3300025907 Ga0207645_10123736 Ga0207645_101237362 130
197 3300025921 Ga0207652_11039372 Ga0207652_110393721 130
198 3300025926 Ga0207659_10682373 Ga0207659_106823732 130
199 3300025927 Ga0207687_10852961 Ga0207687_108529612 130
200 3300025986 Ga0207658_11003022 Ga0207658_110030222 130
201 3300026067 Ga0207678_10004385 Ga0207678_100043852 130
202 3300026088 Ga0207641_10292776 Ga0207641_102927762 130
203 3300026089 Ga0207648_10024712 Ga0207648_100247123 130
204 3300026095 Ga0207676_10237325 Ga0207676_102373253 130
205 3300001989 JGI24739J22299_10074555 JGI24739J22299_100745552 131
206 3300001990 JGI24737J22298_10219395 JGI24737J22298_102193951 131
207 3300005331 Ga0070670_101039161 Ga0070670_1010391612 131
208 3300005335 Ga0070666_10264471 Ga0070666_102644712 131
209 3300005339 Ga0070660_101640509 Ga0070660_1016405091 131
210 3300005344 Ga0070661_100546187 Ga0070661_1005461872 131
211 3300005355 Ga0070671_100052997 Ga0070671_1000529973 131
212 3300005355 Ga0070671_101073915 Ga0070671_1010739152 131
213 3300005367 Ga0070667_100098420 Ga0070667_1000984202 131
214 3300005367 Ga0070667_101899843 Ga0070667_1018998431 131
215 3300005455 Ga0070663_100424125 Ga0070663_1004241252 131
216 3300005578 Ga0068854_100428257 Ga0068854_1004282572 131
217 3300005617 Ga0068859_100029607 Ga0068859_1000296073 131
218 3300005719 Ga0068861_101562020 Ga0068861_1015620202 131
219 3300005841 Ga0068863_100010123 Ga0068863_10001012311 131
220 3300005842 Ga0068858_100223249 Ga0068858_1002232491 131
221 3300005843 Ga0068860_100619532 Ga0068860_1006195322 131
222 3300006931 Ga0097620_100029606 Ga0097620_1000296066 131
223 3300009177 Ga0105248_10011069 Ga0105248_100110694 131
224 3300009177 Ga0105248_10065954 Ga0105248_100659545 131
225 3300009553 Ga0105249_11031942 Ga0105249_110319421 131
226 3300013297 Ga0157378_10209398 Ga0157378_102093981 131
227 3300013308 Ga0157375_11029396 Ga0157375_110293961 131
228 3300021384 Ga0213876_10006881 Ga0213876_100068816 131
229 3300025919 Ga0207657_10524251 Ga0207657_105242512 131
230 3300025925 Ga0207650_10591109 Ga0207650_105911091 131
231 3300025931 Ga0207644_10036165 Ga0207644_100361653 131
232 3300025941 Ga0207711_10006806 Ga0207711_1000680610 131
233 3300025941 Ga0207711_10071863 Ga0207711_100718634 131
234 3300025986 Ga0207658_10001869 Ga0207658_100018695 131
235 3300025986 Ga0207658_10744975 Ga0207658_107449752 131
236 3300026067 Ga0207678_10013251 Ga0207678_100132514 131
237 3300026118 Ga0207675_102003620 Ga0207675_1020036201 131
238 3300028381 Ga0268264_11334621 Ga0268264_113346211 131
239 3300031824 Ga0307413_10588444 Ga0307413_105884442 131
240 3300031852 Ga0307410_10009569 Ga0307410_100095695 131
241 3300031995 Ga0307409_100030739 Ga0307409_1000307393 131
242 3300032004 Ga0307414_10416208 Ga0307414_104162081 131
243 3300032005 Ga0307411_10184343 Ga0307411_101843432 131
244 3300032126 Ga0307415_100442979 Ga0307415_1004429792 131
245 3300037466 Ga0395898_1141100 Ga0395898_1141100_206_670 131
246 3300037471 Ga0395905_0053330 Ga0395905_0053330_1999_2439 131
247 3300039437 Ga0436365_1326608 Ga0436365_1326608_2119_2544 131
248 3300039450 Ga0436363_0421745 Ga0436363_0421745_230_655 131
249 3300046558 Ga0495633_0048378 Ga0495633_0048378_858_1304 131
250 3300046691 Ga0495670_0381950 Ga0495670_0381950_130_576 131
251 3300048910 Ga0496107_0299221 Ga0496107_0299221_305_736 131
252 3300049686 Ga0501257_037142 Ga0501257_037142_513_977 131

Feature Viewer

pLDDT pTM Quality
67.43 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map