F363247

General Info

Members Datasets Scaffolds Average Seq Length
252 187 504 205

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10594944|Ga0157378_105949442
Length 245
Sequence MDAQIEPVALGSTTASDFDFEAVFHSQYARIARIIFRIVRDSSRAEDLSIEVFWKLSRTRRAQGPDVNKVLADIRAKDKGQLAISEEDGRFLRLMIASGQRKRVLEIGGASGYSAIWMAQALRVTGGRMTTIEYDPARAKELADNIRKAGFSDIVQVVAGDAFAEIPKLQGTFDFVFLDAWKRDYKKFLDLVFPRLEKGGLFTAHNVVNKKGEMEDFLDAIQRNPALWTTIVSPAGEGISLSYKK

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
117 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
118 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
119 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
120 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
121 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
122 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
131 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.52
Nodule 0
Rhizoplane 3.97
Rhizosphere 86.11
Stem 0
Stem Tuber 0
Unclassified 20.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10594944 3300013297 Bacteria 1117
2 Ga0065712_10143712 3300005290 Unclassified 1427
3 Ga0065712_10250971 3300005290 Unclassified 960
4 Ga0065715_10115027 3300005293 Bacteria 2366
5 Ga0065715_10174135 3300005293 Unclassified 1524
6 Ga0065715_10193742 3300005293 Bacteria 1400
7 Ga0065715_10414158 3300005293 Bacteria 866
8 Ga0065715_10534314 3300005293 Unclassified 753
9 Ga0065707_10278255 3300005295 Bacteria 1054
10 Ga0070676_10065673 3300005328 Bacteria 2167
11 Ga0070683_100117039 3300005329 Bacteria 2516
12 Ga0070683_100608124 3300005329 Unclassified 1046
13 Ga0070690_100196386 3300005330 Bacteria 1401
14 Ga0070677_10167368 3300005333 Unclassified 1036
15 Ga0068869_100006316 3300005334 Bacteria 7503
16 Ga0068868_100018767 3300005338 Bacteria 5173
17 Ga0068868_100372787 3300005338 Bacteria 1227
18 Ga0070689_100012244 3300005340 Bacteria 6172
19 Ga0070689_100411136 3300005340 Bacteria 1145
20 Ga0070691_10077686 3300005341 Bacteria 1621
21 Ga0070687_100016108 3300005343 Bacteria 3399
22 Ga0070668_100272935 3300005347 Bacteria 1410
23 Ga0070675_100174580 3300005354 Bacteria 1855
24 Ga0070671_100011793 3300005355 Bacteria 7031
25 Ga0070671_100086882 3300005355 Bacteria 2617
26 Ga0070674_100121193 3300005356 Bacteria 1936
27 Ga0070674_100616210 3300005356 Bacteria 919
28 Ga0070673_100364854 3300005364 Bacteria 1284
29 Ga0070688_100076951 3300005365 Bacteria 2149
30 Ga0070659_100047603 3300005366 Bacteria 3364
31 Ga0070667_100420669 3300005367 Unclassified 1218
32 Ga0070713_100098935 3300005436 Bacteria 2523
33 Ga0070701_10115289 3300005438 Bacteria 1507
34 Ga0070678_100074256 3300005456 Unclassified 2555
35 Ga0070678_100165389 3300005456 Bacteria 1796
36 Ga0070662_100388956 3300005457 Bacteria 1149
37 Ga0070685_10182159 3300005466 Unclassified 1353
38 Ga0070707_100061815 3300005468 Bacteria 3593
39 Ga0070684_100090334 3300005535 Bacteria 2724
40 Ga0070684_100102553 3300005535 Unclassified 2558
41 Ga0070672_100097701 3300005543 Bacteria 2377
42 Ga0070686_100105425 3300005544 Bacteria 1911
43 Ga0070695_100075906 3300005545 Bacteria 2212
44 Ga0070695_100423930 3300005545 Bacteria 1014
45 Ga0070695_100787175 3300005545 Unclassified 761
46 Ga0070704_100157173 3300005549 Bacteria 1794
47 Ga0068855_100315176 3300005563 Bacteria 1730
48 Ga0070664_100157616 3300005564 Unclassified 2007
49 Ga0070664_100164309 3300005564 Unclassified 1966
50 Ga0068854_100131320 3300005578 Bacteria 1913
51 Ga0070702_100096487 3300005615 Bacteria 1804
52 Ga0068852_100156025 3300005616 Bacteria 2126
53 Ga0068859_100563249 3300005617 Bacteria 1234
54 Ga0068864_100256978 3300005618 Bacteria 1624
55 Ga0068866_10003380 3300005718 Bacteria 6545
56 Ga0068861_100082931 3300005719 Bacteria 2514
57 Ga0068858_100115652 3300005842 Bacteria 2506
58 Ga0068860_100268502 3300005843 Bacteria 1664
59 Ga0068862_100827738 3300005844 Bacteria 906
60 Ga0070717_10155437 3300006028 Bacteria 1981
61 Ga0075368_10005104 3300006042 Bacteria 4496
62 Ga0075363_100166468 3300006048 Bacteria 1250
63 Ga0075364_10397609 3300006051 Bacteria 940
64 Ga0070716_100152041 3300006173 Bacteria 1490
65 Ga0075369_10103664 3300006186 Bacteria 1278
66 Ga0075366_10071743 3300006195 Bacteria 2063
67 Ga0075366_10145853 3300006195 Bacteria 1432
68 Ga0075370_10020189 3300006353 Bacteria 3638
69 Ga0068871_100304957 3300006358 Bacteria 1399
70 Ga0068871_100445491 3300006358 Bacteria 1160
71 Ga0075428_100028904 3300006844 Bacteria 6136
72 Ga0075430_100020106 3300006846 Bacteria 5681
73 Ga0075431_100092801 3300006847 Bacteria 3116
74 Ga0075431_100097754 3300006847 Unclassified 3032
75 Ga0075433_10027110 3300006852 Bacteria 4857
76 Ga0075434_100002495 3300006871 Bacteria 16216
77 Ga0075434_100356681 3300006871 Bacteria 1483
78 Ga0075429_100087915 3300006880 Unclassified 2709
79 Ga0075429_100135547 3300006880 Unclassified 2155
80 Ga0068865_100061669 3300006881 Bacteria 2630
81 Ga0075436_100001718 3300006914 Bacteria 14994
82 Ga0075436_100744174 3300006914 Bacteria 728
83 Ga0097620_100563210 3300006931 Bacteria 1234
84 Ga0075435_100000189 3300007076 Bacteria 36888
85 Ga0075435_100004108 3300007076 Bacteria 9977
86 Ga0075435_100013180 3300007076 Bacteria 6143
87 Ga0075435_100254187 3300007076 Unclassified 1496
88 Ga0075435_100455883 3300007076 Bacteria 1103
89 Ga0105240_10154421 3300009093 Bacteria 2731
90 Ga0111539_10000001 3300009094 Bacteria 1035431
91 Ga0111539_10219517 3300009094 Unclassified 2214
92 Ga0105245_10180343 3300009098 Unclassified 2017
93 Ga0105247_10090661 3300009101 Bacteria 1940
94 Ga0114129_10047615 3300009147 Bacteria 6024
95 Ga0114129_10049702 3300009147 Bacteria 5891
96 Ga0105243_10043339 3300009148 Bacteria 3526
97 Ga0105242_10108046 3300009176 Bacteria 2367
98 Ga0105248_10099960 3300009177 Bacteria 3268
99 Ga0105249_10348032 3300009553 Bacteria 1500
100 Ga0105249_10381003 3300009553 Bacteria 1436
101 Ga0105239_10208994 3300010375 Bacteria 2187
102 Ga0105239_11432259 3300010375 Bacteria 798
103 Ga0105246_10912933 3300011119 Unclassified 788
104 Ga0157378_10909066 3300013297 Bacteria 911
105 Ga0157375_10185981 3300013308 Bacteria 2231
106 Ga0163163_11016080 3300014325 Unclassified 892
107 Ga0157377_10270973 3300014745 Bacteria 1108
108 Ga0157376_10121462 3300014969 Unclassified 2316
109 Ga0207697_10012102 3300025315 Bacteria 3631
110 Ga0207697_10093732 3300025315 Bacteria 1274
111 Ga0207688_10015127 3300025901 Bacteria 4185
112 Ga0207647_10342031 3300025904 Bacteria 848
113 Ga0207645_10049284 3300025907 Bacteria 2689
114 Ga0207695_10062269 3300025913 Bacteria 3852
115 Ga0207695_10674608 3300025913 Bacteria 914
116 Ga0207662_10001397 3300025918 Bacteria 11669
117 Ga0207659_10236287 3300025926 Bacteria 1476
118 Ga0207659_10290806 3300025926 Unclassified 1339
119 Ga0207700_10130950 3300025928 Unclassified 2048
120 Ga0207644_10185877 3300025931 Bacteria 1631
121 Ga0207644_10392018 3300025931 Unclassified 1134
122 Ga0207644_10453006 3300025931 Unclassified 1054
123 Ga0207706_10751738 3300025933 Bacteria 831
124 Ga0207706_10887713 3300025933 Unclassified 753
125 Ga0207669_10237005 3300025937 Bacteria 1350
126 Ga0207669_10719471 3300025937 Bacteria 822
127 Ga0207665_10114811 3300025939 Bacteria 1896
128 Ga0207691_10014887 3300025940 Bacteria 7411
129 Ga0207711_10040286 3300025941 Bacteria 3974
130 Ga0207711_10045130 3300025941 Bacteria 3766
131 Ga0207689_10023982 3300025942 Bacteria 5118
132 Ga0207679_10239836 3300025945 Bacteria 1536
133 Ga0207651_10266225 3300025960 Bacteria 1409
134 Ga0207651_10530814 3300025960 Bacteria 1021
135 Ga0207668_10189944 3300025972 Bacteria 1627
136 Ga0207640_10262288 3300025981 Unclassified 1347
137 Ga0207703_10313659 3300026035 Bacteria 1434
138 Ga0207703_10330778 3300026035 Bacteria 1398
139 Ga0207678_10297800 3300026067 Bacteria 1386
140 Ga0207708_10072069 3300026075 Bacteria 2647
141 Ga0207641_10741884 3300026088 Unclassified 969
142 Ga0207648_10050278 3300026089 Bacteria 3645
143 Ga0207648_10321505 3300026089 Bacteria 1391
144 Ga0207676_10229227 3300026095 Bacteria 1659
145 Ga0207675_100055646 3300026118 Bacteria 3691
146 Ga0207675_100773839 3300026118 Bacteria 972
147 Ga0207683_10617564 3300026121 Bacteria 1004
148 Ga0209967_1027706 3300027364 Bacteria 843
149 Ga0209971_1003715 3300027682 Bacteria 3615
150 Ga0209813_10116519 3300027866 Bacteria 926
151 Ga0207428_10000002 3300027907 Bacteria 854851
152 Ga0268265_10608389 3300028380 Bacteria 1045
153 Ga0265316_10347699 3300031344 Bacteria 1074
154 Ga0307407_10741105 3300031903 Bacteria 743
155 Ga0307409_100248807 3300031995 Bacteria 1624
156 Ga0307416_100416476 3300032002 Bacteria 1386
157 Ga0307415_100492531 3300032126 Bacteria 1070
158 Ga0373930_0002601 3300034816 Bacteria 2804
159 Ga0373959_0002109 3300034820 Bacteria 3174
160 Ga0373938_0005187 3300034957 Bacteria 2207
161 Ga0373928_0002313 3300035084 Bacteria 3703
162 Ga0373929_0011155 3300035085 Bacteria 1689
163 Ga0373949_0003515 3300035090 Bacteria 3710
164 Ga0373951_0000437 3300035091 Bacteria 12172
165 Ga0373952_0003943 3300035092 Bacteria 2684
166 Ga0373932_0209284 3300035112 Bacteria 696
167 Ga0373939_0001301 3300035114 Bacteria 6061
168 Ga0373941_0015421 3300035115 Bacteria 2060
169 Ga0373960_0004257 3300035121 Bacteria 3268
170 Ga0373943_0152350 3300035170 Bacteria 1253
171 Ga0373946_0179592 3300035171 Bacteria 1004
172 Ga0373942_0014080 3300035207 Bacteria 1931
173 Ga0373962_0011209 3300035242 Bacteria 2244
174 Ga0373931_0000499 3300035691 Bacteria 16005
175 Ga0373935_0049095 3300035692 Bacteria 2674
176 Ga0373935_0483808 3300035692 Unclassified 897
177 Ga0373947_0190508 3300035725 Bacteria 1338
178 Ga0373947_0728936 3300035725 Bacteria 676
179 Ga0373937_0077935 3300036401 Bacteria 3062
180 Ga0373925_0070931 3300037068 Bacteria 2634
181 Ga0451853_2113008 3300041512 Unclassified 835
182 Ga0439450_085838 3300042008 Bacteria 787
183 Ga0439435_0055978 3300042436 Unclassified 1139
184 Ga0451576_0126345 3300045051 Bacteria 2664
185 Ga0495629_0407863 3300046459 Bacteria 923
186 Ga0495634_0311291 3300046642 Bacteria 950
187 Ga0495674_0706500 3300047319 Bacteria 791
188 Ga0496104_0629761 3300048907 Bacteria 982
189 Ga0496105_0449837 3300048908 Bacteria 1017
190 Ga0496107_0073919 3300048910 Archaea 2480
191 Ga0496107_0248143 3300048910 Bacteria 1325
192 Ga0496108_0914365 3300048911 Unclassified 753
193 Ga0496109_0360333 3300048912 Bacteria 1374
194 Ga0496110_0162618 3300048913 Unclassified 2024
195 Ga0496112_0335490 3300048915 Bacteria 1456
196 Ga0496112_0436752 3300048915 Bacteria 1247
197 Ga0496113_0189756 3300048916 Unclassified 1631
198 Ga0501034_0882635 3300049571 Unclassified 783
199 Ga0501036_0124476 3300049572 Bacteria 2177
200 Ga0501039_0098469 3300049575 Bacteria 2281
201 Ga0501040_0015889 3300049576 Bacteria 4976
202 Ga0501040_0082086 3300049576 Bacteria 2234
203 Ga0501041_0019135 3300049577 Unclassified 4085
204 Ga0501042_0136767 3300049578 Unclassified 1766
205 Ga0501046_0254077 3300049580 Bacteria 1293
206 Ga0501047_0165749 3300049581 Unclassified 2080
207 Ga0501048_0017593 3300049582 Bacteria 5263
208 Ga0501048_0130364 3300049582 Bacteria 1778
209 Ga0501067_0098163 3300049583 Bacteria 1627
210 Ga0501069_0110828 3300049585 Bacteria 1563
211 Ga0501071_0070235 3300049587 Unclassified 2551
212 Ga0501071_0081556 3300049587 Unclassified 2367
213 Ga0501072_0284327 3300049588 Unclassified 1315
214 Ga0501075_0050863 3300049591 Unclassified 3115
215 Ga0501076_0035492 3300049592 Bacteria 3901
216 Ga0501076_0113506 3300049592 Archaea 2192
217 Ga0501077_0085294 3300049593 Unclassified 2002
218 Ga0501079_0197976 3300049741 Unclassified 1569
219 Ga0501080_0079108 3300049742 Archaea 3057
220 Ga0501080_0137686 3300049742 Unclassified 2258
221 Ga0501080_0490710 3300049742 Bacteria 1098
222 Ga0501081_0389076 3300049743 Unclassified 1031
223 Ga0501045_0061710 3300049824 Bacteria 2750
224 nmdc:mga03683_7002_c1 3300050489 Bacteria 3890
225 nmdc:mga00v17_141338_c1 3300050491 Bacteria 1544
226 nmdc:mga00v17_31600_c1 3300050491 Bacteria 3124
227 nmdc:mga00v17_362760_c1 3300050491 Bacteria 942
228 nmdc:mga00v17_36732_c1 3300050491 Bacteria 2922
229 nmdc:mga0yw44_38177_c1 3300050492 Bacteria 2840
230 nmdc:mga0yw44_94385_c1 3300050492 Bacteria 1896
231 nmdc:mga0k408_298246_c1 3300050493 Unclassified 962
232 nmdc:mga0k408_3217_c2 3300050493 Bacteria 5879
233 nmdc:mga0k408_8796_c1 3300050493 Bacteria 5433
234 nmdc:mga06z11_302507_c1 3300050494 Bacteria 951
235 nmdc:mga06z11_68490_c1 3300050494 Bacteria 1871
236 nmdc:mga06z11_9915_c2 3300050494 Bacteria 3132
237 nmdc:mga04h51_137123_c1 3300050495 Bacteria 925
238 nmdc:mga07m45_145221_c1 3300050496 Bacteria 1375
239 nmdc:mga09592_112356_c1 3300050508 Unclassified 2337
240 nmdc:mga06r32_11616_c1 3300050510 Bacteria 7928
241 nmdc:mga06r32_36361_c1 3300050510 Bacteria 4652
242 nmdc:mga06r32_652440_c1 3300050510 Bacteria 1020
243 nmdc:mga08y16_544300_c1 3300050511 Unclassified 1175
244 nmdc:mga0n895_121_c1 3300050512 Bacteria 46448
245 nmdc:mga0n895_525523_c1 3300050512 Bacteria 1191
246 nmdc:mga0rr50_107_c1 3300050513 Bacteria 46254
247 nmdc:mga0rr50_673_c1 3300050513 Bacteria 18292
248 nmdc:mga08x19_776425_c1 3300050514 Bacteria 680
249 nmdc:mga08x19_967_c1 3300050514 Bacteria 17964
250 Ga0500628_071343 3300053129 Bacteria 871
251 Ga0501082_0456323 3300060353 Bacteria 1117
252 Ga0530510_0108179 3300061734 Unclassified 2035
253 Ga0157378_10594944
254 Ga0065712_10143712
255 Ga0065712_10250971
256 Ga0065715_10115027
257 Ga0065715_10174135
258 Ga0065715_10193742
259 Ga0065715_10414158
260 Ga0065715_10534314
261 Ga0065707_10278255
262 Ga0070676_10065673
263 Ga0070683_100117039
264 Ga0070683_100608124
265 Ga0070690_100196386
266 Ga0070677_10167368
267 Ga0068869_100006316
268 Ga0068868_100018767
269 Ga0068868_100372787
270 Ga0070689_100012244
271 Ga0070689_100411136
272 Ga0070691_10077686
273 Ga0070687_100016108
274 Ga0070668_100272935
275 Ga0070675_100174580
276 Ga0070671_100011793
277 Ga0070671_100086882
278 Ga0070674_100121193
279 Ga0070674_100616210
280 Ga0070673_100364854
281 Ga0070688_100076951
282 Ga0070659_100047603
283 Ga0070667_100420669
284 Ga0070713_100098935
285 Ga0070701_10115289
286 Ga0070678_100074256
287 Ga0070678_100165389
288 Ga0070662_100388956
289 Ga0070685_10182159
290 Ga0070707_100061815
291 Ga0070684_100090334
292 Ga0070684_100102553
293 Ga0070672_100097701
294 Ga0070686_100105425
295 Ga0070695_100075906
296 Ga0070695_100423930
297 Ga0070695_100787175
298 Ga0070704_100157173
299 Ga0068855_100315176
300 Ga0070664_100157616
301 Ga0070664_100164309
302 Ga0068854_100131320
303 Ga0070702_100096487
304 Ga0068852_100156025
305 Ga0068859_100563249
306 Ga0068864_100256978
307 Ga0068866_10003380
308 Ga0068861_100082931
309 Ga0068858_100115652
310 Ga0068860_100268502
311 Ga0068862_100827738
312 Ga0070717_10155437
313 Ga0075368_10005104
314 Ga0075363_100166468
315 Ga0075364_10397609
316 Ga0070716_100152041
317 Ga0075369_10103664
318 Ga0075366_10071743
319 Ga0075366_10145853
320 Ga0075370_10020189
321 Ga0068871_100304957
322 Ga0068871_100445491
323 Ga0075428_100028904
324 Ga0075430_100020106
325 Ga0075431_100092801
326 Ga0075431_100097754
327 Ga0075433_10027110
328 Ga0075434_100002495
329 Ga0075434_100356681
330 Ga0075429_100087915
331 Ga0075429_100135547
332 Ga0068865_100061669
333 Ga0075436_100001718
334 Ga0075436_100744174
335 Ga0097620_100563210
336 Ga0075435_100000189
337 Ga0075435_100004108
338 Ga0075435_100013180
339 Ga0075435_100254187
340 Ga0075435_100455883
341 Ga0105240_10154421
342 Ga0111539_10000001
343 Ga0111539_10219517
344 Ga0105245_10180343
345 Ga0105247_10090661
346 Ga0114129_10047615
347 Ga0114129_10049702
348 Ga0105243_10043339
349 Ga0105242_10108046
350 Ga0105248_10099960
351 Ga0105249_10348032
352 Ga0105249_10381003
353 Ga0105239_10208994
354 Ga0105239_11432259
355 Ga0105246_10912933
356 Ga0157378_10909066
357 Ga0157375_10185981
358 Ga0163163_11016080
359 Ga0157377_10270973
360 Ga0157376_10121462
361 Ga0207697_10012102
362 Ga0207697_10093732
363 Ga0207688_10015127
364 Ga0207647_10342031
365 Ga0207645_10049284
366 Ga0207695_10062269
367 Ga0207695_10674608
368 Ga0207662_10001397
369 Ga0207659_10236287
370 Ga0207659_10290806
371 Ga0207700_10130950
372 Ga0207644_10185877
373 Ga0207644_10392018
374 Ga0207644_10453006
375 Ga0207706_10751738
376 Ga0207706_10887713
377 Ga0207669_10237005
378 Ga0207669_10719471
379 Ga0207665_10114811
380 Ga0207691_10014887
381 Ga0207711_10040286
382 Ga0207711_10045130
383 Ga0207689_10023982
384 Ga0207679_10239836
385 Ga0207651_10266225
386 Ga0207651_10530814
387 Ga0207668_10189944
388 Ga0207640_10262288
389 Ga0207703_10313659
390 Ga0207703_10330778
391 Ga0207678_10297800
392 Ga0207708_10072069
393 Ga0207641_10741884
394 Ga0207648_10050278
395 Ga0207648_10321505
396 Ga0207676_10229227
397 Ga0207675_100055646
398 Ga0207675_100773839
399 Ga0207683_10617564
400 Ga0209967_1027706
401 Ga0209971_1003715
402 Ga0209813_10116519
403 Ga0207428_10000002
404 Ga0268265_10608389
405 Ga0265316_10347699
406 Ga0307407_10741105
407 Ga0307409_100248807
408 Ga0307416_100416476
409 Ga0307415_100492531
410 Ga0373930_0002601
411 Ga0373959_0002109
412 Ga0373938_0005187
413 Ga0373928_0002313
414 Ga0373929_0011155
415 Ga0373949_0003515
416 Ga0373951_0000437
417 Ga0373952_0003943
418 Ga0373932_0209284
419 Ga0373939_0001301
420 Ga0373941_0015421
421 Ga0373960_0004257
422 Ga0373943_0152350
423 Ga0373946_0179592
424 Ga0373942_0014080
425 Ga0373962_0011209
426 Ga0373931_0000499
427 Ga0373935_0049095
428 Ga0373935_0483808
429 Ga0373947_0190508
430 Ga0373947_0728936
431 Ga0373937_0077935
432 Ga0373925_0070931
433 Ga0451853_2113008
434 Ga0439450_085838
435 Ga0439435_0055978
436 Ga0451576_0126345
437 Ga0495629_0407863
438 Ga0495634_0311291
439 Ga0495674_0706500
440 Ga0496104_0629761
441 Ga0496105_0449837
442 Ga0496107_0073919
443 Ga0496107_0248143
444 Ga0496108_0914365
445 Ga0496109_0360333
446 Ga0496110_0162618
447 Ga0496112_0335490
448 Ga0496112_0436752
449 Ga0496113_0189756
450 Ga0501034_0882635
451 Ga0501036_0124476
452 Ga0501039_0098469
453 Ga0501040_0015889
454 Ga0501040_0082086
455 Ga0501041_0019135
456 Ga0501042_0136767
457 Ga0501046_0254077
458 Ga0501047_0165749
459 Ga0501048_0017593
460 Ga0501048_0130364
461 Ga0501067_0098163
462 Ga0501069_0110828
463 Ga0501071_0070235
464 Ga0501071_0081556
465 Ga0501072_0284327
466 Ga0501075_0050863
467 Ga0501076_0035492
468 Ga0501076_0113506
469 Ga0501077_0085294
470 Ga0501079_0197976
471 Ga0501080_0079108
472 Ga0501080_0137686
473 Ga0501080_0490710
474 Ga0501081_0389076
475 Ga0501045_0061710
476 nmdc:mga03683_7002_c1
477 nmdc:mga00v17_141338_c1
478 nmdc:mga00v17_31600_c1
479 nmdc:mga00v17_362760_c1
480 nmdc:mga00v17_36732_c1
481 nmdc:mga0yw44_38177_c1
482 nmdc:mga0yw44_94385_c1
483 nmdc:mga0k408_298246_c1
484 nmdc:mga0k408_3217_c2
485 nmdc:mga0k408_8796_c1
486 nmdc:mga06z11_302507_c1
487 nmdc:mga06z11_68490_c1
488 nmdc:mga06z11_9915_c2
489 nmdc:mga04h51_137123_c1
490 nmdc:mga07m45_145221_c1
491 nmdc:mga09592_112356_c1
492 nmdc:mga06r32_11616_c1
493 nmdc:mga06r32_36361_c1
494 nmdc:mga06r32_652440_c1
495 nmdc:mga08y16_544300_c1
496 nmdc:mga0n895_121_c1
497 nmdc:mga0n895_525523_c1
498 nmdc:mga0rr50_107_c1
499 nmdc:mga0rr50_673_c1
500 nmdc:mga08x19_776425_c1
501 nmdc:mga08x19_967_c1
502 Ga0500628_071343
503 Ga0501082_0456323
504 Ga0530510_0108179

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13578

Methyltransf_24

Methyltransferase domain

105

207

0.93

PF13649

Methyltransf_25

Methyltransferase domain

104

200

0.93

PF01596

Methyltransf_3

O-methyltransferase

62

227

0.89

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

89

202

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9v-assembly1.cif.gz_A-2 o-methyltransferase from desulfuromonas acetoxidans 0.9382 27 203
7ud6-assembly1.cif.gz_A designed enzyme sh3-588 (catechol o-methyltransferase catalytic domain and src homology 3 binding domain fusion) 0.9161 42 204
7cvv-assembly1.cif.gz_A crystal structure of catechol o-methyl transferase (comt) from niastella koreensis 0.9129 29 204
4pca-assembly2.cif.gz_B x-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah and manganese 0.9121 29 203
4pca-assembly3.cif.gz_D-4 x-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah and manganese 0.905 29 203
ID Description Score Start End Superfamily
af_A0A0R0IR39_2_192_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9061 37 202 3.40.50.150
af_A1Y9I9_44_257_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9028 44 204 3.40.50.150
5x7fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8957 29 204 3.40.50.150
af_O07431_3_220_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8786 19 204 3.40.50.150
3r3hB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8753 29 204 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1F2U308-F1-model_v4 Methyltransferase 0.9988 25 204 GO:0008171
GO:0032259
AF-A0A5C6D5D7-F1-model_v4 Putative O-methyltransferase (EC 2.1.1.-) 0.9756 28 203 GO:0008171
GO:0032259
AF-A0A0M1JTQ9-F1-model_v4 Methyltransferase 0.9696 42 204 GO:0008171
GO:0032259
AF-A0A0S7XGV3-F1-model_v4 Methyltransferase 0.9667 21 204 GO:0008171
GO:0032259
AF-A0A7V2V218-F1-model_v4 Methyltransferase domain-containing protein 0.9664 26 204 GO:0008171
GO:0032259

Map