F362813

General Info

Members Datasets Scaffolds Average Seq Length
251 157 502 379

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_001958|Ga0500645_001958_7748_8959
Length 403
Sequence MSPPLNVMISCGEASGDLYAGALARDLRALDPGVTLFGFGGERLADAGAELIDDYRHHHVTGLAEVIAQLPRTYALYRRLVSAARARRPDVLVLIDFPDFNFRLGGALRRLGVPVVYYISPQLWAWRSGRLKTMKQFVDLVLPIFPFEEQLYRDAGIPVEFVGHPLVDLARPTQDRAAFLTSVGLKPHAPTVALLPGSRPNELREILPDLVSAARLVATQVPDVQFLLARAPHLSDELLAPAIDAARDESANGGTPRAGASLGPPLRLAMIEGRADDVLASADVVITASGTATVQTALHGKPMVIVYRLSNLTYRLGRRFVKIDTFGMVNLIAGHRIVPELIQDDFSPQSTCHEVVRLLRDEPHRARMIADVEEVRRKLGGTGASGRAAAAVLRLARDRAMVS

Samples

Sample ID Description Type Environment
1 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
105 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
106 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
107 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
108 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
109 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
110 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
111 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
112 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
113 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
114 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
119 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
120 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 1.99
Rhizosphere 96.41
Stem 0
Stem Tuber 0
Unclassified 18.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500645_001958 3300053730 Bacteria 9728
2 Ga0065707_10113822 3300005295 Bacteria 2315
3 Ga0070676_10000992 3300005328 Bacteria 14101
4 Ga0070690_100023548 3300005330 Bacteria 3777
5 Ga0070690_100044412 3300005330 Bacteria 2820
6 Ga0070690_100079524 3300005330 Bacteria 2144
7 Ga0070670_100102230 3300005331 Unclassified 2468
8 Ga0070670_100168033 3300005331 Unclassified 1902
9 Ga0070666_10070967 3300005335 Bacteria 2370
10 Ga0068868_100025981 3300005338 Unclassified 4459
11 Ga0070689_100088097 3300005340 Unclassified 2443
12 Ga0070691_10000545 3300005341 Bacteria 14270
13 Ga0070687_100016584 3300005343 Unclassified 3365
14 Ga0070668_100029823 3300005347 Bacteria 4144
15 Ga0070669_100007332 3300005353 Bacteria 7910
16 Ga0070669_100008625 3300005353 Bacteria 7273
17 Ga0070669_100055972 3300005353 Bacteria 2891
18 Ga0070675_100005964 3300005354 Bacteria 9333
19 Ga0070675_100032269 3300005354 Bacteria 4237
20 Ga0070675_100288866 3300005354 Bacteria 1443
21 Ga0070671_100017205 3300005355 Bacteria 5852
22 Ga0070674_100001518 3300005356 Bacteria 12383
23 Ga0070673_100103156 3300005364 Bacteria 2353
24 Ga0070688_100030689 3300005365 Unclassified 3228
25 Ga0070667_100045743 3300005367 Unclassified 3681
26 Ga0070714_100015388 3300005435 Bacteria 6156
27 Ga0070713_100052301 3300005436 Bacteria 3382
28 Ga0070701_10003665 3300005438 Bacteria 6121
29 Ga0070705_100000840 3300005440 Bacteria 17215
30 Ga0070705_100178518 3300005440 Bacteria 1436
31 Ga0070694_100005528 3300005444 Bacteria 7652
32 Ga0070694_100015043 3300005444 Bacteria 4850
33 Ga0070708_100067543 3300005445 Unclassified 3211
34 Ga0070662_100113581 3300005457 Bacteria 2067
35 Ga0070662_100186227 3300005457 Bacteria 1639
36 Ga0068867_100003539 3300005459 Bacteria 10978
37 Ga0068867_100021553 3300005459 Bacteria 4598
38 Ga0070707_100011437 3300005468 Bacteria 8277
39 Ga0070707_100117425 3300005468 Bacteria 2582
40 Ga0070698_100024778 3300005471 Bacteria 6255
41 Ga0070699_100008845 3300005518 Bacteria 8721
42 Ga0070697_100209808 3300005536 Bacteria 1658
43 Ga0070672_100022938 3300005543 Unclassified 4594
44 Ga0070686_100002808 3300005544 Bacteria 9591
45 Ga0070695_100003219 3300005545 Bacteria 9530
46 Ga0070695_100111822 3300005545 Bacteria 1855
47 Ga0070696_100003791 3300005546 Bacteria 10094
48 Ga0070665_100002524 3300005548 Bacteria 20109
49 Ga0070665_100007600 3300005548 Bacteria 11019
50 Ga0070665_100041392 3300005548 Bacteria 4631
51 Ga0070704_100000968 3300005549 Bacteria 14573
52 Ga0068854_100034781 3300005578 Bacteria 3522
53 Ga0068854_100065942 3300005578 Bacteria 2633
54 Ga0068854_100088453 3300005578 Unclassified 2300
55 Ga0070702_100001483 3300005615 Bacteria 9637
56 Ga0068859_100111236 3300005617 Bacteria 2801
57 Ga0068864_100002895 3300005618 Bacteria 14184
58 Ga0068866_10009143 3300005718 Bacteria 4200
59 Ga0068861_100007342 3300005719 Bacteria 7551
60 Ga0068861_100039105 3300005719 Bacteria 3539
61 Ga0068861_100098613 3300005719 Bacteria 2319
62 Ga0068870_10146507 3300005840 Bacteria 1387
63 Ga0068863_100040615 3300005841 Unclassified 4424
64 Ga0068858_100017548 3300005842 Bacteria 6712
65 Ga0068858_100026350 3300005842 Bacteria 5404
66 Ga0068858_100076093 3300005842 Bacteria 3118
67 Ga0068860_100205687 3300005843 Unclassified 1909
68 Ga0068860_100310885 3300005843 Bacteria 1545
69 Ga0068862_100013390 3300005844 Bacteria 6786
70 Ga0075367_10022414 3300006178 Bacteria 3542
71 Ga0097621_100003748 3300006237 Bacteria 10531
72 Ga0097621_100070164 3300006237 Bacteria 2893
73 Ga0097621_100075280 3300006237 Bacteria 2798
74 Ga0068871_100001260 3300006358 Bacteria 16929
75 Ga0068871_100035599 3300006358 Bacteria 3957
76 Ga0075428_100132244 3300006844 Unclassified 2713
77 Ga0075430_100226371 3300006846 Unclassified 1551
78 Ga0075431_100080000 3300006847 Unclassified 3374
79 Ga0075431_100142201 3300006847 Unclassified 2473
80 Ga0075431_100394003 3300006847 Unclassified 1387
81 Ga0075433_10049446 3300006852 Unclassified 3658
82 Ga0075433_10051791 3300006852 Unclassified 3576
83 Ga0075433_10137461 3300006852 Bacteria 2172
84 Ga0068865_100002511 3300006881 Bacteria 10856
85 Ga0068865_100091754 3300006881 Unclassified 2205
86 Ga0075436_100039274 3300006914 Bacteria 3267
87 Ga0075436_100072023 3300006914 Unclassified 2390
88 Ga0097620_100111234 3300006931 Bacteria 2801
89 Ga0075435_100000566 3300007076 Bacteria 22768
90 Ga0075435_100001491 3300007076 Bacteria 15047
91 Ga0075435_100028858 3300007076 Bacteria 4353
92 Ga0075435_100055360 3300007076 Bacteria 3203
93 Ga0105240_10095260 3300009093 Bacteria 3630
94 Ga0111539_10000210 3300009094 Bacteria 69456
95 Ga0111539_10003171 3300009094 Bacteria 21764
96 Ga0111539_10012026 3300009094 Bacteria 10854
97 Ga0111539_10016109 3300009094 Bacteria 9276
98 Ga0111539_10096123 3300009094 Bacteria 3479
99 Ga0105245_10061829 3300009098 Bacteria 3377
100 Ga0105245_10080363 3300009098 Bacteria 2978
101 Ga0105247_10004885 3300009101 Bacteria 8529
102 Ga0114129_10001005 3300009147 Bacteria 36721
103 Ga0114129_10003029 3300009147 Bacteria 23559
104 Ga0114129_10004438 3300009147 Bacteria 19798
105 Ga0114129_10067499 3300009147 Bacteria 4988
106 Ga0114129_10190993 3300009147 Unclassified 2781
107 Ga0114129_10751015 3300009147 Unclassified 1249
108 Ga0105243_10019451 3300009148 Bacteria 5149
109 Ga0105241_10072859 3300009174 Bacteria 2671
110 Ga0105242_10003149 3300009176 Bacteria 12880
111 Ga0105242_10010652 3300009176 Bacteria 7059
112 Ga0105242_10106574 3300009176 Bacteria 2382
113 Ga0105248_10016211 3300009177 Bacteria 8201
114 Ga0105248_10020352 3300009177 Bacteria 7351
115 Ga0105248_10063914 3300009177 Unclassified 4132
116 Ga0105248_10119502 3300009177 Bacteria 2972
117 Ga0105248_10138543 3300009177 Bacteria 2745
118 Ga0105248_10316347 3300009177 Bacteria 1758
119 Ga0105238_10037137 3300009551 Unclassified 4953
120 Ga0163162_10043493 3300013306 Bacteria 4498
121 Ga0163163_10085009 3300014325 Bacteria 3171
122 Ga0163163_10097837 3300014325 Bacteria 2955
123 Ga0157376_10027374 3300014969 Bacteria 4518
124 Ga0207645_10006458 3300025907 Bacteria 8412
125 Ga0207645_10052390 3300025907 Bacteria 2607
126 Ga0207646_10233355 3300025922 Bacteria 1662
127 Ga0207681_10089242 3300025923 Unclassified 2197
128 Ga0207681_10179320 3300025923 Bacteria 1612
129 Ga0207694_10149905 3300025924 Unclassified 1878
130 Ga0207650_10026682 3300025925 Unclassified 4124
131 Ga0207659_10002821 3300025926 Bacteria 10362
132 Ga0207659_10131296 3300025926 Bacteria 1934
133 Ga0207687_10002974 3300025927 Bacteria 11480
134 Ga0207664_10040222 3300025929 Bacteria 3634
135 Ga0207706_10028449 3300025933 Bacteria 4992
136 Ga0207706_10161344 3300025933 Bacteria 1970
137 Ga0207686_10008145 3300025934 Bacteria 5654
138 Ga0207686_10011002 3300025934 Bacteria 4939
139 Ga0207686_10173178 3300025934 Bacteria 1524
140 Ga0207709_10096273 3300025935 Bacteria 1947
141 Ga0207670_10153656 3300025936 Unclassified 1710
142 Ga0207670_10173885 3300025936 Bacteria 1617
143 Ga0207669_10067399 3300025937 Bacteria 2230
144 Ga0207704_10024175 3300025938 Bacteria 3290
145 Ga0207711_10069176 3300025941 Bacteria 3059
146 Ga0207711_10101142 3300025941 Unclassified 2550
147 Ga0207711_10217798 3300025941 Bacteria 1745
148 Ga0207712_10150062 3300025961 Bacteria 1800
149 Ga0207668_10244889 3300025972 Bacteria 1453
150 Ga0207640_10100523 3300025981 Bacteria 2026
151 Ga0207658_10075846 3300025986 Unclassified 2560
152 Ga0207677_10027083 3300026023 Bacteria 3605
153 Ga0207677_10029928 3300026023 Bacteria 3468
154 Ga0207703_10008288 3300026035 Bacteria 8210
155 Ga0207703_10234179 3300026035 Bacteria 1648
156 Ga0207708_10026540 3300026075 Bacteria 4385
157 Ga0207708_10146316 3300026075 Bacteria 1857
158 Ga0207708_10168584 3300026075 Bacteria 1733
159 Ga0207708_10286032 3300026075 Bacteria 1337
160 Ga0207641_10080462 3300026088 Archaea 2827
161 Ga0207648_10004028 3300026089 Bacteria 15257
162 Ga0207648_10012990 3300026089 Bacteria 7771
163 Ga0207676_10223211 3300026095 Bacteria 1679
164 Ga0207675_100014292 3300026118 Bacteria 7400
165 Ga0207675_100045319 3300026118 Bacteria 4109
166 Ga0207675_100071057 3300026118 Unclassified 3254
167 Ga0207675_100122106 3300026118 Bacteria 2465
168 Ga0207675_100168948 3300026118 Unclassified 2090
169 Ga0207428_10006989 3300027907 Bacteria 10337
170 Ga0207428_10009757 3300027907 Bacteria 8604
171 Ga0207428_10012393 3300027907 Bacteria 7491
172 Ga0207428_10023995 3300027907 Bacteria 5122
173 Ga0268266_10008740 3300028379 Bacteria 8976
174 Ga0268266_10014146 3300028379 Bacteria 6868
175 Ga0268265_10057913 3300028380 Bacteria 2955
176 Ga0268265_10124519 3300028380 Bacteria 2130
177 Ga0268264_10149497 3300028381 Bacteria 2092
178 Ga0268264_10259999 3300028381 Bacteria 1617
179 Ga0307408_100238656 3300031548 Bacteria 1493
180 Ga0307412_10186992 3300031911 Bacteria 1563
181 Ga0373948_0000383 3300034817 Bacteria 5431
182 Ga0373950_0010599 3300034818 Bacteria 1492
183 Ga0373958_0001496 3300034819 Bacteria 3146
184 Ga0373928_0001199 3300035084 Bacteria 5121
185 Ga0373929_0000822 3300035085 Bacteria 6054
186 Ga0373940_0019849 3300035088 Bacteria 1701
187 Ga0373949_0001348 3300035090 Bacteria 7066
188 Ga0373951_0000940 3300035091 Bacteria 7833
189 Ga0373952_0000236 3300035092 Bacteria 8947
190 Ga0373932_0000313 3300035112 Bacteria 14733
191 Ga0373939_0002776 3300035114 Bacteria 4104
192 Ga0373941_0001597 3300035115 Bacteria 4824
193 Ga0373960_0001123 3300035121 Bacteria 5781
194 Ga0373955_0016490 3300035172 Bacteria 3638
195 Ga0373942_0001670 3300035207 Bacteria 5637
196 Ga0373961_0001587 3300035241 Bacteria 6478
197 Ga0373962_0000507 3300035242 Bacteria 8680
198 Ga0373924_0061292 3300035410 Bacteria 1574
199 Ga0373931_0001456 3300035691 Bacteria 10175
200 Ga0373937_0035730 3300036401 Bacteria 4524
201 Ga0373937_0289396 3300036401 Bacteria 1548
202 Ga0373925_0213425 3300037068 Bacteria 1538
203 Ga0451577_0014930 3300042876 Bacteria 7233
204 Ga0451577_0023946 3300042876 Bacteria 5560
205 Ga0453684_0032561 3300044712 Bacteria 7292
206 Ga0451576_0035115 3300045051 Bacteria 5321
207 Ga0495638_0021340 3300046460 Bacteria 4271
208 Ga0495628_0140777 3300046516 Bacteria 1841
209 Ga0495645_0117778 3300046543 Bacteria 1873
210 Ga0495658_0028319 3300046683 Bacteria 3023
211 Ga0495658_0087686 3300046683 Unclassified 1838
212 Ga0495600_0061940 3300046809 Bacteria 2444
213 Ga0495674_0038623 3300047319 Bacteria 4284
214 Ga0496101_0002465 3300048904 Bacteria 11366
215 Ga0496105_0071528 3300048908 Bacteria 2866
216 Ga0496112_0141444 3300048915 Bacteria 2375
217 Ga0496112_0448629 3300048915 Unclassified 1228
218 Ga0496114_0000333 3300048917 Bacteria 34301
219 Ga0501034_0020313 3300049571 Bacteria 6782
220 Ga0501034_0277458 3300049571 Bacteria 1616
221 Ga0501043_0167221 3300049579 Unclassified 1717
222 Ga0501046_0200542 3300049580 Unclassified 1485
223 Ga0501047_0008650 3300049581 Bacteria 9617
224 Ga0501080_0203175 3300049742 Unclassified 1818
225 Ga0501044_0022598 3300049823 Bacteria 6702
226 nmdc:mga06z11_20584_c1 3300050494 Bacteria 3051
227 nmdc:mga05p37_1909_c1 3300050507 Bacteria 24257
228 nmdc:mga05p37_2204_c1 3300050507 Bacteria 22685
229 nmdc:mga05p37_60932_c1 3300050507 Bacteria 4646
230 nmdc:mga05p37_8476_c1 3300050507 Bacteria 12152
231 nmdc:mga05p37_88_c2 3300050507 Bacteria 72885
232 nmdc:mga09592_99925_c1 3300050508 Unclassified 2484
233 nmdc:mga0qj67_157895_c1 3300050509 Unclassified 1841
234 nmdc:mga06r32_96851_c1 3300050510 Unclassified 2890
235 nmdc:mga08y16_14665_c1 3300050511 Bacteria 8241
236 nmdc:mga08y16_161277_c1 3300050511 Unclassified 2330
237 nmdc:mga08y16_18185_c1 3300050511 Bacteria 7406
238 nmdc:mga08y16_1959_c1 3300050511 Bacteria 20984
239 nmdc:mga08y16_3450_c1 3300050511 Bacteria 16405
240 nmdc:mga0n895_20397_c1 3300050512 Bacteria 6181
241 nmdc:mga0n895_486400_c1 3300050512 Archaea 1244
242 nmdc:mga0n895_68322_c1 3300050512 Unclassified 3521
243 nmdc:mga0rr50_17756_c1 3300050513 Bacteria 4760
244 nmdc:mga08x19_12492_c1 3300050514 Bacteria 5119
245 nmdc:mga08x19_19942_c1 3300050514 Bacteria 4123
246 nmdc:mga0a205_139489_c1 3300050515 Unclassified 2325
247 nmdc:mga0a205_9880_c1 3300050515 Bacteria 8751
248 Ga0495595_0014817 3300053084 Bacteria 3315
249 Ga0495619_0037390 3300053085 Unclassified 3163
250 Ga0500616_0000100 3300053153 Bacteria 173477
251 Ga0501084_0172832 3300054114 Unclassified 1824
252 Ga0500645_001958
253 Ga0065707_10113822
254 Ga0070676_10000992
255 Ga0070690_100023548
256 Ga0070690_100044412
257 Ga0070690_100079524
258 Ga0070670_100102230
259 Ga0070670_100168033
260 Ga0070666_10070967
261 Ga0068868_100025981
262 Ga0070689_100088097
263 Ga0070691_10000545
264 Ga0070687_100016584
265 Ga0070668_100029823
266 Ga0070669_100007332
267 Ga0070669_100008625
268 Ga0070669_100055972
269 Ga0070675_100005964
270 Ga0070675_100032269
271 Ga0070675_100288866
272 Ga0070671_100017205
273 Ga0070674_100001518
274 Ga0070673_100103156
275 Ga0070688_100030689
276 Ga0070667_100045743
277 Ga0070714_100015388
278 Ga0070713_100052301
279 Ga0070701_10003665
280 Ga0070705_100000840
281 Ga0070705_100178518
282 Ga0070694_100005528
283 Ga0070694_100015043
284 Ga0070708_100067543
285 Ga0070662_100113581
286 Ga0070662_100186227
287 Ga0068867_100003539
288 Ga0068867_100021553
289 Ga0070707_100011437
290 Ga0070707_100117425
291 Ga0070698_100024778
292 Ga0070699_100008845
293 Ga0070697_100209808
294 Ga0070672_100022938
295 Ga0070686_100002808
296 Ga0070695_100003219
297 Ga0070695_100111822
298 Ga0070696_100003791
299 Ga0070665_100002524
300 Ga0070665_100007600
301 Ga0070665_100041392
302 Ga0070704_100000968
303 Ga0068854_100034781
304 Ga0068854_100065942
305 Ga0068854_100088453
306 Ga0070702_100001483
307 Ga0068859_100111236
308 Ga0068864_100002895
309 Ga0068866_10009143
310 Ga0068861_100007342
311 Ga0068861_100039105
312 Ga0068861_100098613
313 Ga0068870_10146507
314 Ga0068863_100040615
315 Ga0068858_100017548
316 Ga0068858_100026350
317 Ga0068858_100076093
318 Ga0068860_100205687
319 Ga0068860_100310885
320 Ga0068862_100013390
321 Ga0075367_10022414
322 Ga0097621_100003748
323 Ga0097621_100070164
324 Ga0097621_100075280
325 Ga0068871_100001260
326 Ga0068871_100035599
327 Ga0075428_100132244
328 Ga0075430_100226371
329 Ga0075431_100080000
330 Ga0075431_100142201
331 Ga0075431_100394003
332 Ga0075433_10049446
333 Ga0075433_10051791
334 Ga0075433_10137461
335 Ga0068865_100002511
336 Ga0068865_100091754
337 Ga0075436_100039274
338 Ga0075436_100072023
339 Ga0097620_100111234
340 Ga0075435_100000566
341 Ga0075435_100001491
342 Ga0075435_100028858
343 Ga0075435_100055360
344 Ga0105240_10095260
345 Ga0111539_10000210
346 Ga0111539_10003171
347 Ga0111539_10012026
348 Ga0111539_10016109
349 Ga0111539_10096123
350 Ga0105245_10061829
351 Ga0105245_10080363
352 Ga0105247_10004885
353 Ga0114129_10001005
354 Ga0114129_10003029
355 Ga0114129_10004438
356 Ga0114129_10067499
357 Ga0114129_10190993
358 Ga0114129_10751015
359 Ga0105243_10019451
360 Ga0105241_10072859
361 Ga0105242_10003149
362 Ga0105242_10010652
363 Ga0105242_10106574
364 Ga0105248_10016211
365 Ga0105248_10020352
366 Ga0105248_10063914
367 Ga0105248_10119502
368 Ga0105248_10138543
369 Ga0105248_10316347
370 Ga0105238_10037137
371 Ga0163162_10043493
372 Ga0163163_10085009
373 Ga0163163_10097837
374 Ga0157376_10027374
375 Ga0207645_10006458
376 Ga0207645_10052390
377 Ga0207646_10233355
378 Ga0207681_10089242
379 Ga0207681_10179320
380 Ga0207694_10149905
381 Ga0207650_10026682
382 Ga0207659_10002821
383 Ga0207659_10131296
384 Ga0207687_10002974
385 Ga0207664_10040222
386 Ga0207706_10028449
387 Ga0207706_10161344
388 Ga0207686_10008145
389 Ga0207686_10011002
390 Ga0207686_10173178
391 Ga0207709_10096273
392 Ga0207670_10153656
393 Ga0207670_10173885
394 Ga0207669_10067399
395 Ga0207704_10024175
396 Ga0207711_10069176
397 Ga0207711_10101142
398 Ga0207711_10217798
399 Ga0207712_10150062
400 Ga0207668_10244889
401 Ga0207640_10100523
402 Ga0207658_10075846
403 Ga0207677_10027083
404 Ga0207677_10029928
405 Ga0207703_10008288
406 Ga0207703_10234179
407 Ga0207708_10026540
408 Ga0207708_10146316
409 Ga0207708_10168584
410 Ga0207708_10286032
411 Ga0207641_10080462
412 Ga0207648_10004028
413 Ga0207648_10012990
414 Ga0207676_10223211
415 Ga0207675_100014292
416 Ga0207675_100045319
417 Ga0207675_100071057
418 Ga0207675_100122106
419 Ga0207675_100168948
420 Ga0207428_10006989
421 Ga0207428_10009757
422 Ga0207428_10012393
423 Ga0207428_10023995
424 Ga0268266_10008740
425 Ga0268266_10014146
426 Ga0268265_10057913
427 Ga0268265_10124519
428 Ga0268264_10149497
429 Ga0268264_10259999
430 Ga0307408_100238656
431 Ga0307412_10186992
432 Ga0373948_0000383
433 Ga0373950_0010599
434 Ga0373958_0001496
435 Ga0373928_0001199
436 Ga0373929_0000822
437 Ga0373940_0019849
438 Ga0373949_0001348
439 Ga0373951_0000940
440 Ga0373952_0000236
441 Ga0373932_0000313
442 Ga0373939_0002776
443 Ga0373941_0001597
444 Ga0373960_0001123
445 Ga0373955_0016490
446 Ga0373942_0001670
447 Ga0373961_0001587
448 Ga0373962_0000507
449 Ga0373924_0061292
450 Ga0373931_0001456
451 Ga0373937_0035730
452 Ga0373937_0289396
453 Ga0373925_0213425
454 Ga0451577_0014930
455 Ga0451577_0023946
456 Ga0453684_0032561
457 Ga0451576_0035115
458 Ga0495638_0021340
459 Ga0495628_0140777
460 Ga0495645_0117778
461 Ga0495658_0028319
462 Ga0495658_0087686
463 Ga0495600_0061940
464 Ga0495674_0038623
465 Ga0496101_0002465
466 Ga0496105_0071528
467 Ga0496112_0141444
468 Ga0496112_0448629
469 Ga0496114_0000333
470 Ga0501034_0020313
471 Ga0501034_0277458
472 Ga0501043_0167221
473 Ga0501046_0200542
474 Ga0501047_0008650
475 Ga0501080_0203175
476 Ga0501044_0022598
477 nmdc:mga06z11_20584_c1
478 nmdc:mga05p37_1909_c1
479 nmdc:mga05p37_2204_c1
480 nmdc:mga05p37_60932_c1
481 nmdc:mga05p37_8476_c1
482 nmdc:mga05p37_88_c2
483 nmdc:mga09592_99925_c1
484 nmdc:mga0qj67_157895_c1
485 nmdc:mga06r32_96851_c1
486 nmdc:mga08y16_14665_c1
487 nmdc:mga08y16_161277_c1
488 nmdc:mga08y16_18185_c1
489 nmdc:mga08y16_1959_c1
490 nmdc:mga08y16_3450_c1
491 nmdc:mga0n895_20397_c1
492 nmdc:mga0n895_486400_c1
493 nmdc:mga0n895_68322_c1
494 nmdc:mga0rr50_17756_c1
495 nmdc:mga08x19_12492_c1
496 nmdc:mga08x19_19942_c1
497 nmdc:mga0a205_139489_c1
498 nmdc:mga0a205_9880_c1
499 Ga0495595_0014817
500 Ga0495619_0037390
501 Ga0500616_0000100
502 Ga0501084_0172832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02684

LpxB

Lipid-A-disaccharide synthetase

7

394

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vz6-assembly1.cif.gz_B the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp-glucose 0.7768 2 370
7vz6-assembly1.cif.gz_C-2 the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp-glucose 0.7754 2 370
7vz6-assembly1.cif.gz_D-2 the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp-glucose 0.7671 2 370
7vz6-assembly1.cif.gz_E the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp-glucose 0.7541 2 370
7vza-assembly1.cif.gz_E-2 the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp 0.7538 2 370
ID Description Score Start End Superfamily
af_F4IF99_42_436_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8754 2 358 3.40.50.2000
af_P10441_9_377_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8742 2 368 3.40.50.2000
af_P10441_9_377_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8655 2 368 3.40.50.2000
af_F4IF99_42_436_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8277 2 358 3.40.50.2000
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7762 169 354 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2E8E2A4-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9844 1 373 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-A0A843SN74-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9836 2 373 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-A0A382A3Q3-F1-model_v4 lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9765 2 235 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-A0A7C5V415-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9726 1 143 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-A0A2E8E2A4-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.969 1 373 GO:0005543
GO:0008915
GO:0009245
GO:0016020

Map