F362729

General Info

Members Datasets Scaffolds Average Seq Length
251 198 247 313

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0437788|Ga0496115_0437788_22_1038
Length 338
Sequence MSERNDLSEPTHRRQPGEEVSMSSIPLIDVAPLLDGSPKEAQAVADTLGRACREVGFFYITGHGVPASLMAKVFEDSAALFSAPAPLRDAASFSGASGNRGYIRLGGERLDPGKPADVKEAFNIGLELAPDDPELLARAPFRSANLWPDLPGFRDTMLDYFNRVWRLGCDLHRGFALDLGLDRDFFETSLDKPIATLRLLHYPPVAGPLPEGQLGAGEHTDYGNVTLLATDAVGGLMVRDRSGRWLDAPVVPGAFVCNIGDCLMRWSNDVYVSTPHKVVSPPNKDRYSVAFFLDPNPDAMVACLPTCVTPDRPAKYAPITGADFLRSRLEPTYAAKAS

Samples

Sample ID Description Type Environment
1 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
2 2842733646 Variovorax sp. R-72446 Isolate Unclassified
3 2842747753 Variovorax sp. R-72060 Isolate Unclassified
4 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
179 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
180 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
181 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
182 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
183 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
184 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
185 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
188 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
189 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
190 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
191 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
192 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
193 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
194 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
195 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
196 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
197 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.33
Nodule 0
Rhizoplane 1.99
Rhizosphere 70.12
Stem 0
Stem Tuber 0
Unclassified 9.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000246 3300003187 Bacteria 63372
2 JGI25160J50197_1007541 3300003354 Bacteria 4245
3 Ga0070683_100045353 3300005329 Bacteria 4057
4 Ga0070690_100001865 3300005330 Bacteria 11172
5 Ga0070677_10090090 3300005333 Bacteria 1332
6 Ga0068869_100000820 3300005334 Bacteria 17751
7 Ga0068868_100001028 3300005338 Bacteria 19079
8 Ga0070668_100125033 3300005347 Bacteria 2059
9 Ga0070669_100008188 3300005353 Bacteria 7466
10 Ga0070669_100078139 3300005353 Bacteria 2459
11 Ga0070669_100323342 3300005353 Bacteria 1246
12 Ga0070675_100000329 3300005354 Bacteria 32086
13 Ga0070675_100191467 3300005354 Bacteria 1772
14 Ga0070675_100356487 3300005354 Bacteria 1298
15 Ga0070671_100012205 3300005355 Bacteria 6913
16 Ga0070673_100002015 3300005364 Bacteria 12259
17 Ga0070673_100168640 3300005364 Bacteria 1867
18 Ga0070667_100010392 3300005367 Bacteria 7684
19 Ga0070713_100000849 3300005436 Bacteria 19595
20 Ga0070713_100222278 3300005436 Bacteria 1713
21 Ga0070713_100231418 3300005436 Bacteria 1680
22 Ga0070678_100001048 3300005456 Bacteria 14462
23 Ga0070662_100136230 3300005457 Bacteria 1899
24 Ga0068867_100010539 3300005459 Bacteria 6522
25 Ga0068867_100062379 3300005459 Bacteria 2769
26 Ga0068867_100500006 3300005459 Bacteria 1045
27 Ga0070685_10124860 3300005466 Bacteria 1602
28 Ga0070698_100218068 3300005471 Bacteria 1842
29 Ga0070665_100030290 3300005548 Bacteria 5446
30 Ga0070665_100351497 3300005548 Bacteria 1479
31 Ga0068856_100289713 3300005614 Bacteria 1654
32 Ga0068859_100004139 3300005617 Bacteria 14808
33 Ga0068864_100000318 3300005618 Bacteria 42460
34 Ga0068866_10191986 3300005718 Bacteria 1214
35 Ga0068851_10025057 3300005834 Bacteria 2924
36 Ga0068863_100000507 3300005841 Bacteria 39658
37 Ga0068858_100000539 3300005842 Bacteria 39368
38 Ga0068860_100559256 3300005843 Bacteria 1147
39 Ga0081455_10015320 3300005937 Bacteria 7455
40 Ga0081539_10002576 3300005985 Bacteria 25031
41 Ga0070717_10000144 3300006028 Bacteria 53223
42 Ga0075365_10165471 3300006038 Bacteria 1543
43 Ga0070712_100075653 3300006175 Bacteria 2422
44 Ga0075367_10069273 3300006178 Bacteria 2118
45 Ga0075367_10182277 3300006178 Bacteria 1309
46 Ga0075369_10002262 3300006186 Bacteria 6836
47 Ga0097621_100011127 3300006237 Bacteria 6619
48 Ga0075370_10147794 3300006353 Bacteria 1376
49 Ga0068871_100000830 3300006358 Bacteria 20684
50 Ga0075428_100111221 3300006844 Bacteria 2985
51 Ga0068865_100334179 3300006881 Bacteria 1223
52 Ga0097620_100004139 3300006931 Bacteria 14808
53 Ga0105240_10289529 3300009093 Bacteria 1878
54 Ga0111539_10133958 3300009094 Bacteria 2901
55 Ga0105248_10000901 3300009177 Bacteria 33234
56 Ga0105248_10051633 3300009177 Bacteria 4613
57 Ga0105237_10299948 3300009545 Bacteria 1610
58 Ga0105238_10061641 3300009551 Bacteria 3752
59 Ga0105249_10170733 3300009553 Bacteria 2108
60 Ga0105249_10395806 3300009553 Bacteria 1411
61 Ga0099796_10029374 3300010159 Bacteria 1774
62 Ga0099796_10056784 3300010159 Bacteria 1375
63 Ga0157370_10267137 3300013104 Bacteria 1581
64 Ga0157374_10068605 3300013296 Bacteria 3337
65 Ga0163162_10000204 3300013306 Bacteria 54853
66 Ga0163162_10048945 3300013306 Bacteria 4236
67 Ga0163162_10614549 3300013306 Bacteria 1212
68 Ga0157372_10645209 3300013307 Bacteria 1233
69 Ga0157375_10001119 3300013308 Bacteria 23247
70 Ga0157375_10524719 3300013308 Bacteria 1347
71 Ga0163163_10004109 3300014325 Bacteria 12412
72 Ga0157380_10035562 3300014326 Bacteria 3849
73 Ga0182008_10000075 3300014497 Bacteria 77531
74 Ga0182008_10169088 3300014497 Bacteria 1103
75 Ga0157379_10002672 3300014968 Bacteria 15018
76 Ga0157376_10015114 3300014969 Bacteria 5819
77 Ga0163161_10030953 3300017792 Bacteria 3810
78 Ga0213872_10000628 3300021361 Bacteria 26697
79 Ga0213872_10004930 3300021361 Bacteria 6944
80 Ga0213872_10078283 3300021361 Bacteria 1486
81 Ga0213876_10013803 3300021384 Bacteria 4281
82 Ga0213875_10023210 3300021388 Bacteria 2963
83 Ga0209130_1000486 3300025284 Bacteria 40838
84 Ga0209025_1000265 3300025294 Bacteria 123182
85 Ga0209758_1001772 3300025297 Bacteria 23932
86 Ga0207426_1000088 3300025302 Bacteria 287526
87 Ga0207656_10050238 3300025321 Bacteria 1800
88 Ga0207680_10000693 3300025903 Bacteria 15837
89 Ga0207681_10003434 3300025923 Bacteria 9893
90 Ga0207681_10045711 3300025923 Bacteria 2942
91 Ga0207681_10087760 3300025923 Bacteria 2214
92 Ga0207694_10080252 3300025924 Bacteria 2560
93 Ga0207659_10019662 3300025926 Bacteria 4449
94 Ga0207659_10189877 3300025926 Bacteria 1634
95 Ga0207700_10001272 3300025928 Bacteria 14386
96 Ga0207704_10019326 3300025938 Bacteria 3575
97 Ga0207711_10001117 3300025941 Bacteria 25666
98 Ga0207689_10006926 3300025942 Bacteria 9971
99 Ga0207661_10078303 3300025944 Bacteria 2721
100 Ga0207651_10000144 3300025960 Bacteria 31275
101 Ga0207712_10138803 3300025961 Bacteria 1862
102 Ga0207712_10225076 3300025961 Bacteria 1502
103 Ga0207658_10001163 3300025986 Bacteria 21016
104 Ga0207703_10000702 3300026035 Bacteria 33148
105 Ga0207639_10400227 3300026041 Bacteria 1237
106 Ga0207641_10000926 3300026088 Bacteria 30280
107 Ga0207648_10014469 3300026089 Bacteria 7289
108 Ga0207648_10034969 3300026089 Bacteria 4430
109 Ga0207676_10000656 3300026095 Bacteria 27723
110 Ga0207675_100068117 3300026118 Bacteria 3327
111 Ga0207683_10010852 3300026121 Bacteria 7770
112 Ga0268265_10200934 3300028380 Bacteria 1729
113 Ga0268264_10242732 3300028381 Bacteria 1669
114 Ga0265338_10020688 3300028800 Bacteria 6905
115 Ga0265332_10049326 3300031238 Bacteria 1810
116 Ga0265320_10107204 3300031240 Bacteria 1282
117 Ga0265325_10002809 3300031241 Bacteria 11619
118 Ga0265340_10002182 3300031247 Bacteria 11203
119 Ga0265340_10037849 3300031247 Bacteria 2388
120 Ga0265339_10003653 3300031249 Bacteria 10734
121 Ga0265331_10033779 3300031250 Bacteria 2528
122 Ga0265327_10002083 3300031251 Bacteria 22333
123 Ga0265316_10021514 3300031344 Bacteria 5460
124 Ga0265316_10025053 3300031344 Unclassified 4984
125 Ga0307509_10086712 3300031507 Bacteria 3218
126 Ga0265313_10000356 3300031595 Bacteria 49871
127 Ga0307514_10146957 3300031649 Bacteria 1591
128 Ga0265314_10186285 3300031711 Unclassified 1239
129 Ga0265342_10017565 3300031712 Bacteria 4649
130 Ga0265342_10022723 3300031712 Bacteria 3983
131 Ga0307406_10047797 3300031901 Bacteria 2699
132 Ga0307412_10474348 3300031911 Bacteria 1036
133 Ga0307510_10011814 3300033180 Bacteria 10360
134 Ga0307510_10049980 3300033180 Bacteria 4441
135 Ga0307510_10091918 3300033180 Bacteria 2874
136 Ga0373954_0014139 3300035118 Bacteria 3557
137 Ga0373946_0043448 3300035171 Bacteria 1852
138 Ga0373955_0006204 3300035172 Bacteria 5438
139 Ga0373933_0066920 3300035724 Bacteria 2178
140 Ga0373937_0108706 3300036401 Bacteria 2578
141 Ga0395898_0069266 3300037466 Bacteria 3413
142 Ga0395905_0149543 3300037471 Bacteria 2197
143 Ga0436364_1339039 3300037853 Bacteria 11649
144 Ga0395901_0082018 3300038443 Bacteria 3369
145 Ga0395901_0293557 3300038443 Bacteria 1686
146 Ga0400483_233501 3300039062 Bacteria 2577
147 Ga0436365_0518064 3300039437 Bacteria 3675
148 Ga0436365_0884021 3300039437 Bacteria 3240
149 Ga0436360_0501157 3300039438 Bacteria 1609
150 Ga0436360_1072262 3300039438 Bacteria 1234
151 Ga0436361_0093690 3300039447 Bacteria 10354
152 Ga0436361_0919771 3300039447 Bacteria 3669
153 Ga0436363_0508743 3300039450 Bacteria 1379
154 Ga0436363_1077398 3300039450 Bacteria 1809
155 Ga0436363_1306036 3300039450 Bacteria 1431
156 Ga0450911_000124 3300042115 Bacteria 30673
157 Ga0466966_0043212 3300044684 Bacteria 2890
158 Ga0466966_0064476 3300044684 Bacteria 2306
159 Ga0466961_0049625 3300044693 Bacteria 2682
160 Ga0466971_0040267 3300044719 Bacteria 2099
161 Ga0466970_0076026 3300044765 Bacteria 1809
162 Ga0466957_0025089 3300044842 Bacteria 3532
163 Ga0466959_0066435 3300045049 Bacteria 2616
164 Ga0495592_0003692 3300046454 Bacteria 11038
165 Ga0495592_0170051 3300046454 Bacteria 1493
166 Ga0495629_0035842 3300046459 Bacteria 3505
167 Ga0495653_0123189 3300046463 Bacteria 1844
168 Ga0495650_0003635 3300046471 Bacteria 11087
169 Ga0495608_0016044 3300046511 Bacteria 5183
170 Ga0495608_0276028 3300046511 Bacteria 1044
171 Ga0495618_0055397 3300046514 Bacteria 2510
172 Ga0495620_0091465 3300046515 Bacteria 1220
173 Ga0495648_0018990 3300046524 Bacteria 4849
174 Ga0495587_0090239 3300046536 Bacteria 1770
175 Ga0495645_0116334 3300046543 Bacteria 1887
176 Ga0495667_0034502 3300046559 Bacteria 3383
177 Ga0495667_0045102 3300046559 Bacteria 2920
178 Ga0495635_0315505 3300046663 Bacteria 1047
179 Ga0495599_0024026 3300046678 Bacteria 3811
180 Ga0495623_0023524 3300046679 Bacteria 3976
181 Ga0495646_0057129 3300046680 Bacteria 2337
182 Ga0495600_0154341 3300046809 Bacteria 1485
183 Ga0495674_0101615 3300047319 Bacteria 2446
184 Ga0495672_0016953 3300047320 Bacteria 4882
185 Ga0495680_0029180 3300047322 Bacteria 4518
186 Ga0495675_0064158 3300047444 Bacteria 2323
187 Ga0495684_0018562 3300047471 Bacteria 5357
188 Ga0495602_0030317 3300048088 Bacteria 5132
189 Ga0496104_0037904 3300048907 Bacteria 4508
190 Ga0496104_0124112 3300048907 Bacteria 2479
191 Ga0496104_0481029 3300048907 Bacteria 1153
192 Ga0496105_0076313 3300048908 Bacteria 2767
193 Ga0496115_0437788 3300048918 Bacteria 1057
194 Ga0496121_0026865 3300048924 Bacteria 5406
195 Ga0496122_0000039 3300048925 Bacteria 295352
196 Ga0496123_0000026 3300048926 Bacteria 318040
197 Ga0496124_0011647 3300048927 Bacteria 8776
198 Ga0496125_0004511 3300048928 Bacteria 16008
199 Ga0496125_0006459 3300048928 Bacteria 12670
200 Ga0496126_0189630 3300048929 Bacteria 1742
201 Ga0501033_0127907 3300049570 Bacteria 1842
202 Ga0501067_0001395 3300049583 Bacteria 13094
203 Ga0501072_0019573 3300049588 Bacteria 5234
204 Ga0501083_0001788 3300049744 Bacteria 14702
205 Ga0501083_0026038 3300049744 Bacteria 4045
206 Ga0501083_0124578 3300049744 Bacteria 1689
207 nmdc:mga03683_472_c2 3300050489 Bacteria 11243
208 nmdc:mga0yw44_66450_c1 3300050492 Bacteria 2225
209 nmdc:mga0k408_126603_c1 3300050493 Bacteria 1515
210 nmdc:mga0k408_149290_c1 3300050493 Bacteria 1392
211 nmdc:mga0k408_44051_c1 3300050493 Bacteria 1220
212 nmdc:mga06z11_30591_c1 3300050494 Bacteria 2606
213 nmdc:mga07m45_2920_c1 3300050496 Bacteria 8107
214 nmdc:mga07m45_89746_c1 3300050496 Bacteria 1760
215 nmdc:mga08y16_96057_c1 3300050511 Bacteria 3086
216 nmdc:mga0sz30_946_c1 3300050516 Bacteria 10411
217 Ga0495601_0047363 3300053077 Bacteria 2706
218 Ga0495612_0058254 3300053078 Bacteria 1596
219 Ga0495619_0227219 3300053085 Bacteria 1293
220 Ga0500647_0117676 3300053091 Bacteria 1259
221 Ga0500651_0044103 3300053093 Bacteria 2809
222 Ga0500566_0000601 3300053094 Bacteria 20208
223 Ga0500640_001185 3300053095 Bacteria 7640
224 Ga0500572_002533 3300053111 Bacteria 4365
225 Ga0500594_0001955 3300053118 Bacteria 4460
226 Ga0500595_016588 3300053119 Bacteria 2739
227 Ga0500614_001061 3300053123 Bacteria 6833
228 Ga0500618_012028 3300053125 Bacteria 2277
229 Ga0500559_0002505 3300053136 Bacteria 9443
230 Ga0500559_0004350 3300053136 Bacteria 6748
231 Ga0500559_0014002 3300053136 Bacteria 3390
232 Ga0500568_0023205 3300053139 Bacteria 2641
233 Ga0500573_0016415 3300053140 Bacteria 4204
234 Ga0500590_046103 3300053148 Bacteria 2230
235 Ga0500603_000166 3300053150 Bacteria 16600
236 Ga0500622_0002189 3300053156 Bacteria 14442
237 Ga0500624_000100 3300053157 Bacteria 41296
238 Ga0500630_006610 3300053159 Bacteria 5683
239 Ga0500638_036943 3300053162 Bacteria 2369
240 Ga0500639_000166 3300053163 Bacteria 32001
241 Ga0500636_0033956 3300053177 Bacteria 3019
242 Ga0500636_0046894 3300053177 Bacteria 2547
243 Ga0500636_0173794 3300053177 Bacteria 1163
244 Ga0500596_000771 3300053735 Bacteria 6316
245 Ga0500587_002215 3300053739 Bacteria 2768
246 Ga0501084_0034250 3300054114 Bacteria 4247
247 Ga0501084_0178561 3300054114 Bacteria 1792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053085 Ga0495619_0227219 Ga0495619_0227219_116_1012 290
2 3300005333 Ga0070677_10090090 Ga0070677_100900902 291
3 3300005353 Ga0070669_100323342 Ga0070669_1003233421 291
4 3300005364 Ga0070673_100168640 Ga0070673_1001686403 291
5 3300005548 Ga0070665_100030290 Ga0070665_1000302902 291
6 3300025923 Ga0207681_10045711 Ga0207681_100457113 291
7 3300006175 Ga0070712_100075653 Ga0070712_1000756531 298
8 3300009553 Ga0105249_10170733 Ga0105249_101707333 299
9 iso_pu_bacteria 2842733646 2842737296 300
10 iso_pu_bacteria 2842747753 2842750508 300
11 3300031901 Ga0307406_10047797 Ga0307406_100477973 301
12 3300031911 Ga0307412_10474348 Ga0307412_104743481 301
13 3300037471 Ga0395905_0149543 Ga0395905_0149543_737_1669 301
14 3300042115 Ga0450911_000124 Ga0450911_000124_1073_1984 301
15 3300048924 Ga0496121_0026865 Ga0496121_0026865_1112_2023 301
16 3300048928 Ga0496125_0004511 Ga0496125_0004511_11150_12061 301
17 3300048928 Ga0496125_0006459 Ga0496125_0006459_10693_11604 301
18 3300006178 Ga0075367_10069273 Ga0075367_100692732 302
19 3300031251 Ga0265327_10002083 Ga0265327_1000208319 302
20 3300035171 Ga0373946_0043448 Ga0373946_0043448_23_943 302
21 3300039062 Ga0400483_233501 Ga0400483_233501_289_1200 302
22 3300039450 Ga0436363_1306036 Ga0436363_1306036_84_1049 302
23 3300048908 Ga0496105_0076313 Ga0496105_0076313_1650_2570 302
24 3300050493 nmdc:mga0k408_149290_c1 nmdc:mga0k408_149290_c1_16_981 302
25 3300050496 nmdc:mga07m45_2920_c1 nmdc:mga07m45_2920_c1_144_1109 302
26 3300053125 Ga0500618_012028 Ga0500618_012028_95_1033 302
27 3300053157 Ga0500624_000100 Ga0500624_000100_4095_5033 302
28 iso_pu_bacteria 2881101125 2881105001 302
29 3300005330 Ga0070690_100001865 Ga0070690_1000018652 303
30 3300005334 Ga0068869_100000820 Ga0068869_1000008203 303
31 3300005338 Ga0068868_100001028 Ga0068868_10000102816 303
32 3300005353 Ga0070669_100008188 Ga0070669_1000081885 303
33 3300005354 Ga0070675_100000329 Ga0070675_1000003292 303
34 3300005354 Ga0070675_100356487 Ga0070675_1003564871 303
35 3300005355 Ga0070671_100012205 Ga0070671_1000122052 303
36 3300005364 Ga0070673_100002015 Ga0070673_1000020157 303
37 3300005367 Ga0070667_100010392 Ga0070667_1000103929 303
38 3300005456 Ga0070678_100001048 Ga0070678_1000010482 303
39 3300005457 Ga0070662_100136230 Ga0070662_1001362303 303
40 3300005459 Ga0068867_100010539 Ga0068867_1000105397 303
41 3300005459 Ga0068867_100500006 Ga0068867_1005000061 303
42 3300005617 Ga0068859_100004139 Ga0068859_10000413915 303
43 3300005618 Ga0068864_100000318 Ga0068864_1000003187 303
44 3300005834 Ga0068851_10025057 Ga0068851_100250573 303
45 3300005841 Ga0068863_100000507 Ga0068863_1000005077 303
46 3300005842 Ga0068858_100000539 Ga0068858_1000005392 303
47 3300005843 Ga0068860_100559256 Ga0068860_1005592562 303
48 3300006237 Ga0097621_100011127 Ga0097621_1000111272 303
49 3300006358 Ga0068871_100000830 Ga0068871_10000083018 303
50 3300006931 Ga0097620_100004139 Ga0097620_10000413915 303
51 3300009177 Ga0105248_10000901 Ga0105248_1000090112 303
52 3300013104 Ga0157370_10267137 Ga0157370_102671371 303
53 3300013296 Ga0157374_10068605 Ga0157374_100686054 303
54 3300013306 Ga0163162_10000204 Ga0163162_1000020436 303
55 3300013308 Ga0157375_10001119 Ga0157375_100011198 303
56 3300014325 Ga0163163_10004109 Ga0163163_100041098 303
57 3300014497 Ga0182008_10000075 Ga0182008_1000007543 303
58 3300014497 Ga0182008_10169088 Ga0182008_101690881 303
59 3300014968 Ga0157379_10002672 Ga0157379_100026727 303
60 3300014969 Ga0157376_10015114 Ga0157376_100151148 303
61 3300017792 Ga0163161_10030953 Ga0163161_100309531 303
62 3300025321 Ga0207656_10050238 Ga0207656_100502382 303
63 3300025903 Ga0207680_10000693 Ga0207680_100006933 303
64 3300025923 Ga0207681_10003434 Ga0207681_100034347 303
65 3300025926 Ga0207659_10019662 Ga0207659_100196622 303
66 3300025941 Ga0207711_10001117 Ga0207711_1000111717 303
67 3300025942 Ga0207689_10006926 Ga0207689_100069265 303
68 3300025960 Ga0207651_10000144 Ga0207651_100001448 303
69 3300025986 Ga0207658_10001163 Ga0207658_1000116311 303
70 3300026035 Ga0207703_10000702 Ga0207703_1000070220 303
71 3300026088 Ga0207641_10000926 Ga0207641_1000092615 303
72 3300026089 Ga0207648_10034969 Ga0207648_100349692 303
73 3300026095 Ga0207676_10000656 Ga0207676_100006568 303
74 3300026121 Ga0207683_10010852 Ga0207683_100108524 303
75 3300028381 Ga0268264_10242732 Ga0268264_102427322 303
76 3300031649 Ga0307514_10146957 Ga0307514_101469572 303
77 3300033180 Ga0307510_10049980 Ga0307510_100499802 303
78 3300038443 Ga0395901_0082018 Ga0395901_0082018_2107_3039 303
79 3300046454 Ga0495592_0003692 Ga0495592_0003692_9165_10085 303
80 3300046515 Ga0495620_0091465 Ga0495620_0091465_124_1047 303
81 3300048925 Ga0496122_0000039 Ga0496122_0000039_286096_287010 303
82 3300048926 Ga0496123_0000026 Ga0496123_0000026_286192_287106 303
83 3300048927 Ga0496124_0011647 Ga0496124_0011647_5899_6822 303
84 3300053093 Ga0500651_0044103 Ga0500651_0044103_16_939 303
85 3300053118 Ga0500594_0001955 Ga0500594_0001955_665_1588 303
86 3300053136 Ga0500559_0002505 Ga0500559_0002505_6636_7559 303
87 3300053136 Ga0500559_0004350 Ga0500559_0004350_2894_3808 303
88 3300053140 Ga0500573_0016415 Ga0500573_0016415_707_1621 303
89 3300053156 Ga0500622_0002189 Ga0500622_0002189_1697_2620 303
90 3300053177 Ga0500636_0033956 Ga0500636_0033956_1598_2521 303
91 3300053739 Ga0500587_002215 Ga0500587_002215_1066_1989 303
92 3300005347 Ga0070668_100125033 Ga0070668_1001250332 304
93 3300005459 Ga0068867_100062379 Ga0068867_1000623792 304
94 3300005466 Ga0070685_10124860 Ga0070685_101248601 304
95 3300005718 Ga0068866_10191986 Ga0068866_101919862 304
96 3300006881 Ga0068865_100334179 Ga0068865_1003341792 304
97 3300013306 Ga0163162_10048945 Ga0163162_100489453 304
98 3300013306 Ga0163162_10614549 Ga0163162_106145491 304
99 3300013308 Ga0157375_10524719 Ga0157375_105247191 304
100 3300014326 Ga0157380_10035562 Ga0157380_100355622 304
101 3300025938 Ga0207704_10019326 Ga0207704_100193262 304
102 3300026089 Ga0207648_10014469 Ga0207648_100144698 304
103 3300026118 Ga0207675_100068117 Ga0207675_1000681175 304
104 3300028380 Ga0268265_10200934 Ga0268265_102009342 304
105 3300031507 Ga0307509_10086712 Ga0307509_100867125 304
106 3300033180 Ga0307510_10011814 Ga0307510_100118146 304
107 3300044765 Ga0466970_0076026 Ga0466970_0076026_401_1315 304
108 3300053119 Ga0500595_016588 Ga0500595_016588_1620_2570 304
109 3300053139 Ga0500568_0023205 Ga0500568_0023205_1011_1961 304
110 3300005436 Ga0070713_100000849 Ga0070713_1000008491 305
111 3300006028 Ga0070717_10000144 Ga0070717_100001446 305
112 3300021361 Ga0213872_10004930 Ga0213872_100049303 305
113 3300021361 Ga0213872_10078283 Ga0213872_100782832 305
114 3300025928 Ga0207700_10001272 Ga0207700_1000127213 305
115 3300044684 Ga0466966_0043212 Ga0466966_0043212_991_1908 305
116 3300044842 Ga0466957_0025089 Ga0466957_0025089_1805_2722 305
117 3300005329 Ga0070683_100045353 Ga0070683_1000453533 306
118 3300005548 Ga0070665_100351497 Ga0070665_1003514972 306
119 3300009093 Ga0105240_10289529 Ga0105240_102895292 306
120 3300009545 Ga0105237_10299948 Ga0105237_102999482 306
121 3300009551 Ga0105238_10061641 Ga0105238_100616412 306
122 3300013307 Ga0157372_10645209 Ga0157372_106452092 306
123 3300021361 Ga0213872_10000628 Ga0213872_100006282 306
124 3300025924 Ga0207694_10080252 Ga0207694_100802522 306
125 3300025944 Ga0207661_10078303 Ga0207661_100783033 306
126 3300039447 Ga0436361_0093690 Ga0436361_0093690_850_1770 306
127 3300039450 Ga0436363_1077398 Ga0436363_1077398_336_1310 306
128 3300039447 Ga0436361_0919771 Ga0436361_0919771_1371_2303 307
129 3300046471 Ga0495650_0003635 Ga0495650_0003635_1473_2414 307
130 3300049570 Ga0501033_0127907 Ga0501033_0127907_16_942 307
131 3300005353 Ga0070669_100078139 Ga0070669_1000781392 308
132 3300005354 Ga0070675_100191467 Ga0070675_1001914672 308
133 3300009177 Ga0105248_10051633 Ga0105248_100516333 308
134 3300025923 Ga0207681_10087760 Ga0207681_100877602 308
135 3300025926 Ga0207659_10189877 Ga0207659_101898772 308
136 3300025961 Ga0207712_10225076 Ga0207712_102250762 308
137 3300049583 Ga0501067_0001395 Ga0501067_0001395_5527_6459 308
138 3300049744 Ga0501083_0001788 Ga0501083_0001788_3975_4907 308
139 3300049744 Ga0501083_0026038 Ga0501083_0026038_2779_3711 308
140 3300049744 Ga0501083_0124578 Ga0501083_0124578_441_1373 308
141 3300054114 Ga0501084_0034250 Ga0501084_0034250_1420_2352 308
142 3300009553 Ga0105249_10395806 Ga0105249_103958062 309
143 3300025961 Ga0207712_10138803 Ga0207712_101388032 309
144 3300031238 Ga0265332_10049326 Ga0265332_100493262 309
145 3300031240 Ga0265320_10107204 Ga0265320_101072041 309
146 3300031247 Ga0265340_10037849 Ga0265340_100378492 309
147 3300031712 Ga0265342_10017565 Ga0265342_100175651 309
148 3300048907 Ga0496104_0037904 Ga0496104_0037904_2829_3779 309
149 3300005985 Ga0081539_10002576 Ga0081539_1000257619 310
150 3300048929 Ga0496126_0189630 Ga0496126_0189630_397_1347 310
151 3300049588 Ga0501072_0019573 Ga0501072_0019573_1255_2190 310
152 3300054114 Ga0501084_0178561 Ga0501084_0178561_356_1291 310
153 3300047320 Ga0495672_0016953 Ga0495672_0016953_3753_4706 311
154 3300005937 Ga0081455_10015320 Ga0081455_100153207 312
155 3300046524 Ga0495648_0018990 Ga0495648_0018990_101_1060 312
156 3300037466 Ga0395898_0069266 Ga0395898_0069266_936_1895 313
157 3300038443 Ga0395901_0293557 Ga0395901_0293557_83_1042 313
158 3300048907 Ga0496104_0481029 Ga0496104_0481029_133_1080 313
159 3300005436 Ga0070713_100231418 Ga0070713_1002314182 314
160 3300005614 Ga0068856_100289713 Ga0068856_1002897132 314
161 3300010159 Ga0099796_10056784 Ga0099796_100567842 314
162 3300028800 Ga0265338_10020688 Ga0265338_100206883 314
163 3300031247 Ga0265340_10002182 Ga0265340_100021825 314
164 3300031249 Ga0265339_10003653 Ga0265339_100036539 314
165 3300031250 Ga0265331_10033779 Ga0265331_100337792 314
166 3300031344 Ga0265316_10021514 Ga0265316_100215144 314
167 3300031344 Ga0265316_10025053 Ga0265316_100250532 314
168 3300031595 Ga0265313_10000356 Ga0265313_1000035632 314
169 3300031711 Ga0265314_10186285 Ga0265314_101862851 314
170 3300031712 Ga0265342_10022723 Ga0265342_100227232 314
171 3300046511 Ga0495608_0276028 Ga0495608_0276028_52_1020 314
172 3300046663 Ga0495635_0315505 Ga0495635_0315505_30_998 314
173 3300047319 Ga0495674_0101615 Ga0495674_0101615_270_1238 314
174 3300009094 Ga0111539_10133958 Ga0111539_101339582 315
175 3300039438 Ga0436360_0501157 Ga0436360_0501157_407_1357 315
176 3300050511 nmdc:mga08y16_96057_c1 nmdc:mga08y16_96057_c1_1203_2207 315
177 3300053091 Ga0500647_0117676 Ga0500647_0117676_110_1060 315
178 3300053094 Ga0500566_0000601 Ga0500566_0000601_19100_20050 315
179 3300053095 Ga0500640_001185 Ga0500640_001185_6504_7454 315
180 3300053111 Ga0500572_002533 Ga0500572_002533_110_1060 315
181 3300053123 Ga0500614_001061 Ga0500614_001061_622_1572 315
182 3300053136 Ga0500559_0014002 Ga0500559_0014002_2333_3283 315
183 3300053148 Ga0500590_046103 Ga0500590_046103_295_1245 315
184 3300053150 Ga0500603_000166 Ga0500603_000166_14374_15324 315
185 3300053159 Ga0500630_006610 Ga0500630_006610_1453_2403 315
186 3300053162 Ga0500638_036943 Ga0500638_036943_161_1111 315
187 3300053163 Ga0500639_000166 Ga0500639_000166_7608_8558 315
188 3300053735 Ga0500596_000771 Ga0500596_000771_120_1070 315
189 3300005471 Ga0070698_100218068 Ga0070698_1002180682 316
190 3300006178 Ga0075367_10182277 Ga0075367_101822772 316
191 3300006186 Ga0075369_10002262 Ga0075369_100022625 316
192 3300006353 Ga0075370_10147794 Ga0075370_101477942 316
193 3300006844 Ga0075428_100111221 Ga0075428_1001112212 316
194 3300021388 Ga0213875_10023210 Ga0213875_100232103 316
195 3300031241 Ga0265325_10002809 Ga0265325_100028094 316
196 3300033180 Ga0307510_10091918 Ga0307510_100919183 316
197 3300035118 Ga0373954_0014139 Ga0373954_0014139_1978_2937 316
198 3300035172 Ga0373955_0006204 Ga0373955_0006204_768_1727 316
199 3300035724 Ga0373933_0066920 Ga0373933_0066920_1025_1984 316
200 3300036401 Ga0373937_0108706 Ga0373937_0108706_1043_2002 316
201 3300037853 Ga0436364_1339039 Ga0436364_1339039_3971_4924 316
202 3300039437 Ga0436365_0884021 Ga0436365_0884021_1972_2925 316
203 3300039450 Ga0436363_0508743 Ga0436363_0508743_391_1344 316
204 3300044684 Ga0466966_0064476 Ga0466966_0064476_803_1756 316
205 3300044693 Ga0466961_0049625 Ga0466961_0049625_43_996 316
206 3300044719 Ga0466971_0040267 Ga0466971_0040267_458_1411 316
207 3300045049 Ga0466959_0066435 Ga0466959_0066435_187_1140 316
208 3300046454 Ga0495592_0170051 Ga0495592_0170051_52_1011 316
209 3300046459 Ga0495629_0035842 Ga0495629_0035842_1454_2413 316
210 3300046463 Ga0495653_0123189 Ga0495653_0123189_682_1641 316
211 3300046511 Ga0495608_0016044 Ga0495608_0016044_863_1822 316
212 3300046514 Ga0495618_0055397 Ga0495618_0055397_700_1659 316
213 3300046536 Ga0495587_0090239 Ga0495587_0090239_387_1346 316
214 3300046543 Ga0495645_0116334 Ga0495645_0116334_657_1616 316
215 3300046559 Ga0495667_0034502 Ga0495667_0034502_1387_2346 316
216 3300046678 Ga0495599_0024026 Ga0495599_0024026_949_1908 316
217 3300046679 Ga0495623_0023524 Ga0495623_0023524_2754_3713 316
218 3300046680 Ga0495646_0057129 Ga0495646_0057129_751_1710 316
219 3300046809 Ga0495600_0154341 Ga0495600_0154341_464_1423 316
220 3300047322 Ga0495680_0029180 Ga0495680_0029180_1997_2956 316
221 3300047444 Ga0495675_0064158 Ga0495675_0064158_1066_2025 316
222 3300047471 Ga0495684_0018562 Ga0495684_0018562_3742_4701 316
223 3300048088 Ga0495602_0030317 Ga0495602_0030317_464_1423 316
224 3300048918 Ga0496115_0437788 Ga0496115_0437788_22_1038 316
225 3300050489 nmdc:mga03683_472_c2 nmdc:mga03683_472_c2_8536_9498 316
226 3300050493 nmdc:mga0k408_126603_c1 nmdc:mga0k408_126603_c1_395_1357 316
227 3300050493 nmdc:mga0k408_44051_c1 nmdc:mga0k408_44051_c1_189_1163 316
228 3300050494 nmdc:mga06z11_30591_c1 nmdc:mga06z11_30591_c1_372_1334 316
229 3300050496 nmdc:mga07m45_89746_c1 nmdc:mga07m45_89746_c1_565_1527 316
230 3300050516 nmdc:mga0sz30_946_c1 nmdc:mga0sz30_946_c1_9106_10068 316
231 3300053077 Ga0495601_0047363 Ga0495601_0047363_610_1569 316
232 3300053078 Ga0495612_0058254 Ga0495612_0058254_207_1166 316
233 3300053177 Ga0500636_0046894 Ga0500636_0046894_964_1917 316
234 3300053177 Ga0500636_0173794 Ga0500636_0173794_86_1042 316
235 3300010159 Ga0099796_10029374 Ga0099796_100293742 317
236 3300021384 Ga0213876_10013803 Ga0213876_100138032 317
237 3300039437 Ga0436365_0518064 Ga0436365_0518064_1260_2234 317
238 3300039438 Ga0436360_1072262 Ga0436360_1072262_69_1025 317
239 3300046559 Ga0495667_0045102 Ga0495667_0045102_1658_2614 317
240 iso_pu_bacteria 2821443989 2821448350 317
241 3300006038 Ga0075365_10165471 Ga0075365_101654713 319
242 3300048907 Ga0496104_0124112 Ga0496104_0124112_228_1193 319
243 3300050492 nmdc:mga0yw44_66450_c1 nmdc:mga0yw44_66450_c1_1171_2148 319
244 3300003187 JGI25151J46595_10000246 JGI25151J46595_1000024639 320
245 3300003354 JGI25160J50197_1007541 JGI25160J50197_10075413 320
246 3300005436 Ga0070713_100222278 Ga0070713_1002222781 320
247 3300025284 Ga0209130_1000486 Ga0209130_10004867 320
248 3300025294 Ga0209025_1000265 Ga0209025_100026597 320
249 3300025297 Ga0209758_1001772 Ga0209758_100177220 320
250 3300025302 Ga0207426_1000088 Ga0207426_100008827 320
251 3300026041 Ga0207639_10400227 Ga0207639_104002271 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14226

DIOX_N

non-haem dioxygenase in morphine synthesis N-terminal

25

150

0.96

PF03171

2OG-FeII_Oxy

2OG-Fe(II) oxygenase superfamily

193

295

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xjj-assembly1.cif.gz_A structure of non-heme iron enzyme tropc: radical tropolone biosynthesis 0.9433 4 282
5c3p-assembly4.cif.gz_D crystal structure of the full-length neurospora crassa t7h in complex with alpha-kg 0.9176 4 307
5c3o-assembly1.cif.gz_A crystal structure of the c-terminal truncated neurospora crassa t7h (nct7hdeltac) in apo form 0.9148 4 273
3oox-assembly2.cif.gz_B crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution 0.9097 1 309
3oox-assembly2.cif.gz_B crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution 0.9039 1 309
ID Description Score Start End Superfamily
af_A4I478_1_315_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.9561 4 317 2.60.120.330
af_A4I478_1_315_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.9473 4 317 2.60.120.330
af_I1J4J4_3_327_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.9218 4 309 2.60.120.330
af_K7KER3_4_212_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.9193 132 304 2.60.120.330
5c3oA00 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.9137 4 273 2.60.120.330
ID Description Score Start End GO Terms
AF-N9BZB9-F1-model_v4 2-oxoglutarate-dependent ethylene/succinate-forming enzyme (EC 1.13.12.19) (EC 1.14.20.7) (2-oxoglutarate dioxygenase (ethylene-forming)) (2-oxoglutarate/L-arginine monooxygenase/decarboxylase (succinate-forming)) 0.9795 4 311 GO:0046872
GO:0102276
AF-A0A7C7G2I4-F1-model_v4 deleted 0.9651 15 315
AF-S9U422-F1-model_v4 NADPH2:quinone reductase 0.965 4 317 GO:0016020
GO:0016491
GO:0046872
AF-A0A0N8RXI1-F1-model_v4 Putative 2-Oxobutyrate oxidase 0.9648 1 160 GO:0009693
GO:0051213
AF-A0A4Q3YJL1-F1-model_v4 2-oxoglutarate-dependent ethylene/succinate-forming enzyme (EC 1.13.12.19) (EC 1.14.20.7) (2-oxoglutarate dioxygenase (ethylene-forming)) (2-oxoglutarate/L-arginine monooxygenase/decarboxylase (succinate-forming)) 0.9645 122 310 GO:0016491
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.6 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map