F362937

General Info

Members Datasets Scaffolds Average Seq Length
252 185 245 153

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10041679|Ga0065715_100416792
Length 176
Sequence MMVIMYTEXRDSEAKTGEPFVTEQYLEDFRAGQTFRSGRIRIDANRIKSFAAEFDPQPFHLDERAATDSIFGGLAASGWHTAAITMRLLVDSDLKPAGGIVGAGFDEFRWPRPVRPGDELRVEGEVLEIRASKSRPDQGVIKVRATTINQNNEPVQVSLGHLIVRCRPASSGQGHA

Samples

Sample ID Description Type Environment
1 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
2 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
3 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
4 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
5 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
144 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 0.4
Isolates 2.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.95
Nodule 2.38
Rhizoplane 8.73
Rhizosphere 82.14
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1001153 3300003771 Bacteria 19164
2 Ga0055537_1000078 3300003773 Bacteria 70140
3 Ga0055524_1011245 3300003775 Bacteria 3514
4 Ga0055534_1000105 3300003784 Bacteria 64494
5 Ga0055534_1000342 3300003784 Bacteria 30178
6 Ga0055528_1000690 3300003790 Bacteria 24112
7 Ga0065715_10041679 3300005293 Bacteria 1383
8 Ga0070676_10373780 3300005328 Bacteria 985
9 Ga0070683_100208443 3300005329 Bacteria 1856
10 Ga0068869_100017813 3300005334 Bacteria 4825
11 Ga0068869_100045208 3300005334 Bacteria 3169
12 Ga0068868_100012757 3300005338 Bacteria 6146
13 Ga0070661_100423133 3300005344 Bacteria 1056
14 Ga0070668_100012949 3300005347 Bacteria 6209
15 Ga0070668_100428354 3300005347 Bacteria 1134
16 Ga0070669_100115551 3300005353 Bacteria 2041
17 Ga0070675_100016831 3300005354 Bacteria 5806
18 Ga0070671_100292447 3300005355 Bacteria 1386
19 Ga0070674_100038205 3300005356 Bacteria 3233
20 Ga0070673_100046812 3300005364 Bacteria 3362
21 Ga0070673_100487121 3300005364 Bacteria 1114
22 Ga0070688_100256126 3300005365 Bacteria 1248
23 Ga0070659_100144792 3300005366 Bacteria 1936
24 Ga0070667_100271170 3300005367 Bacteria 1522
25 Ga0070714_100162145 3300005435 Bacteria 2023
26 Ga0070713_100118184 3300005436 Bacteria 2321
27 Ga0070710_10972669 3300005437 Unclassified 617
28 Ga0070711_100100485 3300005439 Bacteria 2104
29 Ga0070711_100137906 3300005439 Bacteria 1825
30 Ga0070700_100597326 3300005441 Bacteria 864
31 Ga0070708_100297366 3300005445 Bacteria 1520
32 Ga0070663_100054608 3300005455 Bacteria 2856
33 Ga0070678_100009293 3300005456 Bacteria 5947
34 Ga0070662_100018655 3300005457 Bacteria 4697
35 Ga0070662_100027258 3300005457 Bacteria 3963
36 Ga0068867_100064826 3300005459 Bacteria 2716
37 Ga0068867_101039417 3300005459 Bacteria 745
38 Ga0070706_100604309 3300005467 Bacteria 1019
39 Ga0070707_101124116 3300005468 Bacteria 752
40 Ga0070699_100555511 3300005518 Bacteria 1045
41 Ga0070697_100438221 3300005536 Bacteria 1137
42 Ga0070672_100161745 3300005543 Bacteria 1858
43 Ga0070672_100741090 3300005543 Bacteria 862
44 Ga0070695_100101112 3300005545 Bacteria 1942
45 Ga0070695_100111230 3300005545 Bacteria 1859
46 Ga0070696_100010827 3300005546 Bacteria 6113
47 Ga0070696_100136619 3300005546 Bacteria 1788
48 Ga0070696_100153651 3300005546 Bacteria 1691
49 Ga0070704_100057260 3300005549 Bacteria 2770
50 Ga0070664_101128852 3300005564 Bacteria 739
51 Ga0068857_100183669 3300005577 Bacteria 1903
52 Ga0068854_100753275 3300005578 Bacteria 845
53 Ga0068854_100961337 3300005578 Bacteria 754
54 Ga0070702_100261219 3300005615 Bacteria 1179
55 Ga0068852_100990842 3300005616 Bacteria 859
56 Ga0068859_101941748 3300005617 Bacteria 650
57 Ga0068859_102251892 3300005617 Bacteria 601
58 Ga0068864_101307224 3300005618 Bacteria 725
59 Ga0068866_10947696 3300005718 Bacteria 608
60 Ga0068861_100066527 3300005719 Bacteria 2778
61 Ga0068861_100462061 3300005719 Bacteria 1140
62 Ga0068851_10392083 3300005834 Bacteria 815
63 Ga0068863_100027700 3300005841 Bacteria 5407
64 Ga0068862_100074381 3300005844 Bacteria 2936
65 Ga0068862_100224835 3300005844 Unclassified 1701
66 Ga0068862_100294676 3300005844 Unclassified 1491
67 Ga0081455_10519577 3300005937 Bacteria 795
68 Ga0075365_10022888 3300006038 Bacteria 3922
69 Ga0070716_100387620 3300006173 Bacteria 1001
70 Ga0070712_100263866 3300006175 Bacteria 1381
71 Ga0075428_100180251 3300006844 Bacteria 2287
72 Ga0075428_100250980 3300006844 Bacteria 1907
73 Ga0075428_101186073 3300006844 Bacteria 805
74 Ga0075430_100092088 3300006846 Bacteria 2535
75 Ga0075430_100617518 3300006846 Bacteria 894
76 Ga0075431_100014288 3300006847 Bacteria 8029
77 Ga0075431_100019119 3300006847 Bacteria 6980
78 Ga0075433_10321980 3300006852 Bacteria 1368
79 Ga0075434_101099513 3300006871 Bacteria 808
80 Ga0075429_100237690 3300006880 Bacteria 1596
81 Ga0068865_100881452 3300006881 Unclassified 777
82 Ga0075436_100330028 3300006914 Unclassified 1097
83 Ga0097620_101941482 3300006931 Bacteria 650
84 Ga0097620_102252194 3300006931 Bacteria 601
85 Ga0105240_11584389 3300009093 Bacteria 685
86 Ga0105240_11790001 3300009093 Bacteria 640
87 Ga0105247_10207941 3300009101 Bacteria 1319
88 Ga0105247_10488599 3300009101 Bacteria 895
89 Ga0114129_10034146 3300009147 Bacteria 7184
90 Ga0114129_10340583 3300009147 Bacteria 1989
91 Ga0114129_10695133 3300009147 Bacteria 1308
92 Ga0105243_10038987 3300009148 Bacteria 3702
93 Ga0105242_10393428 3300009176 Unclassified 1291
94 Ga0105248_10302581 3300009177 Bacteria 1801
95 Ga0105248_11043408 3300009177 Bacteria 924
96 Ga0105237_10463697 3300009545 Bacteria 1273
97 Ga0105249_10053144 3300009553 Bacteria 3702
98 Ga0105249_10155501 3300009553 Bacteria 2205
99 Ga0105249_11203713 3300009553 Bacteria 829
100 Ga0105249_13097914 3300009553 Bacteria 534
101 Ga0099796_10203077 3300010159 Bacteria 805
102 Ga0105239_10055999 3300010375 Bacteria 4326
103 Ga0157369_10691602 3300013105 Bacteria 1050
104 Ga0157374_10029776 3300013296 Bacteria 4950
105 Ga0157374_10282556 3300013296 Bacteria 1639
106 Ga0157378_10618906 3300013297 Bacteria 1096
107 Ga0157378_10866238 3300013297 Bacteria 932
108 Ga0163162_10213947 3300013306 Bacteria 2057
109 Ga0157372_10218036 3300013307 Bacteria 2212
110 Ga0157372_10336371 3300013307 Bacteria 1759
111 Ga0157375_10016149 3300013308 Bacteria 6697
112 Ga0157375_11028546 3300013308 Bacteria 962
113 Ga0157380_10238147 3300014326 Bacteria 1639
114 Ga0157380_10479705 3300014326 Bacteria 1202
115 Ga0182008_10186119 3300014497 Bacteria 1052
116 Ga0157377_10084299 3300014745 Bacteria 1864
117 Ga0157379_10166525 3300014968 Bacteria 1989
118 Ga0157376_10199037 3300014969 Bacteria 1842
119 Ga0157376_11420615 3300014969 Bacteria 726
120 Ga0163161_10134464 3300017792 Bacteria 1868
121 Ga0209565_1000035 3300025263 Bacteria 298125
122 Ga0209673_1000006 3300025273 Bacteria 650600
123 Ga0209675_1000005 3300025291 Bacteria 849192
124 Ga0209564_1000083 3300025295 Bacteria 259272
125 Ga0209256_1000322 3300025299 Bacteria 82681
126 Ga0207697_10037092 3300025315 Bacteria 1996
127 Ga0207656_10119046 3300025321 Bacteria 1228
128 Ga0207642_10011046 3300025899 Bacteria 3207
129 Ga0207688_10407304 3300025901 Bacteria 844
130 Ga0207645_10441728 3300025907 Bacteria 878
131 Ga0207684_11433697 3300025910 Bacteria 564
132 Ga0207695_11297532 3300025913 Bacteria 608
133 Ga0207693_10207618 3300025915 Bacteria 1540
134 Ga0207693_10274893 3300025915 Bacteria 1320
135 Ga0207663_10286579 3300025916 Bacteria 1225
136 Ga0207660_11613862 3300025917 Unclassified 523
137 Ga0207649_10390850 3300025920 Bacteria 1039
138 Ga0207681_10016579 3300025923 Bacteria 4610
139 Ga0207664_10176375 3300025929 Bacteria 1833
140 Ga0207644_10444797 3300025931 Bacteria 1064
141 Ga0207690_10213905 3300025932 Bacteria 1471
142 Ga0207706_10016876 3300025933 Bacteria 6587
143 Ga0207706_10026655 3300025933 Bacteria 5173
144 Ga0207709_10186988 3300025935 Bacteria 1468
145 Ga0207669_10008720 3300025937 Bacteria 4779
146 Ga0207704_11217316 3300025938 Unclassified 642
147 Ga0207665_10050867 3300025939 Bacteria 2788
148 Ga0207691_10015591 3300025940 Bacteria 7226
149 Ga0207689_10019682 3300025942 Bacteria 5688
150 Ga0207679_10115512 3300025945 Bacteria 2126
151 Ga0207651_10041522 3300025960 Bacteria 3054
152 Ga0207651_10550820 3300025960 Bacteria 1003
153 Ga0207712_10347479 3300025961 Bacteria 1232
154 Ga0207712_10537527 3300025961 Bacteria 1004
155 Ga0207668_10812016 3300025972 Bacteria 828
156 Ga0207640_10896478 3300025981 Bacteria 774
157 Ga0207708_10148150 3300026075 Unclassified 1846
158 Ga0207708_10740592 3300026075 Bacteria 843
159 Ga0207641_10084337 3300026088 Bacteria 2766
160 Ga0207648_10021883 3300026089 Bacteria 5745
161 Ga0207648_10057258 3300026089 Bacteria 3400
162 Ga0207648_10563432 3300026089 Bacteria 1047
163 Ga0207648_10590091 3300026089 Bacteria 1023
164 Ga0207676_11604206 3300026095 Bacteria 648
165 Ga0207674_10200583 3300026116 Bacteria 1944
166 Ga0207675_100015994 3300026118 Bacteria 7003
167 Ga0207675_100131167 3300026118 Bacteria 2377
168 Ga0207675_100713672 3300026118 Bacteria 1012
169 Ga0207683_10018453 3300026121 Bacteria 5954
170 Ga0207683_11383995 3300026121 Bacteria 651
171 Ga0209981_1002847 3300027378 Bacteria 2219
172 Ga0209999_1001609 3300027543 Bacteria 3890
173 Ga0209588_1052657 3300027671 Bacteria 1317
174 Ga0209966_1007145 3300027695 Bacteria 1951
175 Ga0209974_10037866 3300027876 Bacteria 1602
176 Ga0268266_11547866 3300028379 Bacteria 639
177 Ga0268265_11729597 3300028380 Unclassified 631
178 Ga0307409_102372165 3300031995 Bacteria 560
179 Ga0316593_10006132 3300032168 Bacteria 3227
180 Ga0373939_0344810 3300035114 Bacteria 605
181 Ga0373939_0401452 3300035114 Bacteria 568
182 Ga0395905_0012339 3300037471 Bacteria 8225
183 Ga0436363_1485667 3300039450 Bacteria 641
184 Ga0439435_0003355 3300042436 Bacteria 3322
185 Ga0439460_0000680 3300042461 Bacteria 7513
186 Ga0450916_015907 3300042530 Bacteria 993
187 Ga0451577_0006567 3300042876 Bacteria 11565
188 Ga0453683_0327132 3300044673 Bacteria 983
189 Ga0451576_0007158 3300045051 Bacteria 13450
190 Ga0451576_0977976 3300045051 Bacteria 887
191 Ga0451576_1044447 3300045051 Bacteria 856
192 Ga0451576_1090883 3300045051 Archaea 835
193 Ga0451576_1188304 3300045051 Bacteria 797
194 Ga0495628_0014078 3300046516 Bacteria 6713
195 Ga0495642_0043776 3300046528 Bacteria 1826
196 Ga0495652_0010201 3300046529 Bacteria 8517
197 Ga0495645_0013238 3300046543 Bacteria 5830
198 Ga0495659_0210013 3300046664 Bacteria 801
199 Ga0495669_0022806 3300046684 Bacteria 2721
200 Ga0495636_0569722 3300047318 Bacteria 552
201 Ga0495675_0224877 3300047444 Bacteria 1134
202 Ga0495602_0745810 3300048088 Bacteria 661
203 Ga0496100_0084540 3300048903 Bacteria 2151
204 Ga0496100_0185538 3300048903 Bacteria 1507
205 Ga0496101_0348529 3300048904 Bacteria 1163
206 Ga0496102_0113819 3300048905 Bacteria 2524
207 Ga0496102_0187766 3300048905 Bacteria 1948
208 Ga0496103_0057400 3300048906 Bacteria 2417
209 Ga0496103_0374699 3300048906 Bacteria 915
210 Ga0496104_0052139 3300048907 Bacteria 3863
211 Ga0496105_0181265 3300048908 Unclassified 1725
212 Ga0496105_0403026 3300048908 Bacteria 1085
213 Ga0496106_0017516 3300048909 Bacteria 5301
214 Ga0496106_0190365 3300048909 Bacteria 1631
215 Ga0496107_0053844 3300048910 Bacteria 2902
216 Ga0496108_0157662 3300048911 Bacteria 1960
217 Ga0496109_0022427 3300048912 Bacteria 5591
218 Ga0496110_0123871 3300048913 Bacteria 2331
219 Ga0496110_1170046 3300048913 Bacteria 678
220 Ga0496112_0326464 3300048915 Bacteria 1478
221 Ga0496112_0892128 3300048915 Bacteria 811
222 Ga0496113_0009187 3300048916 Bacteria 6483
223 Ga0496114_0217606 3300048917 Bacteria 1676
224 Ga0496115_0061125 3300048918 Bacteria 3037
225 Ga0501039_0124815 3300049575 Bacteria 2019
226 Ga0501040_0022637 3300049576 Bacteria 4209
227 Ga0501075_0823606 3300049591 Bacteria 706
228 Ga0501081_0023479 3300049743 Bacteria 4134
229 nmdc:mga0yw44_453114_c1 3300050492 Bacteria 869
230 nmdc:mga0yw44_9006_c1 3300050492 Bacteria 5014
231 nmdc:mga0k408_136863_c1 3300050493 Bacteria 1455
232 nmdc:mga05p37_401852_c1 3300050507 Bacteria 1599
233 nmdc:mga05p37_575626_c1 3300050507 Bacteria 1276
234 nmdc:mga09592_316594_c1 3300050508 Bacteria 1352
235 nmdc:mga0qj67_157132_c1 3300050509 Bacteria 1846
236 nmdc:mga0qj67_273493_c1 3300050509 Bacteria 1369
237 nmdc:mga0qj67_77527_c1 3300050509 Bacteria 2659
238 nmdc:mga06r32_454698_c1 3300050510 Bacteria 1260
239 nmdc:mga06r32_45923_c1 3300050510 Bacteria 4166
240 nmdc:mga06r32_47217_c1 3300050510 Bacteria 4112
241 nmdc:mga06r32_557635_c1 3300050510 Bacteria 1119
242 nmdc:mga0rr50_263861_c1 3300050513 Bacteria 1433
243 nmdc:mga0rr50_957679_c1 3300050513 Bacteria 729
244 nmdc:mga08x19_302232_c1 3300050514 Unclassified 1111
245 Ga0501084_1345702 3300054114 Bacteria 598

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005546 Ga0070696_100153651 Ga0070696_1001536513 140
2 3300050493 nmdc:mga0k408_136863_c1 nmdc:mga0k408_136863_c1_691_1158 143
3 3300027876 Ga0209974_10037866 Ga0209974_100378662 145
4 3300049743 Ga0501081_0023479 Ga0501081_0023479_95_535 145
5 3300050510 nmdc:mga06r32_47217_c1 nmdc:mga06r32_47217_c1_2565_3005 145
6 3300049575 Ga0501039_0124815 Ga0501039_0124815_919_1362 146
7 3300049576 Ga0501040_0022637 Ga0501040_0022637_2347_2790 146
8 3300049591 Ga0501075_0823606 Ga0501075_0823606_61_504 146
9 3300054114 Ga0501084_1345702 Ga0501084_1345702_125_568 146
10 iso_pu_bacteria 2513237351 2514592626 146
11 iso_pu_bacteria 2957443900 2957443928 146
12 iso_pu_bacteria 2960617483 2960622180 146
13 iso_pu_bacteria 2960660292 2960662752 146
14 iso_pu_bacteria 2977523885 2977524017 146
15 iso_pu_bacteria 2977523885 2977524076 146
16 iso_pu_bacteria 8001845381 8001846428 146
17 3300005329 Ga0070683_100208443 Ga0070683_1002084432 147
18 3300013307 Ga0157372_10336371 Ga0157372_103363712 147
19 3300026121 Ga0207683_11383995 Ga0207683_113839951 147
20 3300005437 Ga0070710_10972669 Ga0070710_109726691 148
21 3300005439 Ga0070711_100100485 Ga0070711_1001004853 148
22 3300005459 Ga0068867_100064826 Ga0068867_1000648264 148
23 3300005617 Ga0068859_102251892 Ga0068859_1022518921 148
24 3300005719 Ga0068861_100462061 Ga0068861_1004620612 148
25 3300005844 Ga0068862_100224835 Ga0068862_1002248354 148
26 3300006871 Ga0075434_101099513 Ga0075434_1010995132 148
27 3300006881 Ga0068865_100881452 Ga0068865_1008814522 148
28 3300006931 Ga0097620_102252194 Ga0097620_1022521942 148
29 3300009147 Ga0114129_10034146 Ga0114129_100341464 148
30 3300009147 Ga0114129_10695133 Ga0114129_106951333 148
31 3300009148 Ga0105243_10038987 Ga0105243_100389872 148
32 3300009176 Ga0105242_10393428 Ga0105242_103934281 148
33 3300009553 Ga0105249_13097914 Ga0105249_130979141 148
34 3300010159 Ga0099796_10203077 Ga0099796_102030771 148
35 3300025263 Ga0209565_1000035 Ga0209565_1000035269 148
36 3300025273 Ga0209673_1000006 Ga0209673_1000006359 148
37 3300025291 Ga0209675_1000005 Ga0209675_1000005413 148
38 3300025295 Ga0209564_1000083 Ga0209564_1000083223 148
39 3300025299 Ga0209256_1000322 Ga0209256_100032218 148
40 3300025899 Ga0207642_10011046 Ga0207642_100110464 148
41 3300025915 Ga0207693_10207618 Ga0207693_102076182 148
42 3300025917 Ga0207660_11613862 Ga0207660_116138621 148
43 3300025935 Ga0207709_10186988 Ga0207709_101869882 148
44 3300025937 Ga0207669_10008720 Ga0207669_100087207 148
45 3300025938 Ga0207704_11217316 Ga0207704_112173161 148
46 3300025961 Ga0207712_10537527 Ga0207712_105375271 148
47 3300026075 Ga0207708_10148150 Ga0207708_101481503 148
48 3300026089 Ga0207648_10057258 Ga0207648_100572584 148
49 3300026118 Ga0207675_100131167 Ga0207675_1001311674 148
50 3300027378 Ga0209981_1002847 Ga0209981_10028473 148
51 3300027543 Ga0209999_1001609 Ga0209999_10016094 148
52 3300027671 Ga0209588_1052657 Ga0209588_10526572 148
53 3300027695 Ga0209966_1007145 Ga0209966_10071453 148
54 3300028380 Ga0268265_11729597 Ga0268265_117295971 148
55 3300042436 Ga0439435_0003355 Ga0439435_0003355_1142_1591 148
56 3300042461 Ga0439460_0000680 Ga0439460_0000680_6602_7051 148
57 3300045051 Ga0451576_0977976 Ga0451576_0977976_108_566 148
58 3300046528 Ga0495642_0043776 Ga0495642_0043776_132_590 148
59 3300046664 Ga0495659_0210013 Ga0495659_0210013_327_776 148
60 3300046684 Ga0495669_0022806 Ga0495669_0022806_1003_1452 148
61 3300047318 Ga0495636_0569722 Ga0495636_0569722_68_514 148
62 3300048913 Ga0496110_1170046 Ga0496110_1170046_10_459 148
63 3300050507 nmdc:mga05p37_575626_c1 nmdc:mga05p37_575626_c1_244_711 148
64 3300050509 nmdc:mga0qj67_77527_c1 nmdc:mga0qj67_77527_c1_829_1281 148
65 3300050510 nmdc:mga06r32_557635_c1 nmdc:mga06r32_557635_c1_105_557 148
66 3300005334 Ga0068869_100045208 Ga0068869_1000452082 149
67 3300005338 Ga0068868_100012757 Ga0068868_1000127576 149
68 3300005347 Ga0070668_100012949 Ga0070668_1000129492 149
69 3300005353 Ga0070669_100115551 Ga0070669_1001155512 149
70 3300005354 Ga0070675_100016831 Ga0070675_1000168315 149
71 3300005356 Ga0070674_100038205 Ga0070674_1000382053 149
72 3300005364 Ga0070673_100046812 Ga0070673_1000468124 149
73 3300005441 Ga0070700_100597326 Ga0070700_1005973262 149
74 3300005456 Ga0070678_100009293 Ga0070678_1000092932 149
75 3300005457 Ga0070662_100018655 Ga0070662_1000186552 149
76 3300005467 Ga0070706_100604309 Ga0070706_1006043091 149
77 3300005543 Ga0070672_100161745 Ga0070672_1001617453 149
78 3300005577 Ga0068857_100183669 Ga0068857_1001836692 149
79 3300005578 Ga0068854_100753275 Ga0068854_1007532752 149
80 3300005718 Ga0068866_10947696 Ga0068866_109476962 149
81 3300005719 Ga0068861_100066527 Ga0068861_1000665274 149
82 3300005834 Ga0068851_10392083 Ga0068851_103920832 149
83 3300005841 Ga0068863_100027700 Ga0068863_1000277002 149
84 3300005844 Ga0068862_100074381 Ga0068862_1000743813 149
85 3300005937 Ga0081455_10519577 Ga0081455_105195771 149
86 3300006844 Ga0075428_101186073 Ga0075428_1011860731 149
87 3300006847 Ga0075431_100014288 Ga0075431_1000142882 149
88 3300006852 Ga0075433_10321980 Ga0075433_103219802 149
89 3300006880 Ga0075429_100237690 Ga0075429_1002376902 149
90 3300006914 Ga0075436_100330028 Ga0075436_1003300282 149
91 3300009553 Ga0105249_10155501 Ga0105249_101555013 149
92 3300009553 Ga0105249_11203713 Ga0105249_112037131 149
93 3300013296 Ga0157374_10029776 Ga0157374_100297762 149
94 3300013308 Ga0157375_10016149 Ga0157375_100161492 149
95 3300014326 Ga0157380_10238147 Ga0157380_102381472 149
96 3300025321 Ga0207656_10119046 Ga0207656_101190463 149
97 3300025910 Ga0207684_11433697 Ga0207684_114336971 149
98 3300025923 Ga0207681_10016579 Ga0207681_100165796 149
99 3300025933 Ga0207706_10026655 Ga0207706_100266555 149
100 3300025940 Ga0207691_10015591 Ga0207691_100155917 149
101 3300025945 Ga0207679_10115512 Ga0207679_101155122 149
102 3300025960 Ga0207651_10041522 Ga0207651_100415222 149
103 3300025961 Ga0207712_10347479 Ga0207712_103474793 149
104 3300025981 Ga0207640_10896478 Ga0207640_108964782 149
105 3300026075 Ga0207708_10740592 Ga0207708_107405921 149
106 3300026088 Ga0207641_10084337 Ga0207641_100843373 149
107 3300026089 Ga0207648_10021883 Ga0207648_100218831 149
108 3300026116 Ga0207674_10200583 Ga0207674_102005832 149
109 3300026118 Ga0207675_100015994 Ga0207675_1000159942 149
110 3300026121 Ga0207683_10018453 Ga0207683_100184532 149
111 3300035114 Ga0373939_0401452 Ga0373939_0401452_28_495 149
112 3300039450 Ga0436363_1485667 Ga0436363_1485667_100_549 149
113 3300042876 Ga0451577_0006567 Ga0451577_0006567_1336_1785 149
114 3300044673 Ga0453683_0327132 Ga0453683_0327132_476_925 149
115 3300045051 Ga0451576_0007158 Ga0451576_0007158_2570_3019 149
116 3300045051 Ga0451576_1044447 Ga0451576_1044447_266_733 149
117 3300045051 Ga0451576_1090883 Ga0451576_1090883_358_822 149
118 3300045051 Ga0451576_1188304 Ga0451576_1188304_228_695 149
119 3300046516 Ga0495628_0014078 Ga0495628_0014078_2794_3246 149
120 3300046529 Ga0495652_0010201 Ga0495652_0010201_2955_3407 149
121 3300046543 Ga0495645_0013238 Ga0495645_0013238_2751_3203 149
122 3300047444 Ga0495675_0224877 Ga0495675_0224877_304_756 149
123 3300048088 Ga0495602_0745810 Ga0495602_0745810_65_517 149
124 3300050492 nmdc:mga0yw44_453114_c1 nmdc:mga0yw44_453114_c1_80_532 149
125 3300050507 nmdc:mga05p37_401852_c1 nmdc:mga05p37_401852_c1_497_952 149
126 3300050508 nmdc:mga09592_316594_c1 nmdc:mga09592_316594_c1_243_698 149
127 3300050510 nmdc:mga06r32_454698_c1 nmdc:mga06r32_454698_c1_41_496 149
128 3300050514 nmdc:mga08x19_302232_c1 nmdc:mga08x19_302232_c1_170_637 149
129 3300003771 Ga0055526_1001153 Ga0055526_100115316 150
130 3300003773 Ga0055537_1000078 Ga0055537_100007843 150
131 3300003775 Ga0055524_1011245 Ga0055524_10112455 150
132 3300003784 Ga0055534_1000105 Ga0055534_100010514 150
133 3300003784 Ga0055534_1000342 Ga0055534_100034215 150
134 3300003790 Ga0055528_1000690 Ga0055528_100069010 150
135 3300005293 Ga0065715_10041679 Ga0065715_100416792 150
136 3300005328 Ga0070676_10373780 Ga0070676_103737801 150
137 3300005334 Ga0068869_100017813 Ga0068869_1000178132 150
138 3300005344 Ga0070661_100423133 Ga0070661_1004231331 150
139 3300005347 Ga0070668_100428354 Ga0070668_1004283541 150
140 3300005355 Ga0070671_100292447 Ga0070671_1002924472 150
141 3300005364 Ga0070673_100487121 Ga0070673_1004871212 150
142 3300005365 Ga0070688_100256126 Ga0070688_1002561262 150
143 3300005366 Ga0070659_100144792 Ga0070659_1001447921 150
144 3300005367 Ga0070667_100271170 Ga0070667_1002711701 150
145 3300005435 Ga0070714_100162145 Ga0070714_1001621452 150
146 3300005436 Ga0070713_100118184 Ga0070713_1001181842 150
147 3300005439 Ga0070711_100137906 Ga0070711_1001379062 150
148 3300005445 Ga0070708_100297366 Ga0070708_1002973662 150
149 3300005455 Ga0070663_100054608 Ga0070663_1000546083 150
150 3300005457 Ga0070662_100027258 Ga0070662_1000272582 150
151 3300005459 Ga0068867_101039417 Ga0068867_1010394171 150
152 3300005468 Ga0070707_101124116 Ga0070707_1011241162 150
153 3300005518 Ga0070699_100555511 Ga0070699_1005555112 150
154 3300005536 Ga0070697_100438221 Ga0070697_1004382211 150
155 3300005543 Ga0070672_100741090 Ga0070672_1007410902 150
156 3300005545 Ga0070695_100101112 Ga0070695_1001011123 150
157 3300005545 Ga0070695_100111230 Ga0070695_1001112304 150
158 3300005546 Ga0070696_100010827 Ga0070696_1000108275 150
159 3300005546 Ga0070696_100136619 Ga0070696_1001366191 150
160 3300005549 Ga0070704_100057260 Ga0070704_1000572602 150
161 3300005564 Ga0070664_101128852 Ga0070664_1011288521 150
162 3300005578 Ga0068854_100961337 Ga0068854_1009613372 150
163 3300005615 Ga0070702_100261219 Ga0070702_1002612192 150
164 3300005616 Ga0068852_100990842 Ga0068852_1009908422 150
165 3300005617 Ga0068859_101941748 Ga0068859_1019417481 150
166 3300005618 Ga0068864_101307224 Ga0068864_1013072241 150
167 3300005844 Ga0068862_100294676 Ga0068862_1002946762 150
168 3300006038 Ga0075365_10022888 Ga0075365_100228883 150
169 3300006173 Ga0070716_100387620 Ga0070716_1003876202 150
170 3300006175 Ga0070712_100263866 Ga0070712_1002638662 150
171 3300006844 Ga0075428_100180251 Ga0075428_1001802514 150
172 3300006844 Ga0075428_100250980 Ga0075428_1002509801 150
173 3300006846 Ga0075430_100092088 Ga0075430_1000920883 150
174 3300006846 Ga0075430_100617518 Ga0075430_1006175181 150
175 3300006847 Ga0075431_100019119 Ga0075431_1000191193 150
176 3300006931 Ga0097620_101941482 Ga0097620_1019414821 150
177 3300009093 Ga0105240_11584389 Ga0105240_115843892 150
178 3300009093 Ga0105240_11790001 Ga0105240_117900011 150
179 3300009101 Ga0105247_10207941 Ga0105247_102079413 150
180 3300009101 Ga0105247_10488599 Ga0105247_104885991 150
181 3300009147 Ga0114129_10340583 Ga0114129_103405833 150
182 3300009177 Ga0105248_10302581 Ga0105248_103025812 150
183 3300009177 Ga0105248_11043408 Ga0105248_110434081 150
184 3300009545 Ga0105237_10463697 Ga0105237_104636972 150
185 3300009553 Ga0105249_10053144 Ga0105249_100531447 150
186 3300010375 Ga0105239_10055999 Ga0105239_100559992 150
187 3300013105 Ga0157369_10691602 Ga0157369_106916021 150
188 3300013296 Ga0157374_10282556 Ga0157374_102825562 150
189 3300013297 Ga0157378_10618906 Ga0157378_106189061 150
190 3300013297 Ga0157378_10866238 Ga0157378_108662382 150
191 3300013306 Ga0163162_10213947 Ga0163162_102139472 150
192 3300013307 Ga0157372_10218036 Ga0157372_102180362 150
193 3300013308 Ga0157375_11028546 Ga0157375_110285461 150
194 3300014326 Ga0157380_10479705 Ga0157380_104797051 150
195 3300014497 Ga0182008_10186119 Ga0182008_101861192 150
196 3300014745 Ga0157377_10084299 Ga0157377_100842991 150
197 3300014968 Ga0157379_10166525 Ga0157379_101665252 150
198 3300014969 Ga0157376_10199037 Ga0157376_101990373 150
199 3300014969 Ga0157376_11420615 Ga0157376_114206151 150
200 3300017792 Ga0163161_10134464 Ga0163161_101344642 150
201 3300025315 Ga0207697_10037092 Ga0207697_100370922 150
202 3300025901 Ga0207688_10407304 Ga0207688_104073041 150
203 3300025907 Ga0207645_10441728 Ga0207645_104417281 150
204 3300025913 Ga0207695_11297532 Ga0207695_112975321 150
205 3300025915 Ga0207693_10274893 Ga0207693_102748931 150
206 3300025916 Ga0207663_10286579 Ga0207663_102865792 150
207 3300025920 Ga0207649_10390850 Ga0207649_103908501 150
208 3300025929 Ga0207664_10176375 Ga0207664_101763752 150
209 3300025931 Ga0207644_10444797 Ga0207644_104447971 150
210 3300025932 Ga0207690_10213905 Ga0207690_102139051 150
211 3300025933 Ga0207706_10016876 Ga0207706_100168762 150
212 3300025939 Ga0207665_10050867 Ga0207665_100508672 150
213 3300025942 Ga0207689_10019682 Ga0207689_100196822 150
214 3300025960 Ga0207651_10550820 Ga0207651_105508202 150
215 3300025972 Ga0207668_10812016 Ga0207668_108120161 150
216 3300026089 Ga0207648_10563432 Ga0207648_105634322 150
217 3300026089 Ga0207648_10590091 Ga0207648_105900912 150
218 3300026095 Ga0207676_11604206 Ga0207676_116042061 150
219 3300026118 Ga0207675_100713672 Ga0207675_1007136721 150
220 3300028379 Ga0268266_11547866 Ga0268266_115478661 150
221 3300031995 Ga0307409_102372165 Ga0307409_1023721651 150
222 3300032168 Ga0316593_10006132 Ga0316593_100061322 150
223 3300035114 Ga0373939_0344810 Ga0373939_0344810_123_584 150
224 3300037471 Ga0395905_0012339 Ga0395905_0012339_547_999 150
225 3300042530 Ga0450916_015907 Ga0450916_015907_406_876 150
226 3300048903 Ga0496100_0084540 Ga0496100_0084540_931_1392 150
227 3300048903 Ga0496100_0185538 Ga0496100_0185538_733_1221 150
228 3300048904 Ga0496101_0348529 Ga0496101_0348529_573_1034 150
229 3300048905 Ga0496102_0113819 Ga0496102_0113819_1681_2142 150
230 3300048905 Ga0496102_0187766 Ga0496102_0187766_291_749 150
231 3300048906 Ga0496103_0057400 Ga0496103_0057400_1142_1603 150
232 3300048906 Ga0496103_0374699 Ga0496103_0374699_109_642 150
233 3300048907 Ga0496104_0052139 Ga0496104_0052139_3373_3834 150
234 3300048908 Ga0496105_0181265 Ga0496105_0181265_1080_1541 150
235 3300048908 Ga0496105_0403026 Ga0496105_0403026_429_887 150
236 3300048909 Ga0496106_0017516 Ga0496106_0017516_1495_1956 150
237 3300048909 Ga0496106_0190365 Ga0496106_0190365_599_1132 150
238 3300048910 Ga0496107_0053844 Ga0496107_0053844_843_1304 150
239 3300048911 Ga0496108_0157662 Ga0496108_0157662_1031_1492 150
240 3300048912 Ga0496109_0022427 Ga0496109_0022427_771_1232 150
241 3300048913 Ga0496110_0123871 Ga0496110_0123871_529_990 150
242 3300048915 Ga0496112_0326464 Ga0496112_0326464_988_1449 150
243 3300048915 Ga0496112_0892128 Ga0496112_0892128_326_784 150
244 3300048916 Ga0496113_0009187 Ga0496113_0009187_4396_4857 150
245 3300048917 Ga0496114_0217606 Ga0496114_0217606_974_1435 150
246 3300048918 Ga0496115_0061125 Ga0496115_0061125_940_1401 150
247 3300050492 nmdc:mga0yw44_9006_c1 nmdc:mga0yw44_9006_c1_3357_3830 150
248 3300050509 nmdc:mga0qj67_157132_c1 nmdc:mga0qj67_157132_c1_1375_1830 150
249 3300050509 nmdc:mga0qj67_273493_c1 nmdc:mga0qj67_273493_c1_536_988 150
250 3300050510 nmdc:mga06r32_45923_c1 nmdc:mga06r32_45923_c1_2326_2781 150
251 3300050513 nmdc:mga0rr50_263861_c1 nmdc:mga0rr50_263861_c1_38_523 150
252 3300050513 nmdc:mga0rr50_957679_c1 nmdc:mga0rr50_957679_c1_218_679 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

30

157

0.88

PF01575

MaoC_dehydratas

MaoC like domain

28

149

0.87

PF19315

MC_hydratase

Mesaconyl-CoA hydratase

12

176

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3exz-assembly1.cif.gz_A crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. 0.9724 4 147
3exz-assembly1.cif.gz_A crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. 0.9465 4 147
8hgn-assembly1.cif.gz_A crystal structure of meac (mesaconyl-coa hydratase) 0.8844 4 149
4e3e-assembly1.cif.gz_A crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl 0.8808 4 148
4ffu-assembly2.cif.gz_K crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8784 2 146
ID Description Score Start End Superfamily
3exzC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9689 4 147 3.10.129.10
3exzC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9622 4 147 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9082 2 148 3.10.129.10
4ffuI00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8918 2 149 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8854 2 148 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A537BWS2-F1-model_v4 MaoC family dehydratase 0.9968 1 147
AF-A0A534TDR8-F1-model_v4 MaoC family dehydratase 0.9947 3 147
AF-A0A6N1AUX9-F1-model_v4 MaoC family dehydratase 0.9943 3 147
AF-A0A536UPD6-F1-model_v4 MaoC family dehydratase 0.9937 3 150
AF-H3NXZ1-F1-model_v4 Acyl dehydratase 0.9935 2 150

Feature Viewer

pLDDT pTM Quality
94.72 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map