F362983

General Info

Members Datasets Scaffolds Average Seq Length
252 208 504 333

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100004911|Ga0070660_1000049115
Length 364
Sequence MDVPTPPGVIRLLRGWYNDRAMTLVQESTLKPLQIGPITIGTPLVLAPMAGVTCHAFRLLCKRYGVGLVVTELLSSHAIHYKNQKTFGMFDWTDAERPVSVQLFGGEPDMMAEASEVVEAAGADIVDLNMGCWVPKVAKTGAGATLLKDVCHAQAVVKAMVDAVKVPVTVKIRAGWDREHTTGVEFAKRAQDAGAAAIAVHARYANQGFTGTADWSIIRRVKDVVTIPVIGNGDVETAEDAKRMFEETGCDAVMIGRAAMGNPWLFADVKQFLETGTHRPAPTLEERIEAGFFRLKTLAATPNVGEVRAVKEMRGQLTHYFKGFHGVSALRNLIVQATSIQQVEDLLYHESRRDKNVEHVEGTE

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
12 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
16 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
21 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
22 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
23 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
41 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
42 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
43 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
49 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
50 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
51 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
52 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
53 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
54 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
55 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
56 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
62 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
63 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
64 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
65 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
68 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
69 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
70 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
71 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
72 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
73 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
74 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
75 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
76 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
77 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
78 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
88 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
91 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
92 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
93 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
94 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
95 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
96 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
97 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
98 2554235283 Bacillus safensis VK Isolate Rhizosphere
99 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
100 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
101 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
102 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
103 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
104 2643221729 Bacillus sp. Root11 Isolate Unclassified
105 2643221730 Bacillus sp. Root131 Isolate Unclassified
106 2643221735 Bacillus sp. Root920 Isolate Unclassified
107 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
108 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
109 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
110 2684622632 Bacillus cereus 905 Isolate Unclassified
111 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
112 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
113 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
114 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
115 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
116 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
117 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
118 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
119 2738541295 Bacillus sp. OK085 Isolate Unclassified
120 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
121 2738541358 Bacillus sp. OV752 Isolate Unclassified
122 2738543006 Bacillus sp. OK077 Isolate Unclassified
123 2738543010 Bacillus sp. YR335 Isolate Unclassified
124 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
125 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
126 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
127 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
128 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
129 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
130 2811994870 Bacillus sp. JB4 Isolate Unclassified
131 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
132 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
133 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
134 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
135 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
136 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
137 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
138 2842682962 Bacillus sp. R-72492 Isolate Unclassified
139 2849139964 Bacillus sp. R-71875 Isolate Unclassified
140 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
141 2857472729 Cohnella sp. R-74144 Isolate Unclassified
142 2857581216 Bacillus sp. R-71922 Isolate Unclassified
143 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
144 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
145 2860837431 Bacillus sp. WR11 Isolate Unclassified
146 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
147 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
148 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
149 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
150 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
151 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
152 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
153 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
154 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
155 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
156 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
157 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
158 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
159 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
160 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
161 2919726948 Bacillus pumilus 4489 Isolate Unclassified
162 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
163 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
164 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
165 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
166 2938917290 Bacillus sp. CR71 Isolate Unclassified
167 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
168 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
169 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
170 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
171 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
172 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
173 2965761152 Bacillus sp. COPE52 Isolate Unclassified
174 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
175 2969141011 Bacillus velezensis MH25 Isolate Unclassified
176 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
177 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
178 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
179 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
180 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
181 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
182 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
183 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
184 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
185 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
186 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
187 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
188 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
189 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
190 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
191 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
192 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
193 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
194 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
195 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
196 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
197 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
198 8022653035 Bacillus sp. Rc4 Isolate Unclassified
199 8022792930 Bacillus sp. Xin Isolate Rhizosphere
200 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
201 8023438354 Bacillus sp. BH2 Isolate Unclassified
202 8023444577 Bacillus sp. BH32 Isolate Unclassified
203 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
204 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
205 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
206 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
207 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
208 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 49.21
Metatranscriptomes 4.37
Isolates 46.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.49
Nodule 0.4
Rhizoplane 3.17
Rhizosphere 56.75
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100004911 3300005339 Bacteria 9246
2 JGI25159J45721_1005495 3300002987 Bacteria 3975
3 JGI25151J46595_10000294 3300003187 Bacteria 55267
4 JGI25151J46595_10004784 3300003187 Bacteria 7095
5 JGI25151J46595_10007909 3300003187 Bacteria 5161
6 JGI25151J46595_10009605 3300003187 Bacteria 4564
7 JGI25151J46595_10044580 3300003187 Bacteria 1574
8 JGI25151J46595_10052048 3300003187 Bacteria 1381
9 JGI25151J46595_10058766 3300003187 Bacteria 1242
10 Ga0006562J51391_1000026 3300003578 Bacteria 55240
11 Ga0006562J51391_1028952 3300003578 Bacteria 1456
12 Ga0055538_1000645 3300003751 Bacteria 11093
13 Ga0055532_1000183 3300003758 Bacteria 53163
14 Ga0055536_1017141 3300003781 Bacteria 2383
15 Ga0070658_10016542 3300005327 Bacteria 5902
16 Ga0070660_100237771 3300005339 Bacteria 1483
17 Ga0070714_100064463 3300005435 Bacteria 3154
18 Ga0070711_100140806 3300005439 Bacteria 1808
19 Ga0105244_10014498 3300009036 Bacteria 4554
20 Ga0105244_10015912 3300009036 Bacteria 4302
21 Ga0105244_10019501 3300009036 Bacteria 3783
22 Ga0105244_10065324 3300009036 Bacteria 1823
23 Ga0105244_10099153 3300009036 Bacteria 1427
24 Ga0105250_10007983 3300009092 Bacteria 4517
25 Ga0105250_10013710 3300009092 Bacteria 3339
26 Ga0105250_10014594 3300009092 Bacteria 3224
27 Ga0105240_10231933 3300009093 Unclassified 2145
28 Ga0105245_10090357 3300009098 Bacteria 2816
29 Ga0105241_10089414 3300009174 Bacteria 2426
30 Ga0105237_10000024 3300009545 Bacteria 223776
31 Ga0105238_10035708 3300009551 Bacteria 5052
32 Ga0105239_10012422 3300010375 Bacteria 9485
33 Ga0105246_10006639 3300011119 Bacteria 7076
34 Ga0157371_10100360 3300013102 Bacteria 2053
35 Ga0157374_10010319 3300013296 Bacteria 8034
36 Ga0213875_10005751 3300021388 Bacteria 6605
37 Ga0209784_100342 3300025224 Bacteria 22887
38 Ga0209147_100240 3300025229 Bacteria 53218
39 Ga0209147_102406 3300025229 Bacteria 4681
40 Ga0209147_102629 3300025229 Bacteria 4227
41 Ga0209130_1003479 3300025284 Bacteria 6645
42 Ga0209130_1008482 3300025284 Bacteria 3031
43 Ga0209676_1001491 3300025292 Bacteria 21530
44 Ga0209676_1005226 3300025292 Bacteria 6878
45 Ga0209676_1005978 3300025292 Bacteria 6152
46 Ga0209025_1000734 3300025294 Bacteria 55490
47 Ga0209025_1000834 3300025294 Bacteria 48958
48 Ga0209025_1001524 3300025294 Bacteria 29647
49 Ga0209025_1001528 3300025294 Bacteria 29602
50 Ga0209025_1002585 3300025294 Bacteria 18739
51 Ga0209025_1003646 3300025294 Bacteria 14286
52 Ga0209025_1004071 3300025294 Bacteria 13057
53 Ga0209025_1008066 3300025294 Bacteria 7665
54 Ga0209025_1020612 3300025294 Bacteria 3595
55 Ga0209025_1021598 3300025294 Bacteria 3460
56 Ga0209025_1022150 3300025294 Bacteria 3384
57 Ga0209025_1024964 3300025294 Bacteria 3063
58 Ga0209025_1036951 3300025294 Bacteria 2176
59 Ga0209025_1058077 3300025294 Bacteria 1473
60 Ga0207696_1001319 3300025711 Bacteria 13715
61 Ga0207696_1006800 3300025711 Bacteria 4559
62 Ga0207696_1008596 3300025711 Bacteria 3882
63 Ga0207696_1051969 3300025711 Bacteria 1169
64 Ga0207655_1001869 3300025728 Bacteria 18138
65 Ga0207655_1028642 3300025728 Bacteria 2624
66 Ga0207655_1059975 3300025728 Bacteria 1477
67 Ga0207713_1005364 3300025735 Bacteria 8048
68 Ga0207705_10013269 3300025909 Bacteria 5948
69 Ga0207671_10000051 3300025914 Bacteria 189023
70 Ga0207663_10155406 3300025916 Bacteria 1609
71 Ga0207657_10029513 3300025919 Bacteria 4990
72 Ga0207659_10155340 3300025926 Bacteria 1791
73 Ga0207687_10052159 3300025927 Bacteria 2853
74 Ga0207664_10013357 3300025929 Bacteria 5891
75 Ga0207709_10033984 3300025935 Bacteria 3000
76 Ga0209973_1001445 3300027252 Bacteria 2077
77 Ga0209371_1007980 3300027312 Bacteria 3589
78 Ga0237817_10033 3300030083 Bacteria 48418
79 Ga0237817_10334 3300030083 Bacteria 8970
80 Ga0268256_1008270 3300030500 Bacteria 3590
81 Ga0307408_100262561 3300031548 Bacteria 1430
82 Ga0307409_100102924 3300031995 Bacteria 2374
83 Ga0307416_100016381 3300032002 Bacteria 5151
84 Ga0307416_100119196 3300032002 Bacteria 2347
85 Ga0395900_0003090 3300037418 Bacteria 18082
86 Ga0395898_0010809 3300037466 Bacteria 9537
87 Ga0436364_0040027 3300037853 Bacteria 27527
88 Ga0237819_00117 3300038705 Bacteria 29665
89 Ga0237819_01300 3300038705 Bacteria 6716
90 Ga0439436_0002088 3300041404 Bacteria 5962
91 Ga0439439_0000461 3300041406 Bacteria 6928
92 Ga0439433_0004064 3300041999 Bacteria 3144
93 Ga0439449_0000011 3300042007 Bacteria 57369
94 Ga0439462_0000878 3300042015 Bacteria 6315
95 Ga0451577_0074168 3300042876 Unclassified 3035
96 Ga0453683_0001850 3300044673 Bacteria 17368
97 Ga0453684_0000026 3300044712 Bacteria 792958
98 Ga0466959_0007304 3300045049 Bacteria 7745
99 Ga0451576_0000050 3300045051 Bacteria 315118
100 Ga0466967_0336999 3300045976 Bacteria 1458
101 Ga0466967_0503914 3300045976 Bacteria 1188
102 Ga0495605_0044268 3300046474 Bacteria 2202
103 Ga0495654_0089427 3300046530 Bacteria 1431
104 Ga0495661_0074588 3300046665 Bacteria 1974
105 Ga0495661_0165868 3300046665 Bacteria 1182
106 Ga0495660_0023077 3300046810 Bacteria 3551
107 Ga0496100_0153638 3300048903 Bacteria 1644
108 Ga0496102_0023359 3300048905 Bacteria 5491
109 Ga0496103_0024014 3300048906 Bacteria 3678
110 Ga0496110_0000765 3300048913 Bacteria 22271
111 Ga0496111_0131153 3300048914 Bacteria 1854
112 Ga0496112_0577735 3300048915 Bacteria 1057
113 Ga0496115_0064412 3300048918 Bacteria 2959
114 Ga0496116_0005418 3300048919 Bacteria 11859
115 Ga0496119_0077747 3300048922 Bacteria 1921
116 Ga0496120_0073305 3300048923 Bacteria 1874
117 Ga0496122_0018451 3300048925 Bacteria 6443
118 Ga0496122_0022091 3300048925 Bacteria 5668
119 Ga0496124_0000211 3300048927 Bacteria 113824
120 Ga0496125_0005546 3300048928 Bacteria 13961
121 Ga0501306_003837 3300049127 Bacteria 1646
122 Ga0501343_000942 3300049132 Bacteria 1878
123 Ga0501305_004208 3300049161 Bacteria 1679
124 Ga0501305_007463 3300049161 Bacteria 1390
125 Ga0501312_000143 3300049528 Bacteria 4528
126 Ga0501313_001894 3300049529 Bacteria 1912
127 Ga0501317_001374 3300049533 Bacteria 2090
128 Ga0501321_000820 3300049537 Bacteria 2224
129 Ga0501335_000929 3300049551 Bacteria 2102
130 Ga0501075_0261940 3300049591 Bacteria 1318
131 Ga0501217_010586 3300049661 Bacteria 2022
132 Ga0501081_0121987 3300049743 Bacteria 1857
133 Ga0501035_0000330 3300049822 Bacteria 55037
134 Ga0501212_014117 3300049851 Bacteria 1179
135 Ga0530510_0077553 3300061734 Bacteria 2415
136 2511181061 2510917027 Bacteria 5287437
137 2511697949 2511231119 Bacteria 4019861
138 2512639413 2512564013 Bacteria 6286191
139 2540605174 2540341094 Bacteria 4061186
140 2545559797 2545555800 Bacteria 4222588
141 2553393207 2551306519 Bacteria 5465154
142 2555470987 2554235283 Bacteria 3683090
143 2556066094 2554235469 Bacteria 3590176
144 2578930754 2576861599 Bacteria 4217202
145 2595092148 2593339131 Bacteria 5116855
146 2595320833 2593339198 Bacteria 7267884
147 2631985890 2630968484 Bacteria 3876276
148 2644705841 2643221729 Bacteria 6621700
149 2644713291 2643221730 Bacteria 6523787
150 2644741696 2643221735 Bacteria 3676263
151 2651529593 2648501850 Bacteria 3975476
152 2672333535 2671180330 Bacteria 5521719
153 2674421220 2671180844 Bacteria 4164150
154 2685153521 2684622632 Bacteria 5380049
155 2686995272 2684623153 Bacteria 3878815
156 2687496521 2687453109 Bacteria 3860091
157 2695629865 2695420354 Bacteria 3922431
158 2698319671 2695420987 Bacteria 6152737
159 2705991970 2703719227 Bacteria 5631989
160 2712198684 2711768088 Bacteria 3195027
161 2717914449 2716884898 Bacteria 3928789
162 2721503395 2718218445 Bacteria 5113413
163 2738817542 2738541295 Bacteria 5730091
164 2738840662 2738541299 Bacteria 4020721
165 2739160279 2738541358 Bacteria 5932299
166 2739212798 2738543006 Bacteria 5904091
167 2739234736 2738543010 Bacteria 5583595
168 2757569028 2757320391 Bacteria 4746095
169 2777762453 2775507177 Bacteria 4384303
170 2777838560 2775507192 Bacteria 4622234
171 2791211425 2788500588 Bacteria 4584915
172 2793182005 2791355222 Bacteria 5898266
173 2809057106 2808606399 Bacteria 4021018
174 2812314409 2811994870 Bacteria 3776934
175 2816866479 2816332186 Bacteria 5331395
176 2817478137 2816332295 Bacteria 4352468
177 2819585076 2818991443 Bacteria 6598732
178 2819629543 2818991451 Bacteria 4697364
179 2819726166 2818991468 Bacteria 3723169
180 2823526362 2823526263 Bacteria 3765752
181 2831907826 2831905167 Bacteria 3319172
182 2842688440 2842682962 Bacteria 5589973
183 2849145071 2849139964 Bacteria 5613304
184 2852677332 2852673933 Bacteria 3347676
185 2857477541 2857472729 Bacteria 6568124
186 2857586581 2857581216 Bacteria 5522813
187 2857609019 2857604169 Bacteria 5111450
188 2857613560 2857609550 Bacteria 3753890
189 2860837526 2860837431 Bacteria 4202080
190 2865002683 2864997549 Bacteria 5139696
191 2877768745 2877768649 Bacteria 3957164
192 2880169688 2880169592 Bacteria 3900066
193 2881647400 2881644220 Bacteria 5302661
194 2889052451 2889049205 Bacteria 7524325
195 2889298995 2889295896 Bacteria 4704906
196 2897109715 2897109615 Bacteria 4009619
197 2898908088 2898907183 Bacteria 4067722
198 2904564492 2904560550 Bacteria 4029838
199 2904611446 2904606771 Bacteria 4684500
200 2908669238 2908665501 Bacteria 3678115
201 2915598653 2915597211 Bacteria 6475886
202 2915610208 2915606848 Bacteria 6032732
203 2919096997 2919093281 Bacteria 3660974
204 2919419104 2919414237 Bacteria 5429133
205 2919730668 2919726948 Bacteria 3696050
206 2929183799 2929183550 Bacteria 6377511
207 2929233209 2929233124 Bacteria 5948380
208 2936343284 2936340661 Bacteria 5139038
209 2936363637 2936361878 Bacteria 5632809
210 2938917387 2938917290 Bacteria 5914775
211 2939596725 2939593269 Bacteria 4798695
212 2947426675 2947426588 Bacteria 5357194
213 2954776133 2954773129 Bacteria 3741715
214 2956901113 2956897341 Bacteria 5447711
215 2962290736 2962290636 Bacteria 4072939
216 2964376572 2964375228 Bacteria 4909004
217 2965761176 2965761152 Bacteria 5806513
218 2969136943 2969136845 Bacteria 3923176
219 2969141109 2969141011 Bacteria 4118468
220 2969766353 2969765954 Bacteria 4216713
221 2969770437 2969770375 Bacteria 4271280
222 2971893473 2971893375 Bacteria 3929648
223 2977254752 2977254563 Bacteria 4828420
224 2979089232 2979083700 Bacteria 5894929
225 2980129795 2980125574 Bacteria 5567337
226 2980492687 2980492589 Bacteria 4072961
227 2981289624 2981284811 Bacteria 4641497
228 2981294569 2981289755 Bacteria 4641509
229 2981985163 2981980479 Bacteria 4641628
230 2981990097 2981985349 Bacteria 4641497
231 2990275752 2990275345 Bacteria 4887158
232 3001272073 3001267043 Bacteria 4823521
233 3001275897 3001272096 Bacteria 4729684
234 3001894081 3001892409 Bacteria 6328293
235 3006858461 3006858327 Bacteria 4317835
236 3006978398 3006973921 Bacteria 4423788
237 3006980069 3006978542 Bacteria 5328100
238 3006988448 3006984091 Bacteria 4207523
239 3006993254 3006988479 Bacteria 4767936
240 8022621174 8022621104 Bacteria 5241040
241 8022631679 8022630665 Bacteria 3886130
242 8022656347 8022653035 Bacteria 4035078
243 8022795990 8022792930 Bacteria 5693794
244 8022952072 8022948649 Bacteria 5366783
245 8023440690 8023438354 Bacteria 5779374
246 8023447707 8023444577 Bacteria 5661597
247 8051956615 8051952484 Bacteria 3926774
248 8052175092 8052174270 Bacteria 3881265
249 8054282959 8054280661 Bacteria 4232245
250 8055531901 8055531788 Bacteria 5249694
251 8057582742 8057582654 Bacteria 5218944
252 8057632225 8057632132 Bacteria 4726859
253 Ga0070660_100004911
254 JGI25159J45721_1005495
255 JGI25151J46595_10000294
256 JGI25151J46595_10004784
257 JGI25151J46595_10007909
258 JGI25151J46595_10009605
259 JGI25151J46595_10044580
260 JGI25151J46595_10052048
261 JGI25151J46595_10058766
262 Ga0006562J51391_1000026
263 Ga0006562J51391_1028952
264 Ga0055538_1000645
265 Ga0055532_1000183
266 Ga0055536_1017141
267 Ga0070658_10016542
268 Ga0070660_100237771
269 Ga0070714_100064463
270 Ga0070711_100140806
271 Ga0105244_10014498
272 Ga0105244_10015912
273 Ga0105244_10019501
274 Ga0105244_10065324
275 Ga0105244_10099153
276 Ga0105250_10007983
277 Ga0105250_10013710
278 Ga0105250_10014594
279 Ga0105240_10231933
280 Ga0105245_10090357
281 Ga0105241_10089414
282 Ga0105237_10000024
283 Ga0105238_10035708
284 Ga0105239_10012422
285 Ga0105246_10006639
286 Ga0157371_10100360
287 Ga0157374_10010319
288 Ga0213875_10005751
289 Ga0209784_100342
290 Ga0209147_100240
291 Ga0209147_102406
292 Ga0209147_102629
293 Ga0209130_1003479
294 Ga0209130_1008482
295 Ga0209676_1001491
296 Ga0209676_1005226
297 Ga0209676_1005978
298 Ga0209025_1000734
299 Ga0209025_1000834
300 Ga0209025_1001524
301 Ga0209025_1001528
302 Ga0209025_1002585
303 Ga0209025_1003646
304 Ga0209025_1004071
305 Ga0209025_1008066
306 Ga0209025_1020612
307 Ga0209025_1021598
308 Ga0209025_1022150
309 Ga0209025_1024964
310 Ga0209025_1036951
311 Ga0209025_1058077
312 Ga0207696_1001319
313 Ga0207696_1006800
314 Ga0207696_1008596
315 Ga0207696_1051969
316 Ga0207655_1001869
317 Ga0207655_1028642
318 Ga0207655_1059975
319 Ga0207713_1005364
320 Ga0207705_10013269
321 Ga0207671_10000051
322 Ga0207663_10155406
323 Ga0207657_10029513
324 Ga0207659_10155340
325 Ga0207687_10052159
326 Ga0207664_10013357
327 Ga0207709_10033984
328 Ga0209973_1001445
329 Ga0209371_1007980
330 Ga0237817_10033
331 Ga0237817_10334
332 Ga0268256_1008270
333 Ga0307408_100262561
334 Ga0307409_100102924
335 Ga0307416_100016381
336 Ga0307416_100119196
337 Ga0395900_0003090
338 Ga0395898_0010809
339 Ga0436364_0040027
340 Ga0237819_00117
341 Ga0237819_01300
342 Ga0439436_0002088
343 Ga0439439_0000461
344 Ga0439433_0004064
345 Ga0439449_0000011
346 Ga0439462_0000878
347 Ga0451577_0074168
348 Ga0453683_0001850
349 Ga0453684_0000026
350 Ga0466959_0007304
351 Ga0451576_0000050
352 Ga0466967_0336999
353 Ga0466967_0503914
354 Ga0495605_0044268
355 Ga0495654_0089427
356 Ga0495661_0074588
357 Ga0495661_0165868
358 Ga0495660_0023077
359 Ga0496100_0153638
360 Ga0496102_0023359
361 Ga0496103_0024014
362 Ga0496110_0000765
363 Ga0496111_0131153
364 Ga0496112_0577735
365 Ga0496115_0064412
366 Ga0496116_0005418
367 Ga0496119_0077747
368 Ga0496120_0073305
369 Ga0496122_0018451
370 Ga0496122_0022091
371 Ga0496124_0000211
372 Ga0496125_0005546
373 Ga0501306_003837
374 Ga0501343_000942
375 Ga0501305_004208
376 Ga0501305_007463
377 Ga0501312_000143
378 Ga0501313_001894
379 Ga0501317_001374
380 Ga0501321_000820
381 Ga0501335_000929
382 Ga0501075_0261940
383 Ga0501217_010586
384 Ga0501081_0121987
385 Ga0501035_0000330
386 Ga0501212_014117
387 Ga0530510_0077553
388 2511181061
389 2511697949
390 2512639413
391 2540605174
392 2545559797
393 2553393207
394 2555470987
395 2556066094
396 2578930754
397 2595092148
398 2595320833
399 2631985890
400 2644705841
401 2644713291
402 2644741696
403 2651529593
404 2672333535
405 2674421220
406 2685153521
407 2686995272
408 2687496521
409 2695629865
410 2698319671
411 2705991970
412 2712198684
413 2717914449
414 2721503395
415 2738817542
416 2738840662
417 2739160279
418 2739212798
419 2739234736
420 2757569028
421 2777762453
422 2777838560
423 2791211425
424 2793182005
425 2809057106
426 2812314409
427 2816866479
428 2817478137
429 2819585076
430 2819629543
431 2819726166
432 2823526362
433 2831907826
434 2842688440
435 2849145071
436 2852677332
437 2857477541
438 2857586581
439 2857609019
440 2857613560
441 2860837526
442 2865002683
443 2877768745
444 2880169688
445 2881647400
446 2889052451
447 2889298995
448 2897109715
449 2898908088
450 2904564492
451 2904611446
452 2908669238
453 2915598653
454 2915610208
455 2919096997
456 2919419104
457 2919730668
458 2929183799
459 2929233209
460 2936343284
461 2936363637
462 2938917387
463 2939596725
464 2947426675
465 2954776133
466 2956901113
467 2962290736
468 2964376572
469 2965761176
470 2969136943
471 2969141109
472 2969766353
473 2969770437
474 2971893473
475 2977254752
476 2979089232
477 2980129795
478 2980492687
479 2981289624
480 2981294569
481 2981985163
482 2981990097
483 2990275752
484 3001272073
485 3001275897
486 3001894081
487 3006858461
488 3006978398
489 3006980069
490 3006988448
491 3006993254
492 8022621174
493 8022631679
494 8022656347
495 8022795990
496 8022952072
497 8023440690
498 8023447707
499 8051956615
500 8052175092
501 8054282959
502 8055531901
503 8057582742
504 8057632225

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01207

Dus

Dihydrouridine synthase (Dus)

45

356

0.96

PF00977

His_biosynth

Histidine biosynthesis protein

143

262

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ei9-assembly2.cif.gz_B crystal structure of e. coli trna-dihydrouridine synthase b (dusb) 0.955 2 320
1vhn-assembly1.cif.gz_A crystal structure of a putative flavin oxidoreductase with flavin 0.9514 11 322
1vhn-assembly1.cif.gz_A crystal structure of a putative flavin oxidoreductase with flavin 0.9454 11 322
6ei9-assembly2.cif.gz_B crystal structure of e. coli trna-dihydrouridine synthase b (dusb) 0.9308 2 320
3w9z-assembly1.cif.gz_A crystal structure of dusc 0.84 11 317
ID Description Score Start End Superfamily
af_P0ABT5_6_247_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9693 7 249 3.20.20.70
af_P0ABT5_6_247_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9654 7 249 3.20.20.70
af_P9WNS7_19_267_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9635 8 241 3.20.20.70
af_Q9TYN2_201_445_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9575 11 241 3.20.20.70
af_Q9VIS4_253_495_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9475 7 241 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0N0Z3Z5-F1-model_v4 deleted 0.9979 41 253
AF-S7UC72-F1-model_v4 tRNA-dihydrouridine synthase 0.9978 1 253 GO:0003723
GO:0017150
GO:0050660
AF-A0A7X8C3H9-F1-model_v4 tRNA dihydrouridine synthase DusB 0.9943 1 183 GO:0003723
GO:0017150
GO:0050660
AF-A0A7V7SBB5-F1-model_v4 tRNA-dihydrouridine synthase (EC 1.3.1.-) 0.9915 1 332 GO:0000049
GO:0017150
GO:0050660
AF-A0A7C5H937-F1-model_v4 tRNA dihydrouridine synthase DusB 0.9915 2 210 GO:0003723
GO:0017150
GO:0050660

Map