F363348

General Info

Members Datasets Scaffolds Average Seq Length
252 199 504 112

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10000045|Ga0307516_1000004599
Length 131
Sequence MAFDPGLAQRIREALRDCPGITERRMFGGLAFLVDGKMFIGIRNSSLMARVGPERHQDALAVPHVRVMDFTGRPMKGYVYVDPPAIAEDGDLTSWVLWCAHYVANLPISSRPAGAARSSPTPPPPFGRSLA

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
106 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
132 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
189 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
190 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
193 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
194 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
199 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.29
Nodule 0
Rhizoplane 6.35
Rhizosphere 75.4
Stem 0
Stem Tuber 0
Unclassified 13.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10000045 3300031730 Bacteria 132787
2 rootL2_10179271 3300003322 Bacteria 2772
3 rootH1_10067641 3300003323 Bacteria 3199
4 Ga0055540_1014493 3300003792 Bacteria 2343
5 Ga0055531_10004232 3300003794 Bacteria 8829
6 Ga0065704_10226720 3300005289 Bacteria 1056
7 Ga0065707_10082232 3300005295 Bacteria 18627
8 Ga0070683_100373505 3300005329 Bacteria 1358
9 Ga0070683_100614458 3300005329 Bacteria 1040
10 Ga0070690_101088950 3300005330 Bacteria 633
11 Ga0070670_100062114 3300005331 Bacteria 3207
12 Ga0070670_100159254 3300005331 Bacteria 1956
13 Ga0068868_100378011 3300005338 Bacteria 1218
14 Ga0070668_100046598 3300005347 Bacteria 3330
15 Ga0070669_100087268 3300005353 Bacteria 2332
16 Ga0070671_100107972 3300005355 Bacteria 2337
17 Ga0070671_101357716 3300005355 Bacteria 627
18 Ga0070674_100109809 3300005356 Bacteria 2023
19 Ga0070673_100600900 3300005364 Unclassified 1003
20 Ga0070659_100744054 3300005366 Unclassified 850
21 Ga0070667_100449349 3300005367 Bacteria 1178
22 Ga0070714_100434401 3300005435 Bacteria 1245
23 Ga0070701_10807318 3300005438 Bacteria 640
24 Ga0070705_101606117 3300005440 Bacteria 547
25 Ga0070678_101240915 3300005456 Bacteria 692
26 Ga0068867_100000493 3300005459 Bacteria 26395
27 Ga0070698_100039197 3300005471 Bacteria 4877
28 Ga0070679_101033931 3300005530 Bacteria 766
29 Ga0070684_100768971 3300005535 Bacteria 900
30 Ga0068853_100924699 3300005539 Bacteria 838
31 Ga0070672_100019306 3300005543 Bacteria 4945
32 Ga0070665_100105497 3300005548 Bacteria 2820
33 Ga0070664_100150057 3300005564 Bacteria 2057
34 Ga0068856_100595801 3300005614 Bacteria 1126
35 Ga0068856_101023363 3300005614 Unclassified 844
36 Ga0068859_100049008 3300005617 Bacteria 4242
37 Ga0068859_100823450 3300005617 Bacteria 1015
38 Ga0068864_100395597 3300005618 Bacteria 1312
39 Ga0068861_101514687 3300005719 Bacteria 658
40 Ga0068863_100071426 3300005841 Bacteria 3284
41 Ga0068858_101453902 3300005842 Bacteria 676
42 Ga0068860_101943822 3300005843 Unclassified 610
43 Ga0068860_102215791 3300005843 Bacteria 570
44 Ga0068862_100070330 3300005844 Bacteria 3021
45 Ga0068862_100086912 3300005844 Unclassified 2719
46 Ga0068862_100362718 3300005844 Bacteria 1347
47 Ga0081455_10666699 3300005937 Bacteria 667
48 Ga0075365_10066635 3300006038 Bacteria 2416
49 Ga0075368_10057726 3300006042 Bacteria 1550
50 Ga0075368_10263569 3300006042 Bacteria 738
51 Ga0075363_100063086 3300006048 Bacteria 1999
52 Ga0070716_101522342 3300006173 Bacteria 547
53 Ga0070712_100704202 3300006175 Bacteria 861
54 Ga0075362_10041436 3300006177 Bacteria 2031
55 Ga0075362_10415157 3300006177 Unclassified 680
56 Ga0075367_10010909 3300006178 Bacteria 4788
57 Ga0075369_10006664 3300006186 Bacteria 4377
58 Ga0075366_10250401 3300006195 Bacteria 1080
59 Ga0075366_10597068 3300006195 Unclassified 684
60 Ga0075366_11018668 3300006195 Unclassified 517
61 Ga0097621_100088749 3300006237 Bacteria 2584
62 Ga0075370_10038736 3300006353 Bacteria 2683
63 Ga0068871_100309206 3300006358 Bacteria 1389
64 Ga0075428_101655170 3300006844 Unclassified 668
65 Ga0075431_101670477 3300006847 Bacteria 594
66 Ga0075433_10269593 3300006852 Bacteria 1509
67 Ga0068865_102054609 3300006881 Unclassified 519
68 Ga0097620_100049008 3300006931 Bacteria 4242
69 Ga0097620_100823701 3300006931 Bacteria 1015
70 Ga0075435_100081067 3300007076 Bacteria 2665
71 Ga0114129_10237837 3300009147 Bacteria 2449
72 Ga0105243_10007577 3300009148 Bacteria 8340
73 Ga0105243_10007766 3300009148 Bacteria 8249
74 Ga0105243_10054241 3300009148 Bacteria 3182
75 Ga0105242_10558705 3300009176 Unclassified 1099
76 Ga0105248_10689618 3300009177 Bacteria 1152
77 Ga0105249_10001772 3300009553 Bacteria 18816
78 Ga0105249_10283078 3300009553 Bacteria 1657
79 Ga0099796_10262410 3300010159 Unclassified 721
80 Ga0105246_10802676 3300011119 Bacteria 835
81 Ga0157378_10268272 3300013297 Bacteria 1640
82 Ga0163162_10003082 3300013306 Bacteria 15919
83 Ga0157375_10072198 3300013308 Bacteria 3467
84 Ga0157375_10366742 3300013308 Bacteria 1606
85 Ga0157380_10018299 3300014326 Bacteria 5199
86 Ga0157377_10000092 3300014745 Bacteria 65323
87 Ga0157379_10239374 3300014968 Bacteria 1646
88 Ga0157379_11611416 3300014968 Bacteria 634
89 Ga0157376_11412072 3300014969 Unclassified 728
90 Ga0157376_12770748 3300014969 Bacteria 530
91 Ga0209051_1000587 3300025303 Bacteria 43099
92 Ga0209257_1000137 3300025304 Bacteria 204210
93 Ga0207642_10143077 3300025899 Bacteria 1263
94 Ga0207643_10054624 3300025908 Bacteria 2270
95 Ga0207681_10184702 3300025923 Bacteria 1591
96 Ga0207681_10334093 3300025923 Bacteria 1209
97 Ga0207650_10049139 3300025925 Bacteria 3113
98 Ga0207650_10363082 3300025925 Bacteria 1193
99 Ga0207664_10530624 3300025929 Bacteria 1055
100 Ga0207690_10253508 3300025932 Bacteria 1360
101 Ga0207706_10537730 3300025933 Bacteria 1007
102 Ga0207686_10308313 3300025934 Bacteria 1178
103 Ga0207709_10005605 3300025935 Bacteria 7102
104 Ga0207709_10403776 3300025935 Bacteria 1045
105 Ga0207704_10198568 3300025938 Bacteria 1466
106 Ga0207691_10039024 3300025940 Bacteria 4394
107 Ga0207691_10120590 3300025940 Bacteria 2325
108 Ga0207711_10456373 3300025941 Bacteria 1190
109 Ga0207711_10484800 3300025941 Bacteria 1152
110 Ga0207661_10334070 3300025944 Bacteria 1365
111 Ga0207679_10366809 3300025945 Bacteria 1259
112 Ga0207712_10771462 3300025961 Bacteria 844
113 Ga0207658_10471587 3300025986 Bacteria 1114
114 Ga0207703_10110107 3300026035 Bacteria 2349
115 Ga0207708_10404355 3300026075 Bacteria 1130
116 Ga0207708_10818007 3300026075 Unclassified 803
117 Ga0207702_11651065 3300026078 Unclassified 634
118 Ga0207641_10026950 3300026088 Bacteria 4746
119 Ga0207648_10000329 3300026089 Bacteria 52037
120 Ga0207648_10150114 3300026089 Bacteria 2056
121 Ga0207674_10019365 3300026116 Bacteria 7374
122 Ga0207683_10627126 3300026121 Bacteria 996
123 Ga0209813_10014489 3300027866 Bacteria 2123
124 Ga0268265_10063816 3300028380 Bacteria 2835
125 Ga0268265_10513828 3300028380 Bacteria 1131
126 Ga0268264_11013140 3300028381 Bacteria 837
127 Ga0268264_11990087 3300028381 Bacteria 590
128 Ga0307511_10005491 3300030521 Bacteria 12887
129 Ga0265327_10000252 3300031251 Bacteria 106339
130 Ga0307509_10231004 3300031507 Bacteria 1652
131 Ga0307408_100228372 3300031548 Bacteria 1523
132 Ga0307408_100698840 3300031548 Unclassified 911
133 Ga0307408_100737414 3300031548 Bacteria 889
134 Ga0316576_10013769 3300031727 Bacteria 5388
135 Ga0316576_10319786 3300031727 Bacteria 1158
136 Ga0316576_10916281 3300031727 Bacteria 627
137 Ga0316578_10418436 3300031728 Bacteria 793
138 Ga0316577_10295133 3300031733 Bacteria 918
139 Ga0307410_10049154 3300031852 Bacteria 2830
140 Ga0307409_100577123 3300031995 Bacteria 1108
141 Ga0307416_100091078 3300032002 Bacteria 2618
142 Ga0307416_101126187 3300032002 Bacteria 890
143 Ga0307411_10055528 3300032005 Bacteria 2606
144 Ga0316580_10159944 3300032139 Bacteria 692
145 Ga0307510_10514647 3300033180 Bacteria 640
146 Ga0373926_0122026 3300035083 Unclassified 983
147 Ga0373954_0029929 3300035118 Unclassified 2511
148 Ga0373960_0398986 3300035121 Bacteria 530
149 Ga0373946_0620631 3300035171 Bacteria 562
150 Ga0373955_0619369 3300035172 Bacteria 663
151 Ga0316574_0187645 3300035398 Bacteria 1330
152 Ga0373935_0193789 3300035692 Bacteria 1401
153 Ga0373927_1177266 3300035695 Bacteria 506
154 Ga0373947_0089407 3300035725 Bacteria 1918
155 Ga0373947_0370022 3300035725 Bacteria 964
156 Ga0316584_0101639 3300036712 Bacteria 2153
157 Ga0316584_0183223 3300036712 Bacteria 1550
158 Ga0373925_0157102 3300037068 Bacteria 1789
159 Ga0395899_0185318 3300037312 Bacteria 1459
160 Ga0395900_0227234 3300037418 Bacteria 1879
161 Ga0395898_1159149 3300037466 Bacteria 705
162 Ga0395905_0072570 3300037471 Bacteria 3227
163 Ga0395905_1431056 3300037471 Unclassified 595
164 Ga0395901_0141743 3300038443 Bacteria 2526
165 Ga0395901_0866588 3300038443 Bacteria 887
166 Ga0451800_0049577 3300041459 Bacteria 2629
167 Ga0451807_0175612 3300041486 Bacteria 1689
168 Ga0451833_1453179 3300041491 Bacteria 1076
169 Ga0451843_1699234 3300041509 Bacteria 553
170 Ga0451853_2164462 3300041512 Bacteria 610
171 Ga0451577_0235333 3300042876 Bacteria 1656
172 Ga0453684_0464918 3300044712 Bacteria 1406
173 Ga0466967_0049071 3300045976 Bacteria 3690
174 Ga0495594_0089998 3300046499 Bacteria 1719
175 Ga0495630_0301959 3300046517 Bacteria 1223
176 Ga0495630_1226299 3300046517 Unclassified 567
177 Ga0495642_0252396 3300046528 Bacteria 771
178 Ga0495665_0310193 3300046531 Bacteria 807
179 Ga0495621_0003120 3300046539 Bacteria 4535
180 Ga0495621_0340859 3300046539 Bacteria 627
181 Ga0495657_0235319 3300046675 Bacteria 1107
182 Ga0495624_0021925 3300046690 Bacteria 4231
183 Ga0495676_0072820 3300047321 Bacteria 2637
184 Ga0495593_0035127 3300047673 Bacteria 2723
185 Ga0495615_0051366 3300048090 Bacteria 1062
186 Ga0496100_0115899 3300048903 Bacteria 1869
187 Ga0496102_0106186 3300048905 Unclassified 2613
188 Ga0496104_0119209 3300048907 Bacteria 2534
189 Ga0496106_0112970 3300048909 Unclassified 2117
190 Ga0496106_0868352 3300048909 Bacteria 713
191 Ga0496108_0020409 3300048911 Bacteria 5447
192 Ga0496109_0072695 3300048912 Bacteria 3160
193 Ga0496110_0004288 3300048913 Bacteria 11039
194 Ga0496110_1455844 3300048913 Bacteria 595
195 Ga0496111_0101313 3300048914 Bacteria 2116
196 Ga0496112_0167380 3300048915 Bacteria 2164
197 Ga0496112_1189511 3300048915 Bacteria 679
198 Ga0496113_0837936 3300048916 Bacteria 729
199 Ga0496115_0134732 3300048918 Bacteria 2037
200 Ga0496126_0000055 3300048929 Bacteria 297958
201 Ga0501034_0197817 3300049571 Bacteria 1969
202 Ga0501034_0881603 3300049571 Bacteria 784
203 Ga0501036_0608632 3300049572 Bacteria 906
204 Ga0501038_0678385 3300049574 Bacteria 774
205 Ga0501040_0097311 3300049576 Archaea 2050
206 Ga0501040_1395842 3300049576 Unclassified 508
207 Ga0501041_0062362 3300049577 Unclassified 2282
208 Ga0501042_0409731 3300049578 Bacteria 982
209 Ga0501042_0686434 3300049578 Unclassified 744
210 Ga0501042_1180660 3300049578 Bacteria 558
211 Ga0501043_0794358 3300049579 Unclassified 685
212 Ga0501046_0453143 3300049580 Unclassified 922
213 Ga0501048_0617071 3300049582 Bacteria 779
214 Ga0501070_0925333 3300049586 Unclassified 679
215 Ga0501071_0083216 3300049587 Bacteria 2344
216 Ga0501071_0227433 3300049587 Bacteria 1405
217 Ga0501072_0837924 3300049588 Unclassified 719
218 Ga0501074_0370587 3300049590 Bacteria 1016
219 Ga0501075_0037785 3300049591 Archaea 3609
220 Ga0501076_0143627 3300049592 Bacteria 1940
221 Ga0501081_0003620 3300049743 Archaea 9886
222 Ga0501081_1218568 3300049743 Bacteria 570
223 Ga0501044_0519779 3300049823 Bacteria 1090
224 Ga0501045_0125181 3300049824 Archaea 1909
225 nmdc:mga03683_7833_c1 3300050489 Bacteria 3728
226 nmdc:mga03n38_139216_c1 3300050490 Archaea 1211
227 nmdc:mga0yw44_210648_c1 3300050492 Bacteria 1286
228 nmdc:mga0yw44_586209_c1 3300050492 Bacteria 757
229 nmdc:mga0k408_46437_c1 3300050493 Bacteria 2508
230 nmdc:mga0k408_689865_c1 3300050493 Unclassified 599
231 nmdc:mga06z11_726160_c1 3300050494 Unclassified 605
232 nmdc:mga06z11_77829_c1 3300050494 Bacteria 1772
233 nmdc:mga04h51_12921_c1 3300050495 Bacteria 2354
234 nmdc:mga07m45_18747_c1 3300050496 Bacteria 3742
235 nmdc:mga07m45_871410_c1 3300050496 Unclassified 515
236 nmdc:mga08y16_54635_c1 3300050511 Bacteria 4173
237 nmdc:mga0n895_112427_c1 3300050512 Bacteria 2740
238 nmdc:mga0a205_248934_c1 3300050515 Bacteria 1657
239 nmdc:mga0sz30_23948_c1 3300050516 Bacteria 2489
240 Ga0500644_0308014 3300053088 Unclassified 679
241 Ga0500646_0008209 3300053090 Bacteria 2671
242 Ga0500561_0065726 3300053137 Bacteria 1027
243 Ga0500568_0065792 3300053139 Bacteria 1395
244 Ga0500604_0004578 3300053151 Bacteria 3664
245 Ga0500619_000010 3300053154 Bacteria 61024
246 Ga0500627_0112597 3300053158 Bacteria 1225
247 Ga0501084_0435776 3300054114 Bacteria 1108
248 Ga0501084_1200479 3300054114 Unclassified 636
249 Ga0501082_0005266 3300060353 Archaea 11246
250 Ga0530510_0084420 3300061734 Bacteria 2313
251 2808942628 2808606379 Bacteria 5022697
252 8055591546 8055588893 Bacteria 3619545
253 Ga0307516_10000045
254 rootL2_10179271
255 rootH1_10067641
256 Ga0055540_1014493
257 Ga0055531_10004232
258 Ga0065704_10226720
259 Ga0065707_10082232
260 Ga0070683_100373505
261 Ga0070683_100614458
262 Ga0070690_101088950
263 Ga0070670_100062114
264 Ga0070670_100159254
265 Ga0068868_100378011
266 Ga0070668_100046598
267 Ga0070669_100087268
268 Ga0070671_100107972
269 Ga0070671_101357716
270 Ga0070674_100109809
271 Ga0070673_100600900
272 Ga0070659_100744054
273 Ga0070667_100449349
274 Ga0070714_100434401
275 Ga0070701_10807318
276 Ga0070705_101606117
277 Ga0070678_101240915
278 Ga0068867_100000493
279 Ga0070698_100039197
280 Ga0070679_101033931
281 Ga0070684_100768971
282 Ga0068853_100924699
283 Ga0070672_100019306
284 Ga0070665_100105497
285 Ga0070664_100150057
286 Ga0068856_100595801
287 Ga0068856_101023363
288 Ga0068859_100049008
289 Ga0068859_100823450
290 Ga0068864_100395597
291 Ga0068861_101514687
292 Ga0068863_100071426
293 Ga0068858_101453902
294 Ga0068860_101943822
295 Ga0068860_102215791
296 Ga0068862_100070330
297 Ga0068862_100086912
298 Ga0068862_100362718
299 Ga0081455_10666699
300 Ga0075365_10066635
301 Ga0075368_10057726
302 Ga0075368_10263569
303 Ga0075363_100063086
304 Ga0070716_101522342
305 Ga0070712_100704202
306 Ga0075362_10041436
307 Ga0075362_10415157
308 Ga0075367_10010909
309 Ga0075369_10006664
310 Ga0075366_10250401
311 Ga0075366_10597068
312 Ga0075366_11018668
313 Ga0097621_100088749
314 Ga0075370_10038736
315 Ga0068871_100309206
316 Ga0075428_101655170
317 Ga0075431_101670477
318 Ga0075433_10269593
319 Ga0068865_102054609
320 Ga0097620_100049008
321 Ga0097620_100823701
322 Ga0075435_100081067
323 Ga0114129_10237837
324 Ga0105243_10007577
325 Ga0105243_10007766
326 Ga0105243_10054241
327 Ga0105242_10558705
328 Ga0105248_10689618
329 Ga0105249_10001772
330 Ga0105249_10283078
331 Ga0099796_10262410
332 Ga0105246_10802676
333 Ga0157378_10268272
334 Ga0163162_10003082
335 Ga0157375_10072198
336 Ga0157375_10366742
337 Ga0157380_10018299
338 Ga0157377_10000092
339 Ga0157379_10239374
340 Ga0157379_11611416
341 Ga0157376_11412072
342 Ga0157376_12770748
343 Ga0209051_1000587
344 Ga0209257_1000137
345 Ga0207642_10143077
346 Ga0207643_10054624
347 Ga0207681_10184702
348 Ga0207681_10334093
349 Ga0207650_10049139
350 Ga0207650_10363082
351 Ga0207664_10530624
352 Ga0207690_10253508
353 Ga0207706_10537730
354 Ga0207686_10308313
355 Ga0207709_10005605
356 Ga0207709_10403776
357 Ga0207704_10198568
358 Ga0207691_10039024
359 Ga0207691_10120590
360 Ga0207711_10456373
361 Ga0207711_10484800
362 Ga0207661_10334070
363 Ga0207679_10366809
364 Ga0207712_10771462
365 Ga0207658_10471587
366 Ga0207703_10110107
367 Ga0207708_10404355
368 Ga0207708_10818007
369 Ga0207702_11651065
370 Ga0207641_10026950
371 Ga0207648_10000329
372 Ga0207648_10150114
373 Ga0207674_10019365
374 Ga0207683_10627126
375 Ga0209813_10014489
376 Ga0268265_10063816
377 Ga0268265_10513828
378 Ga0268264_11013140
379 Ga0268264_11990087
380 Ga0307511_10005491
381 Ga0265327_10000252
382 Ga0307509_10231004
383 Ga0307408_100228372
384 Ga0307408_100698840
385 Ga0307408_100737414
386 Ga0316576_10013769
387 Ga0316576_10319786
388 Ga0316576_10916281
389 Ga0316578_10418436
390 Ga0316577_10295133
391 Ga0307410_10049154
392 Ga0307409_100577123
393 Ga0307416_100091078
394 Ga0307416_101126187
395 Ga0307411_10055528
396 Ga0316580_10159944
397 Ga0307510_10514647
398 Ga0373926_0122026
399 Ga0373954_0029929
400 Ga0373960_0398986
401 Ga0373946_0620631
402 Ga0373955_0619369
403 Ga0316574_0187645
404 Ga0373935_0193789
405 Ga0373927_1177266
406 Ga0373947_0089407
407 Ga0373947_0370022
408 Ga0316584_0101639
409 Ga0316584_0183223
410 Ga0373925_0157102
411 Ga0395899_0185318
412 Ga0395900_0227234
413 Ga0395898_1159149
414 Ga0395905_0072570
415 Ga0395905_1431056
416 Ga0395901_0141743
417 Ga0395901_0866588
418 Ga0451800_0049577
419 Ga0451807_0175612
420 Ga0451833_1453179
421 Ga0451843_1699234
422 Ga0451853_2164462
423 Ga0451577_0235333
424 Ga0453684_0464918
425 Ga0466967_0049071
426 Ga0495594_0089998
427 Ga0495630_0301959
428 Ga0495630_1226299
429 Ga0495642_0252396
430 Ga0495665_0310193
431 Ga0495621_0003120
432 Ga0495621_0340859
433 Ga0495657_0235319
434 Ga0495624_0021925
435 Ga0495676_0072820
436 Ga0495593_0035127
437 Ga0495615_0051366
438 Ga0496100_0115899
439 Ga0496102_0106186
440 Ga0496104_0119209
441 Ga0496106_0112970
442 Ga0496106_0868352
443 Ga0496108_0020409
444 Ga0496109_0072695
445 Ga0496110_0004288
446 Ga0496110_1455844
447 Ga0496111_0101313
448 Ga0496112_0167380
449 Ga0496112_1189511
450 Ga0496113_0837936
451 Ga0496115_0134732
452 Ga0496126_0000055
453 Ga0501034_0197817
454 Ga0501034_0881603
455 Ga0501036_0608632
456 Ga0501038_0678385
457 Ga0501040_0097311
458 Ga0501040_1395842
459 Ga0501041_0062362
460 Ga0501042_0409731
461 Ga0501042_0686434
462 Ga0501042_1180660
463 Ga0501043_0794358
464 Ga0501046_0453143
465 Ga0501048_0617071
466 Ga0501070_0925333
467 Ga0501071_0083216
468 Ga0501071_0227433
469 Ga0501072_0837924
470 Ga0501074_0370587
471 Ga0501075_0037785
472 Ga0501076_0143627
473 Ga0501081_0003620
474 Ga0501081_1218568
475 Ga0501044_0519779
476 Ga0501045_0125181
477 nmdc:mga03683_7833_c1
478 nmdc:mga03n38_139216_c1
479 nmdc:mga0yw44_210648_c1
480 nmdc:mga0yw44_586209_c1
481 nmdc:mga0k408_46437_c1
482 nmdc:mga0k408_689865_c1
483 nmdc:mga06z11_726160_c1
484 nmdc:mga06z11_77829_c1
485 nmdc:mga04h51_12921_c1
486 nmdc:mga07m45_18747_c1
487 nmdc:mga07m45_871410_c1
488 nmdc:mga08y16_54635_c1
489 nmdc:mga0n895_112427_c1
490 nmdc:mga0a205_248934_c1
491 nmdc:mga0sz30_23948_c1
492 Ga0500644_0308014
493 Ga0500646_0008209
494 Ga0500561_0065726
495 Ga0500568_0065792
496 Ga0500604_0004578
497 Ga0500619_000010
498 Ga0500627_0112597
499 Ga0501084_0435776
500 Ga0501084_1200479
501 Ga0501082_0005266
502 Ga0530510_0084420
503 2808942628
504 8055591546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04993

TfoX_N

TfoX N-terminal domain

13

101

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7652 8 111
4n06-assembly1.cif.gz_A crystal structure of cas1 from archaeoglobus fulgidus and its nucleolytic activity 0.7273 20 45
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7114 8 111
5a5f-assembly1.cif.gz_A crystal structure of murd ligase from escherichia coli in complex with uma and adp 0.7021 17 41
6lnw-assembly1.cif.gz_A crystal structure of accessory secretory protein 1,2 and 3 in streptococcus pneumoniae 0.7001 18 49
ID Description Score Start End Superfamily
4n06B01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2;CRISPR-associated endonuclease Cas1, N-terminal domain 0.782 20 42 3.100.10.20
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7651 8 111 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7316 5 109 3.90.1150.30
af_Q99N90_65_102_2.20.28.120 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Ribosomal protein L33 0.7295 18 35 2.20.28.120
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7114 8 111 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A1U7CPZ8-F1-model_v4 TfoX N-terminal domain-containing protein 0.9799 1 105
AF-A0A1F8NG10-F1-model_v4 TfoX N-terminal domain-containing protein 0.9744 3 109
AF-A0A381V2Y8-F1-model_v4 Uncharacterized protein 0.9742 33 109
AF-A0A257XHX5-F1-model_v4 RNA methyltransferase 0.9717 1 108 GO:0008168
GO:0032259
AF-A0A2D4SEN6-F1-model_v4 RNA methyltransferase 0.9693 1 110 GO:0008168
GO:0032259

Map