F362937
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 252 | 185 | 245 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300005293|Ga0065715_10041679|Ga0065715_100416792 |
| Length | 176 |
| Sequence | MMVIMYTEXRDSEAKTGEPFVTEQYLEDFRAGQTFRSGRIRIDANRIKSFAAEFDPQPFHLDERAATDSIFGGLAASGWHTAAITMRLLVDSDLKPAGGIVGAGFDEFRWPRPVRPGDELRVEGEVLEIRASKSRPDQGVIKVRATTINQNNEPVQVSLGHLIVRCRPASSGQGHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 2 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 3 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 4 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 5 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 142 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 143 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 144 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 147 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 148 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 160 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 161 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 164 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 165 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 168 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 169 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 170 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 171 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 177 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 178 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.83 |
| Metatranscriptomes | 0.4 |
| Isolates | 2.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.95 |
| Nodule | 2.38 |
| Rhizoplane | 8.73 |
| Rhizosphere | 82.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055526_1001153 | 3300003771 | Bacteria | 19164 |
| 2 | Ga0055537_1000078 | 3300003773 | Bacteria | 70140 |
| 3 | Ga0055524_1011245 | 3300003775 | Bacteria | 3514 |
| 4 | Ga0055534_1000105 | 3300003784 | Bacteria | 64494 |
| 5 | Ga0055534_1000342 | 3300003784 | Bacteria | 30178 |
| 6 | Ga0055528_1000690 | 3300003790 | Bacteria | 24112 |
| 7 | Ga0065715_10041679 | 3300005293 | Bacteria | 1383 |
| 8 | Ga0070676_10373780 | 3300005328 | Bacteria | 985 |
| 9 | Ga0070683_100208443 | 3300005329 | Bacteria | 1856 |
| 10 | Ga0068869_100017813 | 3300005334 | Bacteria | 4825 |
| 11 | Ga0068869_100045208 | 3300005334 | Bacteria | 3169 |
| 12 | Ga0068868_100012757 | 3300005338 | Bacteria | 6146 |
| 13 | Ga0070661_100423133 | 3300005344 | Bacteria | 1056 |
| 14 | Ga0070668_100012949 | 3300005347 | Bacteria | 6209 |
| 15 | Ga0070668_100428354 | 3300005347 | Bacteria | 1134 |
| 16 | Ga0070669_100115551 | 3300005353 | Bacteria | 2041 |
| 17 | Ga0070675_100016831 | 3300005354 | Bacteria | 5806 |
| 18 | Ga0070671_100292447 | 3300005355 | Bacteria | 1386 |
| 19 | Ga0070674_100038205 | 3300005356 | Bacteria | 3233 |
| 20 | Ga0070673_100046812 | 3300005364 | Bacteria | 3362 |
| 21 | Ga0070673_100487121 | 3300005364 | Bacteria | 1114 |
| 22 | Ga0070688_100256126 | 3300005365 | Bacteria | 1248 |
| 23 | Ga0070659_100144792 | 3300005366 | Bacteria | 1936 |
| 24 | Ga0070667_100271170 | 3300005367 | Bacteria | 1522 |
| 25 | Ga0070714_100162145 | 3300005435 | Bacteria | 2023 |
| 26 | Ga0070713_100118184 | 3300005436 | Bacteria | 2321 |
| 27 | Ga0070710_10972669 | 3300005437 | Unclassified | 617 |
| 28 | Ga0070711_100100485 | 3300005439 | Bacteria | 2104 |
| 29 | Ga0070711_100137906 | 3300005439 | Bacteria | 1825 |
| 30 | Ga0070700_100597326 | 3300005441 | Bacteria | 864 |
| 31 | Ga0070708_100297366 | 3300005445 | Bacteria | 1520 |
| 32 | Ga0070663_100054608 | 3300005455 | Bacteria | 2856 |
| 33 | Ga0070678_100009293 | 3300005456 | Bacteria | 5947 |
| 34 | Ga0070662_100018655 | 3300005457 | Bacteria | 4697 |
| 35 | Ga0070662_100027258 | 3300005457 | Bacteria | 3963 |
| 36 | Ga0068867_100064826 | 3300005459 | Bacteria | 2716 |
| 37 | Ga0068867_101039417 | 3300005459 | Bacteria | 745 |
| 38 | Ga0070706_100604309 | 3300005467 | Bacteria | 1019 |
| 39 | Ga0070707_101124116 | 3300005468 | Bacteria | 752 |
| 40 | Ga0070699_100555511 | 3300005518 | Bacteria | 1045 |
| 41 | Ga0070697_100438221 | 3300005536 | Bacteria | 1137 |
| 42 | Ga0070672_100161745 | 3300005543 | Bacteria | 1858 |
| 43 | Ga0070672_100741090 | 3300005543 | Bacteria | 862 |
| 44 | Ga0070695_100101112 | 3300005545 | Bacteria | 1942 |
| 45 | Ga0070695_100111230 | 3300005545 | Bacteria | 1859 |
| 46 | Ga0070696_100010827 | 3300005546 | Bacteria | 6113 |
| 47 | Ga0070696_100136619 | 3300005546 | Bacteria | 1788 |
| 48 | Ga0070696_100153651 | 3300005546 | Bacteria | 1691 |
| 49 | Ga0070704_100057260 | 3300005549 | Bacteria | 2770 |
| 50 | Ga0070664_101128852 | 3300005564 | Bacteria | 739 |
| 51 | Ga0068857_100183669 | 3300005577 | Bacteria | 1903 |
| 52 | Ga0068854_100753275 | 3300005578 | Bacteria | 845 |
| 53 | Ga0068854_100961337 | 3300005578 | Bacteria | 754 |
| 54 | Ga0070702_100261219 | 3300005615 | Bacteria | 1179 |
| 55 | Ga0068852_100990842 | 3300005616 | Bacteria | 859 |
| 56 | Ga0068859_101941748 | 3300005617 | Bacteria | 650 |
| 57 | Ga0068859_102251892 | 3300005617 | Bacteria | 601 |
| 58 | Ga0068864_101307224 | 3300005618 | Bacteria | 725 |
| 59 | Ga0068866_10947696 | 3300005718 | Bacteria | 608 |
| 60 | Ga0068861_100066527 | 3300005719 | Bacteria | 2778 |
| 61 | Ga0068861_100462061 | 3300005719 | Bacteria | 1140 |
| 62 | Ga0068851_10392083 | 3300005834 | Bacteria | 815 |
| 63 | Ga0068863_100027700 | 3300005841 | Bacteria | 5407 |
| 64 | Ga0068862_100074381 | 3300005844 | Bacteria | 2936 |
| 65 | Ga0068862_100224835 | 3300005844 | Unclassified | 1701 |
| 66 | Ga0068862_100294676 | 3300005844 | Unclassified | 1491 |
| 67 | Ga0081455_10519577 | 3300005937 | Bacteria | 795 |
| 68 | Ga0075365_10022888 | 3300006038 | Bacteria | 3922 |
| 69 | Ga0070716_100387620 | 3300006173 | Bacteria | 1001 |
| 70 | Ga0070712_100263866 | 3300006175 | Bacteria | 1381 |
| 71 | Ga0075428_100180251 | 3300006844 | Bacteria | 2287 |
| 72 | Ga0075428_100250980 | 3300006844 | Bacteria | 1907 |
| 73 | Ga0075428_101186073 | 3300006844 | Bacteria | 805 |
| 74 | Ga0075430_100092088 | 3300006846 | Bacteria | 2535 |
| 75 | Ga0075430_100617518 | 3300006846 | Bacteria | 894 |
| 76 | Ga0075431_100014288 | 3300006847 | Bacteria | 8029 |
| 77 | Ga0075431_100019119 | 3300006847 | Bacteria | 6980 |
| 78 | Ga0075433_10321980 | 3300006852 | Bacteria | 1368 |
| 79 | Ga0075434_101099513 | 3300006871 | Bacteria | 808 |
| 80 | Ga0075429_100237690 | 3300006880 | Bacteria | 1596 |
| 81 | Ga0068865_100881452 | 3300006881 | Unclassified | 777 |
| 82 | Ga0075436_100330028 | 3300006914 | Unclassified | 1097 |
| 83 | Ga0097620_101941482 | 3300006931 | Bacteria | 650 |
| 84 | Ga0097620_102252194 | 3300006931 | Bacteria | 601 |
| 85 | Ga0105240_11584389 | 3300009093 | Bacteria | 685 |
| 86 | Ga0105240_11790001 | 3300009093 | Bacteria | 640 |
| 87 | Ga0105247_10207941 | 3300009101 | Bacteria | 1319 |
| 88 | Ga0105247_10488599 | 3300009101 | Bacteria | 895 |
| 89 | Ga0114129_10034146 | 3300009147 | Bacteria | 7184 |
| 90 | Ga0114129_10340583 | 3300009147 | Bacteria | 1989 |
| 91 | Ga0114129_10695133 | 3300009147 | Bacteria | 1308 |
| 92 | Ga0105243_10038987 | 3300009148 | Bacteria | 3702 |
| 93 | Ga0105242_10393428 | 3300009176 | Unclassified | 1291 |
| 94 | Ga0105248_10302581 | 3300009177 | Bacteria | 1801 |
| 95 | Ga0105248_11043408 | 3300009177 | Bacteria | 924 |
| 96 | Ga0105237_10463697 | 3300009545 | Bacteria | 1273 |
| 97 | Ga0105249_10053144 | 3300009553 | Bacteria | 3702 |
| 98 | Ga0105249_10155501 | 3300009553 | Bacteria | 2205 |
| 99 | Ga0105249_11203713 | 3300009553 | Bacteria | 829 |
| 100 | Ga0105249_13097914 | 3300009553 | Bacteria | 534 |
| 101 | Ga0099796_10203077 | 3300010159 | Bacteria | 805 |
| 102 | Ga0105239_10055999 | 3300010375 | Bacteria | 4326 |
| 103 | Ga0157369_10691602 | 3300013105 | Bacteria | 1050 |
| 104 | Ga0157374_10029776 | 3300013296 | Bacteria | 4950 |
| 105 | Ga0157374_10282556 | 3300013296 | Bacteria | 1639 |
| 106 | Ga0157378_10618906 | 3300013297 | Bacteria | 1096 |
| 107 | Ga0157378_10866238 | 3300013297 | Bacteria | 932 |
| 108 | Ga0163162_10213947 | 3300013306 | Bacteria | 2057 |
| 109 | Ga0157372_10218036 | 3300013307 | Bacteria | 2212 |
| 110 | Ga0157372_10336371 | 3300013307 | Bacteria | 1759 |
| 111 | Ga0157375_10016149 | 3300013308 | Bacteria | 6697 |
| 112 | Ga0157375_11028546 | 3300013308 | Bacteria | 962 |
| 113 | Ga0157380_10238147 | 3300014326 | Bacteria | 1639 |
| 114 | Ga0157380_10479705 | 3300014326 | Bacteria | 1202 |
| 115 | Ga0182008_10186119 | 3300014497 | Bacteria | 1052 |
| 116 | Ga0157377_10084299 | 3300014745 | Bacteria | 1864 |
| 117 | Ga0157379_10166525 | 3300014968 | Bacteria | 1989 |
| 118 | Ga0157376_10199037 | 3300014969 | Bacteria | 1842 |
| 119 | Ga0157376_11420615 | 3300014969 | Bacteria | 726 |
| 120 | Ga0163161_10134464 | 3300017792 | Bacteria | 1868 |
| 121 | Ga0209565_1000035 | 3300025263 | Bacteria | 298125 |
| 122 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 123 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 124 | Ga0209564_1000083 | 3300025295 | Bacteria | 259272 |
| 125 | Ga0209256_1000322 | 3300025299 | Bacteria | 82681 |
| 126 | Ga0207697_10037092 | 3300025315 | Bacteria | 1996 |
| 127 | Ga0207656_10119046 | 3300025321 | Bacteria | 1228 |
| 128 | Ga0207642_10011046 | 3300025899 | Bacteria | 3207 |
| 129 | Ga0207688_10407304 | 3300025901 | Bacteria | 844 |
| 130 | Ga0207645_10441728 | 3300025907 | Bacteria | 878 |
| 131 | Ga0207684_11433697 | 3300025910 | Bacteria | 564 |
| 132 | Ga0207695_11297532 | 3300025913 | Bacteria | 608 |
| 133 | Ga0207693_10207618 | 3300025915 | Bacteria | 1540 |
| 134 | Ga0207693_10274893 | 3300025915 | Bacteria | 1320 |
| 135 | Ga0207663_10286579 | 3300025916 | Bacteria | 1225 |
| 136 | Ga0207660_11613862 | 3300025917 | Unclassified | 523 |
| 137 | Ga0207649_10390850 | 3300025920 | Bacteria | 1039 |
| 138 | Ga0207681_10016579 | 3300025923 | Bacteria | 4610 |
| 139 | Ga0207664_10176375 | 3300025929 | Bacteria | 1833 |
| 140 | Ga0207644_10444797 | 3300025931 | Bacteria | 1064 |
| 141 | Ga0207690_10213905 | 3300025932 | Bacteria | 1471 |
| 142 | Ga0207706_10016876 | 3300025933 | Bacteria | 6587 |
| 143 | Ga0207706_10026655 | 3300025933 | Bacteria | 5173 |
| 144 | Ga0207709_10186988 | 3300025935 | Bacteria | 1468 |
| 145 | Ga0207669_10008720 | 3300025937 | Bacteria | 4779 |
| 146 | Ga0207704_11217316 | 3300025938 | Unclassified | 642 |
| 147 | Ga0207665_10050867 | 3300025939 | Bacteria | 2788 |
| 148 | Ga0207691_10015591 | 3300025940 | Bacteria | 7226 |
| 149 | Ga0207689_10019682 | 3300025942 | Bacteria | 5688 |
| 150 | Ga0207679_10115512 | 3300025945 | Bacteria | 2126 |
| 151 | Ga0207651_10041522 | 3300025960 | Bacteria | 3054 |
| 152 | Ga0207651_10550820 | 3300025960 | Bacteria | 1003 |
| 153 | Ga0207712_10347479 | 3300025961 | Bacteria | 1232 |
| 154 | Ga0207712_10537527 | 3300025961 | Bacteria | 1004 |
| 155 | Ga0207668_10812016 | 3300025972 | Bacteria | 828 |
| 156 | Ga0207640_10896478 | 3300025981 | Bacteria | 774 |
| 157 | Ga0207708_10148150 | 3300026075 | Unclassified | 1846 |
| 158 | Ga0207708_10740592 | 3300026075 | Bacteria | 843 |
| 159 | Ga0207641_10084337 | 3300026088 | Bacteria | 2766 |
| 160 | Ga0207648_10021883 | 3300026089 | Bacteria | 5745 |
| 161 | Ga0207648_10057258 | 3300026089 | Bacteria | 3400 |
| 162 | Ga0207648_10563432 | 3300026089 | Bacteria | 1047 |
| 163 | Ga0207648_10590091 | 3300026089 | Bacteria | 1023 |
| 164 | Ga0207676_11604206 | 3300026095 | Bacteria | 648 |
| 165 | Ga0207674_10200583 | 3300026116 | Bacteria | 1944 |
| 166 | Ga0207675_100015994 | 3300026118 | Bacteria | 7003 |
| 167 | Ga0207675_100131167 | 3300026118 | Bacteria | 2377 |
| 168 | Ga0207675_100713672 | 3300026118 | Bacteria | 1012 |
| 169 | Ga0207683_10018453 | 3300026121 | Bacteria | 5954 |
| 170 | Ga0207683_11383995 | 3300026121 | Bacteria | 651 |
| 171 | Ga0209981_1002847 | 3300027378 | Bacteria | 2219 |
| 172 | Ga0209999_1001609 | 3300027543 | Bacteria | 3890 |
| 173 | Ga0209588_1052657 | 3300027671 | Bacteria | 1317 |
| 174 | Ga0209966_1007145 | 3300027695 | Bacteria | 1951 |
| 175 | Ga0209974_10037866 | 3300027876 | Bacteria | 1602 |
| 176 | Ga0268266_11547866 | 3300028379 | Bacteria | 639 |
| 177 | Ga0268265_11729597 | 3300028380 | Unclassified | 631 |
| 178 | Ga0307409_102372165 | 3300031995 | Bacteria | 560 |
| 179 | Ga0316593_10006132 | 3300032168 | Bacteria | 3227 |
| 180 | Ga0373939_0344810 | 3300035114 | Bacteria | 605 |
| 181 | Ga0373939_0401452 | 3300035114 | Bacteria | 568 |
| 182 | Ga0395905_0012339 | 3300037471 | Bacteria | 8225 |
| 183 | Ga0436363_1485667 | 3300039450 | Bacteria | 641 |
| 184 | Ga0439435_0003355 | 3300042436 | Bacteria | 3322 |
| 185 | Ga0439460_0000680 | 3300042461 | Bacteria | 7513 |
| 186 | Ga0450916_015907 | 3300042530 | Bacteria | 993 |
| 187 | Ga0451577_0006567 | 3300042876 | Bacteria | 11565 |
| 188 | Ga0453683_0327132 | 3300044673 | Bacteria | 983 |
| 189 | Ga0451576_0007158 | 3300045051 | Bacteria | 13450 |
| 190 | Ga0451576_0977976 | 3300045051 | Bacteria | 887 |
| 191 | Ga0451576_1044447 | 3300045051 | Bacteria | 856 |
| 192 | Ga0451576_1090883 | 3300045051 | Archaea | 835 |
| 193 | Ga0451576_1188304 | 3300045051 | Bacteria | 797 |
| 194 | Ga0495628_0014078 | 3300046516 | Bacteria | 6713 |
| 195 | Ga0495642_0043776 | 3300046528 | Bacteria | 1826 |
| 196 | Ga0495652_0010201 | 3300046529 | Bacteria | 8517 |
| 197 | Ga0495645_0013238 | 3300046543 | Bacteria | 5830 |
| 198 | Ga0495659_0210013 | 3300046664 | Bacteria | 801 |
| 199 | Ga0495669_0022806 | 3300046684 | Bacteria | 2721 |
| 200 | Ga0495636_0569722 | 3300047318 | Bacteria | 552 |
| 201 | Ga0495675_0224877 | 3300047444 | Bacteria | 1134 |
| 202 | Ga0495602_0745810 | 3300048088 | Bacteria | 661 |
| 203 | Ga0496100_0084540 | 3300048903 | Bacteria | 2151 |
| 204 | Ga0496100_0185538 | 3300048903 | Bacteria | 1507 |
| 205 | Ga0496101_0348529 | 3300048904 | Bacteria | 1163 |
| 206 | Ga0496102_0113819 | 3300048905 | Bacteria | 2524 |
| 207 | Ga0496102_0187766 | 3300048905 | Bacteria | 1948 |
| 208 | Ga0496103_0057400 | 3300048906 | Bacteria | 2417 |
| 209 | Ga0496103_0374699 | 3300048906 | Bacteria | 915 |
| 210 | Ga0496104_0052139 | 3300048907 | Bacteria | 3863 |
| 211 | Ga0496105_0181265 | 3300048908 | Unclassified | 1725 |
| 212 | Ga0496105_0403026 | 3300048908 | Bacteria | 1085 |
| 213 | Ga0496106_0017516 | 3300048909 | Bacteria | 5301 |
| 214 | Ga0496106_0190365 | 3300048909 | Bacteria | 1631 |
| 215 | Ga0496107_0053844 | 3300048910 | Bacteria | 2902 |
| 216 | Ga0496108_0157662 | 3300048911 | Bacteria | 1960 |
| 217 | Ga0496109_0022427 | 3300048912 | Bacteria | 5591 |
| 218 | Ga0496110_0123871 | 3300048913 | Bacteria | 2331 |
| 219 | Ga0496110_1170046 | 3300048913 | Bacteria | 678 |
| 220 | Ga0496112_0326464 | 3300048915 | Bacteria | 1478 |
| 221 | Ga0496112_0892128 | 3300048915 | Bacteria | 811 |
| 222 | Ga0496113_0009187 | 3300048916 | Bacteria | 6483 |
| 223 | Ga0496114_0217606 | 3300048917 | Bacteria | 1676 |
| 224 | Ga0496115_0061125 | 3300048918 | Bacteria | 3037 |
| 225 | Ga0501039_0124815 | 3300049575 | Bacteria | 2019 |
| 226 | Ga0501040_0022637 | 3300049576 | Bacteria | 4209 |
| 227 | Ga0501075_0823606 | 3300049591 | Bacteria | 706 |
| 228 | Ga0501081_0023479 | 3300049743 | Bacteria | 4134 |
| 229 | nmdc:mga0yw44_453114_c1 | 3300050492 | Bacteria | 869 |
| 230 | nmdc:mga0yw44_9006_c1 | 3300050492 | Bacteria | 5014 |
| 231 | nmdc:mga0k408_136863_c1 | 3300050493 | Bacteria | 1455 |
| 232 | nmdc:mga05p37_401852_c1 | 3300050507 | Bacteria | 1599 |
| 233 | nmdc:mga05p37_575626_c1 | 3300050507 | Bacteria | 1276 |
| 234 | nmdc:mga09592_316594_c1 | 3300050508 | Bacteria | 1352 |
| 235 | nmdc:mga0qj67_157132_c1 | 3300050509 | Bacteria | 1846 |
| 236 | nmdc:mga0qj67_273493_c1 | 3300050509 | Bacteria | 1369 |
| 237 | nmdc:mga0qj67_77527_c1 | 3300050509 | Bacteria | 2659 |
| 238 | nmdc:mga06r32_454698_c1 | 3300050510 | Bacteria | 1260 |
| 239 | nmdc:mga06r32_45923_c1 | 3300050510 | Bacteria | 4166 |
| 240 | nmdc:mga06r32_47217_c1 | 3300050510 | Bacteria | 4112 |
| 241 | nmdc:mga06r32_557635_c1 | 3300050510 | Bacteria | 1119 |
| 242 | nmdc:mga0rr50_263861_c1 | 3300050513 | Bacteria | 1433 |
| 243 | nmdc:mga0rr50_957679_c1 | 3300050513 | Bacteria | 729 |
| 244 | nmdc:mga08x19_302232_c1 | 3300050514 | Unclassified | 1111 |
| 245 | Ga0501084_1345702 | 3300054114 | Bacteria | 598 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005546 | Ga0070696_100153651 | Ga0070696_1001536513 | 140 |
| 2 | 3300050493 | nmdc:mga0k408_136863_c1 | nmdc:mga0k408_136863_c1_691_1158 | 143 |
| 3 | 3300027876 | Ga0209974_10037866 | Ga0209974_100378662 | 145 |
| 4 | 3300049743 | Ga0501081_0023479 | Ga0501081_0023479_95_535 | 145 |
| 5 | 3300050510 | nmdc:mga06r32_47217_c1 | nmdc:mga06r32_47217_c1_2565_3005 | 145 |
| 6 | 3300049575 | Ga0501039_0124815 | Ga0501039_0124815_919_1362 | 146 |
| 7 | 3300049576 | Ga0501040_0022637 | Ga0501040_0022637_2347_2790 | 146 |
| 8 | 3300049591 | Ga0501075_0823606 | Ga0501075_0823606_61_504 | 146 |
| 9 | 3300054114 | Ga0501084_1345702 | Ga0501084_1345702_125_568 | 146 |
| 10 | iso_pu_bacteria | 2513237351 | 2514592626 | 146 |
| 11 | iso_pu_bacteria | 2957443900 | 2957443928 | 146 |
| 12 | iso_pu_bacteria | 2960617483 | 2960622180 | 146 |
| 13 | iso_pu_bacteria | 2960660292 | 2960662752 | 146 |
| 14 | iso_pu_bacteria | 2977523885 | 2977524017 | 146 |
| 15 | iso_pu_bacteria | 2977523885 | 2977524076 | 146 |
| 16 | iso_pu_bacteria | 8001845381 | 8001846428 | 146 |
| 17 | 3300005329 | Ga0070683_100208443 | Ga0070683_1002084432 | 147 |
| 18 | 3300013307 | Ga0157372_10336371 | Ga0157372_103363712 | 147 |
| 19 | 3300026121 | Ga0207683_11383995 | Ga0207683_113839951 | 147 |
| 20 | 3300005437 | Ga0070710_10972669 | Ga0070710_109726691 | 148 |
| 21 | 3300005439 | Ga0070711_100100485 | Ga0070711_1001004853 | 148 |
| 22 | 3300005459 | Ga0068867_100064826 | Ga0068867_1000648264 | 148 |
| 23 | 3300005617 | Ga0068859_102251892 | Ga0068859_1022518921 | 148 |
| 24 | 3300005719 | Ga0068861_100462061 | Ga0068861_1004620612 | 148 |
| 25 | 3300005844 | Ga0068862_100224835 | Ga0068862_1002248354 | 148 |
| 26 | 3300006871 | Ga0075434_101099513 | Ga0075434_1010995132 | 148 |
| 27 | 3300006881 | Ga0068865_100881452 | Ga0068865_1008814522 | 148 |
| 28 | 3300006931 | Ga0097620_102252194 | Ga0097620_1022521942 | 148 |
| 29 | 3300009147 | Ga0114129_10034146 | Ga0114129_100341464 | 148 |
| 30 | 3300009147 | Ga0114129_10695133 | Ga0114129_106951333 | 148 |
| 31 | 3300009148 | Ga0105243_10038987 | Ga0105243_100389872 | 148 |
| 32 | 3300009176 | Ga0105242_10393428 | Ga0105242_103934281 | 148 |
| 33 | 3300009553 | Ga0105249_13097914 | Ga0105249_130979141 | 148 |
| 34 | 3300010159 | Ga0099796_10203077 | Ga0099796_102030771 | 148 |
| 35 | 3300025263 | Ga0209565_1000035 | Ga0209565_1000035269 | 148 |
| 36 | 3300025273 | Ga0209673_1000006 | Ga0209673_1000006359 | 148 |
| 37 | 3300025291 | Ga0209675_1000005 | Ga0209675_1000005413 | 148 |
| 38 | 3300025295 | Ga0209564_1000083 | Ga0209564_1000083223 | 148 |
| 39 | 3300025299 | Ga0209256_1000322 | Ga0209256_100032218 | 148 |
| 40 | 3300025899 | Ga0207642_10011046 | Ga0207642_100110464 | 148 |
| 41 | 3300025915 | Ga0207693_10207618 | Ga0207693_102076182 | 148 |
| 42 | 3300025917 | Ga0207660_11613862 | Ga0207660_116138621 | 148 |
| 43 | 3300025935 | Ga0207709_10186988 | Ga0207709_101869882 | 148 |
| 44 | 3300025937 | Ga0207669_10008720 | Ga0207669_100087207 | 148 |
| 45 | 3300025938 | Ga0207704_11217316 | Ga0207704_112173161 | 148 |
| 46 | 3300025961 | Ga0207712_10537527 | Ga0207712_105375271 | 148 |
| 47 | 3300026075 | Ga0207708_10148150 | Ga0207708_101481503 | 148 |
| 48 | 3300026089 | Ga0207648_10057258 | Ga0207648_100572584 | 148 |
| 49 | 3300026118 | Ga0207675_100131167 | Ga0207675_1001311674 | 148 |
| 50 | 3300027378 | Ga0209981_1002847 | Ga0209981_10028473 | 148 |
| 51 | 3300027543 | Ga0209999_1001609 | Ga0209999_10016094 | 148 |
| 52 | 3300027671 | Ga0209588_1052657 | Ga0209588_10526572 | 148 |
| 53 | 3300027695 | Ga0209966_1007145 | Ga0209966_10071453 | 148 |
| 54 | 3300028380 | Ga0268265_11729597 | Ga0268265_117295971 | 148 |
| 55 | 3300042436 | Ga0439435_0003355 | Ga0439435_0003355_1142_1591 | 148 |
| 56 | 3300042461 | Ga0439460_0000680 | Ga0439460_0000680_6602_7051 | 148 |
| 57 | 3300045051 | Ga0451576_0977976 | Ga0451576_0977976_108_566 | 148 |
| 58 | 3300046528 | Ga0495642_0043776 | Ga0495642_0043776_132_590 | 148 |
| 59 | 3300046664 | Ga0495659_0210013 | Ga0495659_0210013_327_776 | 148 |
| 60 | 3300046684 | Ga0495669_0022806 | Ga0495669_0022806_1003_1452 | 148 |
| 61 | 3300047318 | Ga0495636_0569722 | Ga0495636_0569722_68_514 | 148 |
| 62 | 3300048913 | Ga0496110_1170046 | Ga0496110_1170046_10_459 | 148 |
| 63 | 3300050507 | nmdc:mga05p37_575626_c1 | nmdc:mga05p37_575626_c1_244_711 | 148 |
| 64 | 3300050509 | nmdc:mga0qj67_77527_c1 | nmdc:mga0qj67_77527_c1_829_1281 | 148 |
| 65 | 3300050510 | nmdc:mga06r32_557635_c1 | nmdc:mga06r32_557635_c1_105_557 | 148 |
| 66 | 3300005334 | Ga0068869_100045208 | Ga0068869_1000452082 | 149 |
| 67 | 3300005338 | Ga0068868_100012757 | Ga0068868_1000127576 | 149 |
| 68 | 3300005347 | Ga0070668_100012949 | Ga0070668_1000129492 | 149 |
| 69 | 3300005353 | Ga0070669_100115551 | Ga0070669_1001155512 | 149 |
| 70 | 3300005354 | Ga0070675_100016831 | Ga0070675_1000168315 | 149 |
| 71 | 3300005356 | Ga0070674_100038205 | Ga0070674_1000382053 | 149 |
| 72 | 3300005364 | Ga0070673_100046812 | Ga0070673_1000468124 | 149 |
| 73 | 3300005441 | Ga0070700_100597326 | Ga0070700_1005973262 | 149 |
| 74 | 3300005456 | Ga0070678_100009293 | Ga0070678_1000092932 | 149 |
| 75 | 3300005457 | Ga0070662_100018655 | Ga0070662_1000186552 | 149 |
| 76 | 3300005467 | Ga0070706_100604309 | Ga0070706_1006043091 | 149 |
| 77 | 3300005543 | Ga0070672_100161745 | Ga0070672_1001617453 | 149 |
| 78 | 3300005577 | Ga0068857_100183669 | Ga0068857_1001836692 | 149 |
| 79 | 3300005578 | Ga0068854_100753275 | Ga0068854_1007532752 | 149 |
| 80 | 3300005718 | Ga0068866_10947696 | Ga0068866_109476962 | 149 |
| 81 | 3300005719 | Ga0068861_100066527 | Ga0068861_1000665274 | 149 |
| 82 | 3300005834 | Ga0068851_10392083 | Ga0068851_103920832 | 149 |
| 83 | 3300005841 | Ga0068863_100027700 | Ga0068863_1000277002 | 149 |
| 84 | 3300005844 | Ga0068862_100074381 | Ga0068862_1000743813 | 149 |
| 85 | 3300005937 | Ga0081455_10519577 | Ga0081455_105195771 | 149 |
| 86 | 3300006844 | Ga0075428_101186073 | Ga0075428_1011860731 | 149 |
| 87 | 3300006847 | Ga0075431_100014288 | Ga0075431_1000142882 | 149 |
| 88 | 3300006852 | Ga0075433_10321980 | Ga0075433_103219802 | 149 |
| 89 | 3300006880 | Ga0075429_100237690 | Ga0075429_1002376902 | 149 |
| 90 | 3300006914 | Ga0075436_100330028 | Ga0075436_1003300282 | 149 |
| 91 | 3300009553 | Ga0105249_10155501 | Ga0105249_101555013 | 149 |
| 92 | 3300009553 | Ga0105249_11203713 | Ga0105249_112037131 | 149 |
| 93 | 3300013296 | Ga0157374_10029776 | Ga0157374_100297762 | 149 |
| 94 | 3300013308 | Ga0157375_10016149 | Ga0157375_100161492 | 149 |
| 95 | 3300014326 | Ga0157380_10238147 | Ga0157380_102381472 | 149 |
| 96 | 3300025321 | Ga0207656_10119046 | Ga0207656_101190463 | 149 |
| 97 | 3300025910 | Ga0207684_11433697 | Ga0207684_114336971 | 149 |
| 98 | 3300025923 | Ga0207681_10016579 | Ga0207681_100165796 | 149 |
| 99 | 3300025933 | Ga0207706_10026655 | Ga0207706_100266555 | 149 |
| 100 | 3300025940 | Ga0207691_10015591 | Ga0207691_100155917 | 149 |
| 101 | 3300025945 | Ga0207679_10115512 | Ga0207679_101155122 | 149 |
| 102 | 3300025960 | Ga0207651_10041522 | Ga0207651_100415222 | 149 |
| 103 | 3300025961 | Ga0207712_10347479 | Ga0207712_103474793 | 149 |
| 104 | 3300025981 | Ga0207640_10896478 | Ga0207640_108964782 | 149 |
| 105 | 3300026075 | Ga0207708_10740592 | Ga0207708_107405921 | 149 |
| 106 | 3300026088 | Ga0207641_10084337 | Ga0207641_100843373 | 149 |
| 107 | 3300026089 | Ga0207648_10021883 | Ga0207648_100218831 | 149 |
| 108 | 3300026116 | Ga0207674_10200583 | Ga0207674_102005832 | 149 |
| 109 | 3300026118 | Ga0207675_100015994 | Ga0207675_1000159942 | 149 |
| 110 | 3300026121 | Ga0207683_10018453 | Ga0207683_100184532 | 149 |
| 111 | 3300035114 | Ga0373939_0401452 | Ga0373939_0401452_28_495 | 149 |
| 112 | 3300039450 | Ga0436363_1485667 | Ga0436363_1485667_100_549 | 149 |
| 113 | 3300042876 | Ga0451577_0006567 | Ga0451577_0006567_1336_1785 | 149 |
| 114 | 3300044673 | Ga0453683_0327132 | Ga0453683_0327132_476_925 | 149 |
| 115 | 3300045051 | Ga0451576_0007158 | Ga0451576_0007158_2570_3019 | 149 |
| 116 | 3300045051 | Ga0451576_1044447 | Ga0451576_1044447_266_733 | 149 |
| 117 | 3300045051 | Ga0451576_1090883 | Ga0451576_1090883_358_822 | 149 |
| 118 | 3300045051 | Ga0451576_1188304 | Ga0451576_1188304_228_695 | 149 |
| 119 | 3300046516 | Ga0495628_0014078 | Ga0495628_0014078_2794_3246 | 149 |
| 120 | 3300046529 | Ga0495652_0010201 | Ga0495652_0010201_2955_3407 | 149 |
| 121 | 3300046543 | Ga0495645_0013238 | Ga0495645_0013238_2751_3203 | 149 |
| 122 | 3300047444 | Ga0495675_0224877 | Ga0495675_0224877_304_756 | 149 |
| 123 | 3300048088 | Ga0495602_0745810 | Ga0495602_0745810_65_517 | 149 |
| 124 | 3300050492 | nmdc:mga0yw44_453114_c1 | nmdc:mga0yw44_453114_c1_80_532 | 149 |
| 125 | 3300050507 | nmdc:mga05p37_401852_c1 | nmdc:mga05p37_401852_c1_497_952 | 149 |
| 126 | 3300050508 | nmdc:mga09592_316594_c1 | nmdc:mga09592_316594_c1_243_698 | 149 |
| 127 | 3300050510 | nmdc:mga06r32_454698_c1 | nmdc:mga06r32_454698_c1_41_496 | 149 |
| 128 | 3300050514 | nmdc:mga08x19_302232_c1 | nmdc:mga08x19_302232_c1_170_637 | 149 |
| 129 | 3300003771 | Ga0055526_1001153 | Ga0055526_100115316 | 150 |
| 130 | 3300003773 | Ga0055537_1000078 | Ga0055537_100007843 | 150 |
| 131 | 3300003775 | Ga0055524_1011245 | Ga0055524_10112455 | 150 |
| 132 | 3300003784 | Ga0055534_1000105 | Ga0055534_100010514 | 150 |
| 133 | 3300003784 | Ga0055534_1000342 | Ga0055534_100034215 | 150 |
| 134 | 3300003790 | Ga0055528_1000690 | Ga0055528_100069010 | 150 |
| 135 | 3300005293 | Ga0065715_10041679 | Ga0065715_100416792 | 150 |
| 136 | 3300005328 | Ga0070676_10373780 | Ga0070676_103737801 | 150 |
| 137 | 3300005334 | Ga0068869_100017813 | Ga0068869_1000178132 | 150 |
| 138 | 3300005344 | Ga0070661_100423133 | Ga0070661_1004231331 | 150 |
| 139 | 3300005347 | Ga0070668_100428354 | Ga0070668_1004283541 | 150 |
| 140 | 3300005355 | Ga0070671_100292447 | Ga0070671_1002924472 | 150 |
| 141 | 3300005364 | Ga0070673_100487121 | Ga0070673_1004871212 | 150 |
| 142 | 3300005365 | Ga0070688_100256126 | Ga0070688_1002561262 | 150 |
| 143 | 3300005366 | Ga0070659_100144792 | Ga0070659_1001447921 | 150 |
| 144 | 3300005367 | Ga0070667_100271170 | Ga0070667_1002711701 | 150 |
| 145 | 3300005435 | Ga0070714_100162145 | Ga0070714_1001621452 | 150 |
| 146 | 3300005436 | Ga0070713_100118184 | Ga0070713_1001181842 | 150 |
| 147 | 3300005439 | Ga0070711_100137906 | Ga0070711_1001379062 | 150 |
| 148 | 3300005445 | Ga0070708_100297366 | Ga0070708_1002973662 | 150 |
| 149 | 3300005455 | Ga0070663_100054608 | Ga0070663_1000546083 | 150 |
| 150 | 3300005457 | Ga0070662_100027258 | Ga0070662_1000272582 | 150 |
| 151 | 3300005459 | Ga0068867_101039417 | Ga0068867_1010394171 | 150 |
| 152 | 3300005468 | Ga0070707_101124116 | Ga0070707_1011241162 | 150 |
| 153 | 3300005518 | Ga0070699_100555511 | Ga0070699_1005555112 | 150 |
| 154 | 3300005536 | Ga0070697_100438221 | Ga0070697_1004382211 | 150 |
| 155 | 3300005543 | Ga0070672_100741090 | Ga0070672_1007410902 | 150 |
| 156 | 3300005545 | Ga0070695_100101112 | Ga0070695_1001011123 | 150 |
| 157 | 3300005545 | Ga0070695_100111230 | Ga0070695_1001112304 | 150 |
| 158 | 3300005546 | Ga0070696_100010827 | Ga0070696_1000108275 | 150 |
| 159 | 3300005546 | Ga0070696_100136619 | Ga0070696_1001366191 | 150 |
| 160 | 3300005549 | Ga0070704_100057260 | Ga0070704_1000572602 | 150 |
| 161 | 3300005564 | Ga0070664_101128852 | Ga0070664_1011288521 | 150 |
| 162 | 3300005578 | Ga0068854_100961337 | Ga0068854_1009613372 | 150 |
| 163 | 3300005615 | Ga0070702_100261219 | Ga0070702_1002612192 | 150 |
| 164 | 3300005616 | Ga0068852_100990842 | Ga0068852_1009908422 | 150 |
| 165 | 3300005617 | Ga0068859_101941748 | Ga0068859_1019417481 | 150 |
| 166 | 3300005618 | Ga0068864_101307224 | Ga0068864_1013072241 | 150 |
| 167 | 3300005844 | Ga0068862_100294676 | Ga0068862_1002946762 | 150 |
| 168 | 3300006038 | Ga0075365_10022888 | Ga0075365_100228883 | 150 |
| 169 | 3300006173 | Ga0070716_100387620 | Ga0070716_1003876202 | 150 |
| 170 | 3300006175 | Ga0070712_100263866 | Ga0070712_1002638662 | 150 |
| 171 | 3300006844 | Ga0075428_100180251 | Ga0075428_1001802514 | 150 |
| 172 | 3300006844 | Ga0075428_100250980 | Ga0075428_1002509801 | 150 |
| 173 | 3300006846 | Ga0075430_100092088 | Ga0075430_1000920883 | 150 |
| 174 | 3300006846 | Ga0075430_100617518 | Ga0075430_1006175181 | 150 |
| 175 | 3300006847 | Ga0075431_100019119 | Ga0075431_1000191193 | 150 |
| 176 | 3300006931 | Ga0097620_101941482 | Ga0097620_1019414821 | 150 |
| 177 | 3300009093 | Ga0105240_11584389 | Ga0105240_115843892 | 150 |
| 178 | 3300009093 | Ga0105240_11790001 | Ga0105240_117900011 | 150 |
| 179 | 3300009101 | Ga0105247_10207941 | Ga0105247_102079413 | 150 |
| 180 | 3300009101 | Ga0105247_10488599 | Ga0105247_104885991 | 150 |
| 181 | 3300009147 | Ga0114129_10340583 | Ga0114129_103405833 | 150 |
| 182 | 3300009177 | Ga0105248_10302581 | Ga0105248_103025812 | 150 |
| 183 | 3300009177 | Ga0105248_11043408 | Ga0105248_110434081 | 150 |
| 184 | 3300009545 | Ga0105237_10463697 | Ga0105237_104636972 | 150 |
| 185 | 3300009553 | Ga0105249_10053144 | Ga0105249_100531447 | 150 |
| 186 | 3300010375 | Ga0105239_10055999 | Ga0105239_100559992 | 150 |
| 187 | 3300013105 | Ga0157369_10691602 | Ga0157369_106916021 | 150 |
| 188 | 3300013296 | Ga0157374_10282556 | Ga0157374_102825562 | 150 |
| 189 | 3300013297 | Ga0157378_10618906 | Ga0157378_106189061 | 150 |
| 190 | 3300013297 | Ga0157378_10866238 | Ga0157378_108662382 | 150 |
| 191 | 3300013306 | Ga0163162_10213947 | Ga0163162_102139472 | 150 |
| 192 | 3300013307 | Ga0157372_10218036 | Ga0157372_102180362 | 150 |
| 193 | 3300013308 | Ga0157375_11028546 | Ga0157375_110285461 | 150 |
| 194 | 3300014326 | Ga0157380_10479705 | Ga0157380_104797051 | 150 |
| 195 | 3300014497 | Ga0182008_10186119 | Ga0182008_101861192 | 150 |
| 196 | 3300014745 | Ga0157377_10084299 | Ga0157377_100842991 | 150 |
| 197 | 3300014968 | Ga0157379_10166525 | Ga0157379_101665252 | 150 |
| 198 | 3300014969 | Ga0157376_10199037 | Ga0157376_101990373 | 150 |
| 199 | 3300014969 | Ga0157376_11420615 | Ga0157376_114206151 | 150 |
| 200 | 3300017792 | Ga0163161_10134464 | Ga0163161_101344642 | 150 |
| 201 | 3300025315 | Ga0207697_10037092 | Ga0207697_100370922 | 150 |
| 202 | 3300025901 | Ga0207688_10407304 | Ga0207688_104073041 | 150 |
| 203 | 3300025907 | Ga0207645_10441728 | Ga0207645_104417281 | 150 |
| 204 | 3300025913 | Ga0207695_11297532 | Ga0207695_112975321 | 150 |
| 205 | 3300025915 | Ga0207693_10274893 | Ga0207693_102748931 | 150 |
| 206 | 3300025916 | Ga0207663_10286579 | Ga0207663_102865792 | 150 |
| 207 | 3300025920 | Ga0207649_10390850 | Ga0207649_103908501 | 150 |
| 208 | 3300025929 | Ga0207664_10176375 | Ga0207664_101763752 | 150 |
| 209 | 3300025931 | Ga0207644_10444797 | Ga0207644_104447971 | 150 |
| 210 | 3300025932 | Ga0207690_10213905 | Ga0207690_102139051 | 150 |
| 211 | 3300025933 | Ga0207706_10016876 | Ga0207706_100168762 | 150 |
| 212 | 3300025939 | Ga0207665_10050867 | Ga0207665_100508672 | 150 |
| 213 | 3300025942 | Ga0207689_10019682 | Ga0207689_100196822 | 150 |
| 214 | 3300025960 | Ga0207651_10550820 | Ga0207651_105508202 | 150 |
| 215 | 3300025972 | Ga0207668_10812016 | Ga0207668_108120161 | 150 |
| 216 | 3300026089 | Ga0207648_10563432 | Ga0207648_105634322 | 150 |
| 217 | 3300026089 | Ga0207648_10590091 | Ga0207648_105900912 | 150 |
| 218 | 3300026095 | Ga0207676_11604206 | Ga0207676_116042061 | 150 |
| 219 | 3300026118 | Ga0207675_100713672 | Ga0207675_1007136721 | 150 |
| 220 | 3300028379 | Ga0268266_11547866 | Ga0268266_115478661 | 150 |
| 221 | 3300031995 | Ga0307409_102372165 | Ga0307409_1023721651 | 150 |
| 222 | 3300032168 | Ga0316593_10006132 | Ga0316593_100061322 | 150 |
| 223 | 3300035114 | Ga0373939_0344810 | Ga0373939_0344810_123_584 | 150 |
| 224 | 3300037471 | Ga0395905_0012339 | Ga0395905_0012339_547_999 | 150 |
| 225 | 3300042530 | Ga0450916_015907 | Ga0450916_015907_406_876 | 150 |
| 226 | 3300048903 | Ga0496100_0084540 | Ga0496100_0084540_931_1392 | 150 |
| 227 | 3300048903 | Ga0496100_0185538 | Ga0496100_0185538_733_1221 | 150 |
| 228 | 3300048904 | Ga0496101_0348529 | Ga0496101_0348529_573_1034 | 150 |
| 229 | 3300048905 | Ga0496102_0113819 | Ga0496102_0113819_1681_2142 | 150 |
| 230 | 3300048905 | Ga0496102_0187766 | Ga0496102_0187766_291_749 | 150 |
| 231 | 3300048906 | Ga0496103_0057400 | Ga0496103_0057400_1142_1603 | 150 |
| 232 | 3300048906 | Ga0496103_0374699 | Ga0496103_0374699_109_642 | 150 |
| 233 | 3300048907 | Ga0496104_0052139 | Ga0496104_0052139_3373_3834 | 150 |
| 234 | 3300048908 | Ga0496105_0181265 | Ga0496105_0181265_1080_1541 | 150 |
| 235 | 3300048908 | Ga0496105_0403026 | Ga0496105_0403026_429_887 | 150 |
| 236 | 3300048909 | Ga0496106_0017516 | Ga0496106_0017516_1495_1956 | 150 |
| 237 | 3300048909 | Ga0496106_0190365 | Ga0496106_0190365_599_1132 | 150 |
| 238 | 3300048910 | Ga0496107_0053844 | Ga0496107_0053844_843_1304 | 150 |
| 239 | 3300048911 | Ga0496108_0157662 | Ga0496108_0157662_1031_1492 | 150 |
| 240 | 3300048912 | Ga0496109_0022427 | Ga0496109_0022427_771_1232 | 150 |
| 241 | 3300048913 | Ga0496110_0123871 | Ga0496110_0123871_529_990 | 150 |
| 242 | 3300048915 | Ga0496112_0326464 | Ga0496112_0326464_988_1449 | 150 |
| 243 | 3300048915 | Ga0496112_0892128 | Ga0496112_0892128_326_784 | 150 |
| 244 | 3300048916 | Ga0496113_0009187 | Ga0496113_0009187_4396_4857 | 150 |
| 245 | 3300048917 | Ga0496114_0217606 | Ga0496114_0217606_974_1435 | 150 |
| 246 | 3300048918 | Ga0496115_0061125 | Ga0496115_0061125_940_1401 | 150 |
| 247 | 3300050492 | nmdc:mga0yw44_9006_c1 | nmdc:mga0yw44_9006_c1_3357_3830 | 150 |
| 248 | 3300050509 | nmdc:mga0qj67_157132_c1 | nmdc:mga0qj67_157132_c1_1375_1830 | 150 |
| 249 | 3300050509 | nmdc:mga0qj67_273493_c1 | nmdc:mga0qj67_273493_c1_536_988 | 150 |
| 250 | 3300050510 | nmdc:mga06r32_45923_c1 | nmdc:mga06r32_45923_c1_2326_2781 | 150 |
| 251 | 3300050513 | nmdc:mga0rr50_263861_c1 | nmdc:mga0rr50_263861_c1_38_523 | 150 |
| 252 | 3300050513 | nmdc:mga0rr50_957679_c1 | nmdc:mga0rr50_957679_c1_218_679 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3exz-assembly1.cif.gz_A | crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. | 0.9724 | 4 | 147 |
| 3exz-assembly1.cif.gz_A | crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. | 0.9465 | 4 | 147 |
| 8hgn-assembly1.cif.gz_A | crystal structure of meac (mesaconyl-coa hydratase) | 0.8844 | 4 | 149 |
| 4e3e-assembly1.cif.gz_A | crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl | 0.8808 | 4 | 148 |
| 4ffu-assembly2.cif.gz_K | crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 | 0.8784 | 2 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3exzC00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9689 | 4 | 147 | 3.10.129.10 |
| 3exzC00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9622 | 4 | 147 | 3.10.129.10 |
| af_I6Y9H2_24_180_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9082 | 2 | 148 | 3.10.129.10 |
| 4ffuI00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8918 | 2 | 149 | 3.10.129.10 |
| af_I6Y9H2_24_180_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8854 | 2 | 148 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537BWS2-F1-model_v4 | MaoC family dehydratase | 0.9968 | 1 | 147 |
|
| AF-A0A534TDR8-F1-model_v4 | MaoC family dehydratase | 0.9947 | 3 | 147 |
|
| AF-A0A6N1AUX9-F1-model_v4 | MaoC family dehydratase | 0.9943 | 3 | 147 |
|
| AF-A0A536UPD6-F1-model_v4 | MaoC family dehydratase | 0.9937 | 3 | 150 |
|
| AF-H3NXZ1-F1-model_v4 | Acyl dehydratase | 0.9935 | 2 | 150 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar