F362693

General Info

Members Datasets Scaffolds Average Seq Length
251 190 206 337

Family's Representative Sequence

Representative Sequence 3300046810|Ga0495660_0088857|Ga0495660_0088857_21_1163
Length 380
Sequence MLIINNTYFLVGKIQKSTYLPKVDIWPRFVIKINEMKTPTINRQEIMKAVRQYEFGGPEVLRYEDAPIPPVLRGEILVRVHAVGLNPPDWYLRDGFKSLPPEWQPQGNFPVILGTDISGVVEAVGDGVEDFSVGDQVYAMVRFPEGVFGESRAYAEYVTVPALQAALKPAGIDHIHAAAAPMSLLTAYQFMIEQGHDVPNPIQPDQHQPVPLNGKKVLINGAAGGVGHFAVQLAKWKGAYVIAVASGKHETFLRDLGADEFIDYTKTNAEDVVRDVDLVVDSIGGPGTSRFLQTIKPGGALFPVFGLGADGREQAEKLGIIFSTTQVRSSGAQLAELSDLLNNGTIRVGIDSTFSLADARKAHERAALGNIQGKIALIVD

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
5 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
6 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
7 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
8 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
9 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
10 2636415599 Klebsiella variicola DX120E Isolate Unclassified
11 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
12 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
13 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
14 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
15 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
16 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
17 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
18 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
19 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
20 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
21 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
22 2775507074 Klebsiella sp. D5A Isolate Unclassified
23 2818991444 Filimonas endophytica 3197 Isolate Unclassified
24 2818991446 Variovorax sp. 1180 Isolate Unclassified
25 2818991457 Xanthomonas translucens 569 Isolate Unclassified
26 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
27 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
28 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
29 2857553236 Duganella sp. R-74557 Isolate Unclassified
30 2857564685 Duganella sp. R-74599 Isolate Unclassified
31 2899924645 Variovorax sp. 369 Isolate Unclassified
32 2904424332 Duganella sp. 1411 Isolate Rhizosphere
33 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
34 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
35 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
36 2928051484 Variovorax sp. 1133 Isolate Unclassified
37 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
38 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
39 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
40 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
41 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
42 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
43 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
44 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
45 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
46 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
47 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
48 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
49 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
50 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
51 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
52 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
84 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
131 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
132 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
133 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
189 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
190 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.07
Metatranscriptomes 0
Isolates 17.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.8
Bulb 0
Endosphere 13.15
Nodule 5.18
Rhizoplane 0.4
Rhizosphere 55.78
Stem 0
Stem Tuber 0
Unclassified 24.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000096 3300002704 Bacteria 49227
2 JGI25156J39149_1002307 3300002705 Bacteria 6975
3 JGI25154J39366_1000146 3300002738 Bacteria 55646
4 JGI25164J39214_1002397 3300002772 Bacteria 2919
5 rootH2_10049140 3300003320 Bacteria 5317
6 rootL2_10097604 3300003322 Bacteria 1695
7 rootL2_10179581 3300003322 Bacteria 1941
8 Ga0055535_1000391 3300003761 Bacteria 41551
9 Ga0055542_1000095 3300003762 Bacteria 119022
10 Ga0055542_1001197 3300003762 Bacteria 14763
11 Ga0055529_1001768 3300003763 Bacteria 5339
12 Ga0055540_1018719 3300003792 Bacteria 1889
13 Ga0065165_1000001 3300005262 Bacteria 494087
14 Ga0065714_10081012 3300005288 Bacteria 2403
15 Ga0065704_10012296 3300005289 Bacteria 2621
16 Ga0070658_10129282 3300005327 Bacteria 2104
17 Ga0070670_100084325 3300005331 Bacteria 2730
18 Ga0070666_10232512 3300005335 Bacteria 1302
19 Ga0070660_100182294 3300005339 Bacteria 1699
20 Ga0070668_100000924 3300005347 Bacteria 20475
21 Ga0070669_100000775 3300005353 Bacteria 23189
22 Ga0070671_100001040 3300005355 Bacteria 20430
23 Ga0070667_100173514 3300005367 Bacteria 1904
24 Ga0070662_100003582 3300005457 Bacteria 9687
25 Ga0070662_100056163 3300005457 Bacteria 2858
26 Ga0070665_100003376 3300005548 Bacteria 17083
27 Ga0070665_100020792 3300005548 Bacteria 6597
28 Ga0070665_100023646 3300005548 Bacteria 6186
29 Ga0068856_100053629 3300005614 Bacteria 3976
30 Ga0068859_100007042 3300005617 Bacteria 11420
31 Ga0068863_100001134 3300005841 Bacteria 26619
32 Ga0068863_100002358 3300005841 Bacteria 18787
33 Ga0068858_100014525 3300005842 Bacteria 7419
34 Ga0068860_100000086 3300005843 Bacteria 165786
35 Ga0068860_100030870 3300005843 Bacteria 5152
36 Ga0081540_1027198 3300005983 Bacteria 3246
37 Ga0070717_10071023 3300006028 Bacteria 2903
38 Ga0075363_100061844 3300006048 Bacteria 2018
39 Ga0075366_10000275 3300006195 Bacteria 22900
40 Ga0075366_10007452 3300006195 Bacteria 6045
41 Ga0075366_10167619 3300006195 Bacteria 1332
42 Ga0097620_100007042 3300006931 Bacteria 11420
43 Ga0105251_10000041 3300009011 Bacteria 115207
44 Ga0105251_10000354 3300009011 Bacteria 45386
45 Ga0105240_10014826 3300009093 Bacteria 10624
46 Ga0105247_10048314 3300009101 Bacteria 2613
47 Ga0105247_10200455 3300009101 Bacteria 1341
48 Ga0105243_10008527 3300009148 Bacteria 7864
49 Ga0105243_10091762 3300009148 Bacteria 2502
50 Ga0105248_10010377 3300009177 Bacteria 10256
51 Ga0105248_10013610 3300009177 Bacteria 8955
52 Ga0105248_10181323 3300009177 Bacteria 2373
53 Ga0105237_10089004 3300009545 Bacteria 3077
54 Ga0105238_10026303 3300009551 Bacteria 5931
55 Ga0105238_10090700 3300009551 Bacteria 3044
56 Ga0105238_10139534 3300009551 Bacteria 2401
57 Ga0123341_1000008 3300009765 Bacteria 134834
58 Ga0123342_1024484 3300009766 Bacteria 3774
59 Ga0105239_10300796 3300010375 Bacteria 1807
60 Ga0105239_10369181 3300010375 Unclassified 1621
61 Ga0157371_10047368 3300013102 Bacteria 3057
62 Ga0157370_10038020 3300013104 Bacteria 4658
63 Ga0157370_10048495 3300013104 Bacteria 4068
64 Ga0157369_10533978 3300013105 Bacteria 1213
65 Ga0163162_10001826 3300013306 Bacteria 20028
66 Ga0163162_10241053 3300013306 Bacteria 1939
67 Ga0157372_10025186 3300013307 Bacteria 6466
68 Ga0182005_1001161 3300015265 Bacteria 10905
69 Ga0209435_100057 3300025206 Bacteria 82390
70 Ga0209674_100341 3300025226 Bacteria 27728
71 Ga0209147_100778 3300025229 Bacteria 15536
72 Ga0209147_101287 3300025229 Bacteria 9744
73 Ga0207427_100212 3300025231 Bacteria 51690
74 Ga0209437_101509 3300025233 Bacteria 5523
75 Ga0209258_100069 3300025242 Bacteria 280496
76 Ga0209646_1000061 3300025246 Bacteria 255495
77 Ga0209026_1003637 3300025250 Bacteria 4947
78 Ga0209677_101063 3300025253 Bacteria 13019
79 Ga0209677_101942 3300025253 Bacteria 8270
80 Ga0209148_1000076 3300025254 Bacteria 301449
81 Ga0209148_1000302 3300025254 Bacteria 70861
82 Ga0209148_1002394 3300025254 Bacteria 6555
83 Ga0209759_1000371 3300025256 Bacteria 56139
84 Ga0209455_1000284 3300025272 Bacteria 54580
85 Ga0207426_1017185 3300025302 Bacteria 2577
86 Ga0209051_1002452 3300025303 Bacteria 13287
87 Ga0207713_1002353 3300025735 Bacteria 13857
88 Ga0207713_1039088 3300025735 Bacteria 2005
89 Ga0207705_10206450 3300025909 Bacteria 1489
90 Ga0207695_10009159 3300025913 Bacteria 12284
91 Ga0207695_10210474 3300025913 Bacteria 1855
92 Ga0207681_10011959 3300025923 Bacteria 5345
93 Ga0207694_10013866 3300025924 Bacteria 6076
94 Ga0207650_10038277 3300025925 Bacteria 3502
95 Ga0207650_10060617 3300025925 Bacteria 2824
96 Ga0207644_10000203 3300025931 Bacteria 41625
97 Ga0207706_10004062 3300025933 Bacteria 13834
98 Ga0207706_10230688 3300025933 Bacteria 1620
99 Ga0207709_10001926 3300025935 Bacteria 13633
100 Ga0207709_10111164 3300025935 Bacteria 1832
101 Ga0207711_10001052 3300025941 Bacteria 26434
102 Ga0207711_10011463 3300025941 Bacteria 7370
103 Ga0207667_10000115 3300025949 Bacteria 128732
104 Ga0207667_10187855 3300025949 Bacteria 2121
105 Ga0207668_10006364 3300025972 Bacteria 6982
106 Ga0207658_10079571 3300025986 Bacteria 2507
107 Ga0207703_10000281 3300026035 Bacteria 56555
108 Ga0207639_10135473 3300026041 Bacteria 2044
109 Ga0207678_10073897 3300026067 Bacteria 2921
110 Ga0207702_10259730 3300026078 Unclassified 1635
111 Ga0207641_10000527 3300026088 Bacteria 42788
112 Ga0207641_10001740 3300026088 Bacteria 21016
113 Ga0207674_10387987 3300026116 Bacteria 1350
114 Ga0209371_1002085 3300027312 Bacteria 11885
115 Ga0268266_10000229 3300028379 Bacteria 96547
116 Ga0268265_10122725 3300028380 Bacteria 2143
117 Ga0268264_10000044 3300028381 Bacteria 368079
118 Ga0268264_10075034 3300028381 Bacteria 2874
119 Ga0268264_10198900 3300028381 Bacteria 1832
120 Ga0307515_10000349 3300028794 Bacteria 114163
121 Ga0307515_10023329 3300028794 Bacteria 10848
122 Ga0268256_1001836 3300030500 Bacteria 11885
123 Ga0316183_1017569 3300030742 Bacteria 20437
124 Ga0316181_1101195 3300030744 Bacteria 2006
125 Ga0316181_1101296 3300030744 Bacteria 2679
126 Ga0316182_1328964 3300030745 Bacteria 2401
127 Ga0265320_10121656 3300031240 Bacteria 1190
128 Ga0307513_10093026 3300031456 Bacteria 3066
129 Ga0395905_0050462 3300037471 Bacteria 3898
130 Ga0466959_0072217 3300045049 Bacteria 2498
131 Ga0495627_005361 3300046453 Bacteria 5181
132 Ga0495590_0000011 3300046457 Bacteria 307470
133 Ga0495591_001977 3300046458 Bacteria 11970
134 Ga0495650_0016863 3300046471 Bacteria 3678
135 Ga0495605_0000036 3300046474 Bacteria 203902
136 Ga0495605_0024140 3300046474 Bacteria 3186
137 Ga0495585_0001231 3300046492 Bacteria 20710
138 Ga0495585_0032155 3300046492 Bacteria 2974
139 Ga0495594_0000437 3300046499 Bacteria 21010
140 Ga0495583_0000028 3300046506 Bacteria 255787
141 Ga0495606_0001028 3300046507 Bacteria 40485
142 Ga0495606_0001435 3300046507 Bacteria 31977
143 Ga0495606_0031158 3300046507 Bacteria 3712
144 Ga0495610_0000576 3300046512 Bacteria 36449
145 Ga0495620_0000028 3300046515 Bacteria 123172
146 Ga0495631_0001086 3300046518 Bacteria 16881
147 Ga0495632_0000011 3300046519 Bacteria 266804
148 Ga0495648_0000597 3300046524 Bacteria 38655
149 Ga0495654_0001114 3300046530 Bacteria 19384
150 Ga0495609_0000081 3300046538 Bacteria 116100
151 Ga0495609_0007471 3300046538 Bacteria 5450
152 Ga0495609_0036881 3300046538 Bacteria 2206
153 Ga0495597_0010414 3300046542 Bacteria 4548
154 Ga0495633_0000028 3300046558 Bacteria 203214
155 Ga0495633_0000596 3300046558 Bacteria 34875
156 Ga0495668_0000045 3300046616 Bacteria 225145
157 Ga0495611_0016842 3300046648 Bacteria 3124
158 Ga0495661_0000217 3300046665 Bacteria 66241
159 Ga0495670_0001163 3300046691 Bacteria 12777
160 Ga0495589_0008457 3300046794 Bacteria 5374
161 Ga0495660_0001181 3300046810 Bacteria 18415
162 Ga0495660_0088857 3300046810 Bacteria 1609
163 Ga0495683_0000060 3300047323 Bacteria 115881
164 Ga0495679_000396 3300047446 Bacteria 32865
165 Ga0495673_0002516 3300047469 Bacteria 12818
166 Ga0495673_0021210 3300047469 Bacteria 3214
167 Ga0495681_0002397 3300047470 Bacteria 13416
168 Ga0496103_0057582 3300048906 Bacteria 2413
169 Ga0496117_0000237 3300048920 Bacteria 104534
170 Ga0496117_0015527 3300048920 Bacteria 6485
171 Ga0496118_0002119 3300048921 Bacteria 27797
172 Ga0496118_0043901 3300048921 Bacteria 3507
173 Ga0496118_0219772 3300048921 Bacteria 1107
174 Ga0496119_0000107 3300048922 Bacteria 116784
175 Ga0496120_0000011 3300048923 Bacteria 365549
176 Ga0496120_0001087 3300048923 Bacteria 35657
177 Ga0496121_0003029 3300048924 Bacteria 24402
178 Ga0496122_0000185 3300048925 Bacteria 144350
179 Ga0496122_0043765 3300048925 Bacteria 3503
180 Ga0496122_0208721 3300048925 Bacteria 1134
181 Ga0496123_0000105 3300048926 Bacteria 167806
182 Ga0496123_0024777 3300048926 Bacteria 4547
183 Ga0496124_0163419 3300048927 Bacteria 1733
184 Ga0496124_0240980 3300048927 Bacteria 1345
185 Ga0496125_0000312 3300048928 Bacteria 95519
186 Ga0496125_0002513 3300048928 Bacteria 23692
187 Ga0496125_0005219 3300048928 Bacteria 14572
188 Ga0496126_0007073 3300048929 Bacteria 12359
189 Ga0496126_0033936 3300048929 Bacteria 4799
190 Ga0496126_0045257 3300048929 Bacteria 4046
191 Ga0496126_0104893 3300048929 Bacteria 2469
192 Ga0495678_000020 3300049459 Bacteria 253654
193 Ga0501031_0241536 3300049568 Bacteria 1174
194 Ga0501036_0018961 3300049572 Bacteria 5772
195 Ga0501037_0098463 3300049573 Bacteria 2112
196 Ga0501043_0072629 3300049579 Bacteria 2703
197 Ga0501047_0001038 3300049581 Bacteria 27775
198 Ga0501044_0258835 3300049823 Bacteria 1679
199 nmdc:mga0k408_10974_c1 3300050493 Bacteria 4917
200 nmdc:mga0k408_162235_c1 3300050493 Bacteria 1332
201 nmdc:mga0k408_166_c1 3300050493 Bacteria 34700
202 nmdc:mga04h51_35831_c1 3300050495 Bacteria 1592
203 nmdc:mga07m45_2431_c1 3300050496 Bacteria 8736
204 Ga0500622_0004180 3300053156 Bacteria 9221
205 Ga0500622_0009486 3300053156 Bacteria 5385
206 Ga0500636_0019919 3300053177 Bacteria 3966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0219772 Ga0496118_0219772_167_1081 304
2 3300046538 Ga0495609_0036881 Ga0495609_0036881_24_941 305
3 3300049568 Ga0501031_0241536 Ga0501031_0241536_81_1091 314
4 3300005842 Ga0068858_100014525 Ga0068858_1000145252 321
5 3300009551 Ga0105238_10026303 Ga0105238_100263032 321
6 3300026035 Ga0207703_10000281 Ga0207703_1000028126 321
7 3300045049 Ga0466959_0072217 Ga0466959_0072217_198_1259 321
8 3300048928 Ga0496125_0000312 Ga0496125_0000312_19909_20922 321
9 3300048929 Ga0496126_0045257 Ga0496126_0045257_164_1177 321
10 3300009101 Ga0105247_10048314 Ga0105247_100483142 322
11 3300009148 Ga0105243_10008527 Ga0105243_100085275 322
12 3300009177 Ga0105248_10181323 Ga0105248_101813232 322
13 3300015265 Ga0182005_1001161 Ga0182005_10011612 322
14 3300025935 Ga0207709_10001926 Ga0207709_100019264 322
15 3300048921 Ga0496118_0002119 Ga0496118_0002119_7130_8164 322
16 3300010375 Ga0105239_10300796 Ga0105239_103007963 323
17 3300025924 Ga0207694_10013866 Ga0207694_100138662 324
18 3300005617 Ga0068859_100007042 Ga0068859_10000704213 325
19 3300006931 Ga0097620_100007042 Ga0097620_10000704213 325
20 3300009177 Ga0105248_10013610 Ga0105248_100136109 325
21 3300025941 Ga0207711_10011463 Ga0207711_100114632 325
22 3300046492 Ga0495585_0032155 Ga0495585_0032155_1756_2733 325
23 3300009148 Ga0105243_10091762 Ga0105243_100917622 326
24 3300048929 Ga0496126_0007073 Ga0496126_0007073_4199_5233 326
25 3300050493 nmdc:mga0k408_10974_c1 nmdc:mga0k408_10974_c1_2589_3593 326
26 3300050496 nmdc:mga07m45_2431_c1 nmdc:mga07m45_2431_c1_5680_6684 326
27 3300003762 Ga0055542_1001197 Ga0055542_10011976 327
28 3300003763 Ga0055529_1001768 Ga0055529_10017683 327
29 3300005548 Ga0070665_100023646 Ga0070665_1000236462 327
30 3300025226 Ga0209674_100341 Ga0209674_10034117 327
31 3300025233 Ga0209437_101509 Ga0209437_1015092 327
32 3300025254 Ga0209148_1000302 Ga0209148_100030226 327
33 3300025254 Ga0209148_1002394 Ga0209148_10023947 327
34 3300025272 Ga0209455_1000284 Ga0209455_100028446 327
35 3300048923 Ga0496120_0001087 Ga0496120_0001087_23889_24872 327
36 3300048927 Ga0496124_0240980 Ga0496124_0240980_271_1278 327
37 3300030742 Ga0316183_1017569 Ga0316183_101756910 330
38 3300030744 Ga0316181_1101195 Ga0316181_11011952 330
39 3300030744 Ga0316181_1101296 Ga0316181_11012964 330
40 3300030745 Ga0316182_1328964 Ga0316182_13289643 330
41 iso_pu_bacteria 2904424332 2904426609 330
42 3300005457 Ga0070662_100056163 Ga0070662_1000561633 331
43 3300006195 Ga0075366_10007452 Ga0075366_100074527 331
44 3300025933 Ga0207706_10230688 Ga0207706_102306882 331
45 3300025935 Ga0207709_10111164 Ga0207709_101111642 331
46 3300026116 Ga0207674_10387987 Ga0207674_103879871 331
47 3300046512 Ga0495610_0000576 Ga0495610_0000576_18622_19617 331
48 iso_pu_bacteria 2929212328 2929217356 331
49 3300026067 Ga0207678_10073897 Ga0207678_100738972 332
50 3300053156 Ga0500622_0004180 Ga0500622_0004180_6053_7051 332
51 iso_pu_bacteria 2503198000 2503198123 333
52 3300003322 rootL2_10097604 rootL2_100976042 334
53 3300009765 Ga0123341_1000008 Ga0123341_1000008127 334
54 3300009766 Ga0123342_1024484 Ga0123342_10244843 334
55 3300013306 Ga0163162_10001826 Ga0163162_1000182615 334
56 3300046492 Ga0495585_0001231 Ga0495585_0001231_16618_17622 334
57 3300046507 Ga0495606_0001028 Ga0495606_0001028_7569_8573 334
58 3300046519 Ga0495632_0000011 Ga0495632_0000011_35046_36050 334
59 iso_pu_bacteria 2508501114 2509076957 334
60 iso_pu_bacteria 2509276033 2509445223 334
61 iso_pu_bacteria 2509276033 2509446463 334
62 iso_pu_bacteria 2522572158 2523102950 334
63 iso_pu_bacteria 2523231067 2523467162 334
64 iso_pu_bacteria 2643221595 2643986669 334
65 iso_pu_bacteria 2643221627 2644157604 334
66 iso_pu_bacteria 2718218233 2720616908 334
67 iso_pu_bacteria 2718218235 2720629037 334
68 iso_pu_bacteria 2718218269 2720773111 334
69 iso_pu_bacteria 2721755819 2724093140 334
70 iso_pu_bacteria 2841864319 2841866364 334
71 iso_pu_bacteria 2913308742 2913308784 334
72 iso_pu_bacteria 8005619151 8005624645 334
73 iso_pu_bacteria 2513237087 2513589119 335
74 iso_pu_bacteria 2643221685 2644476942 335
75 iso_pu_bacteria 2818991446 2819598263 335
76 iso_pu_bacteria 2857553236 2857555137 335
77 iso_pu_bacteria 2857564685 2857566806 335
78 iso_pu_bacteria 2899924645 2899926375 335
79 iso_pu_bacteria 2928051484 2928058452 335
80 iso_pu_bacteria 8045864390 8045866717 335
81 3300005288 Ga0065714_10081012 Ga0065714_100810123 336
82 3300028794 Ga0307515_10000349 Ga0307515_1000034980 336
83 3300031240 Ga0265320_10121656 Ga0265320_101216561 336
84 iso_pu_bacteria 2818991444 2819590707 336
85 3300003322 rootL2_10179581 rootL2_101795813 337
86 3300005841 Ga0068863_100001134 Ga0068863_1000011346 337
87 3300005843 Ga0068860_100000086 Ga0068860_100000086114 337
88 3300006195 Ga0075366_10000275 Ga0075366_1000027519 337
89 3300009093 Ga0105240_10014826 Ga0105240_100148265 337
90 3300009545 Ga0105237_10089004 Ga0105237_100890043 337
91 3300009551 Ga0105238_10090700 Ga0105238_100907002 337
92 3300009551 Ga0105238_10139534 Ga0105238_101395343 337
93 3300010375 Ga0105239_10369181 Ga0105239_103691812 337
94 3300013104 Ga0157370_10048495 Ga0157370_100484954 337
95 3300013306 Ga0163162_10241053 Ga0163162_102410532 337
96 3300025229 Ga0209147_101287 Ga0209147_1012876 337
97 3300025913 Ga0207695_10210474 Ga0207695_102104742 337
98 3300026078 Ga0207702_10259730 Ga0207702_102597302 337
99 3300026088 Ga0207641_10000527 Ga0207641_100005276 337
100 3300028381 Ga0268264_10000044 Ga0268264_10000044108 337
101 3300046453 Ga0495627_005361 Ga0495627_005361_3723_4736 337
102 3300046458 Ga0495591_001977 Ga0495591_001977_970_1983 337
103 3300046471 Ga0495650_0016863 Ga0495650_0016863_2152_3165 337
104 3300046474 Ga0495605_0000036 Ga0495605_0000036_189750_190763 337
105 3300046474 Ga0495605_0024140 Ga0495605_0024140_1086_2111 337
106 3300046499 Ga0495594_0000437 Ga0495594_0000437_18652_19665 337
107 3300046506 Ga0495583_0000028 Ga0495583_0000028_205029_206042 337
108 3300046507 Ga0495606_0031158 Ga0495606_0031158_863_1912 337
109 3300046515 Ga0495620_0000028 Ga0495620_0000028_72534_73547 337
110 3300046518 Ga0495631_0001086 Ga0495631_0001086_4585_5598 337
111 3300046524 Ga0495648_0000597 Ga0495648_0000597_13848_14861 337
112 3300046530 Ga0495654_0001114 Ga0495654_0001114_11246_12259 337
113 3300046538 Ga0495609_0000081 Ga0495609_0000081_49890_50903 337
114 3300046542 Ga0495597_0010414 Ga0495597_0010414_439_1452 337
115 3300046558 Ga0495633_0000028 Ga0495633_0000028_49613_50626 337
116 3300046558 Ga0495633_0000596 Ga0495633_0000596_30179_31210 337
117 3300046648 Ga0495611_0016842 Ga0495611_0016842_1779_2792 337
118 3300046665 Ga0495661_0000217 Ga0495661_0000217_15861_16874 337
119 3300046691 Ga0495670_0001163 Ga0495670_0001163_10487_11500 337
120 3300046794 Ga0495589_0008457 Ga0495589_0008457_3767_4780 337
121 3300046810 Ga0495660_0001181 Ga0495660_0001181_11282_12295 337
122 3300047323 Ga0495683_0000060 Ga0495683_0000060_62648_63661 337
123 3300047446 Ga0495679_000396 Ga0495679_000396_1783_2796 337
124 3300047469 Ga0495673_0002516 Ga0495673_0002516_2065_3078 337
125 3300047470 Ga0495681_0002397 Ga0495681_0002397_6979_7992 337
126 3300048925 Ga0496122_0043765 Ga0496122_0043765_1853_2866 337
127 3300049459 Ga0495678_000020 Ga0495678_000020_203165_204178 337
128 3300050493 nmdc:mga0k408_166_c1 nmdc:mga0k408_166_c1_24277_25308 337
129 iso_pu_bacteria 2588253730 2588518069 337
130 iso_pu_bacteria 2593339238 2595446374 337
131 iso_pu_bacteria 2643221600 2644009048 337
132 iso_pu_bacteria 2739367857 2740001151 337
133 iso_pu_bacteria 2739367858 2740005967 337
134 3300003792 Ga0055540_1018719 Ga0055540_10187192 338
135 3300005262 Ga0065165_1000001 Ga0065165_1000001219 338
136 3300005289 Ga0065704_10012296 Ga0065704_100122962 338
137 3300005331 Ga0070670_100084325 Ga0070670_1000843253 338
138 3300005335 Ga0070666_10232512 Ga0070666_102325121 338
139 3300005347 Ga0070668_100000924 Ga0070668_10000092410 338
140 3300005353 Ga0070669_100000775 Ga0070669_10000077514 338
141 3300005355 Ga0070671_100001040 Ga0070671_10000104018 338
142 3300005367 Ga0070667_100173514 Ga0070667_1001735142 338
143 3300005548 Ga0070665_100003376 Ga0070665_10000337615 338
144 3300005548 Ga0070665_100020792 Ga0070665_1000207921 338
145 3300005841 Ga0068863_100002358 Ga0068863_1000023582 338
146 3300005843 Ga0068860_100030870 Ga0068860_1000308702 338
147 3300009011 Ga0105251_10000041 Ga0105251_100000414 338
148 3300009011 Ga0105251_10000354 Ga0105251_1000035412 338
149 3300009101 Ga0105247_10200455 Ga0105247_102004551 338
150 3300009177 Ga0105248_10010377 Ga0105248_100103778 338
151 3300025302 Ga0207426_1017185 Ga0207426_10171852 338
152 3300025303 Ga0209051_1002452 Ga0209051_10024521 338
153 3300025735 Ga0207713_1002353 Ga0207713_10023533 338
154 3300025735 Ga0207713_1039088 Ga0207713_10390882 338
155 3300025923 Ga0207681_10011959 Ga0207681_100119593 338
156 3300025925 Ga0207650_10038277 Ga0207650_100382773 338
157 3300025925 Ga0207650_10060617 Ga0207650_100606172 338
158 3300025931 Ga0207644_10000203 Ga0207644_1000020336 338
159 3300025941 Ga0207711_10001052 Ga0207711_1000105213 338
160 3300025972 Ga0207668_10006364 Ga0207668_100063644 338
161 3300025986 Ga0207658_10079571 Ga0207658_100795712 338
162 3300026088 Ga0207641_10001740 Ga0207641_100017403 338
163 3300028379 Ga0268266_10000229 Ga0268266_1000022973 338
164 3300028380 Ga0268265_10122725 Ga0268265_101227251 338
165 3300028381 Ga0268264_10075034 Ga0268264_100750342 338
166 3300028381 Ga0268264_10198900 Ga0268264_101989002 338
167 3300028794 Ga0307515_10023329 Ga0307515_100233297 338
168 3300031456 Ga0307513_10093026 Ga0307513_100930263 338
169 3300037471 Ga0395905_0050462 Ga0395905_0050462_322_1338 338
170 3300048906 Ga0496103_0057582 Ga0496103_0057582_89_1105 338
171 3300048920 Ga0496117_0000237 Ga0496117_0000237_101371_102387 338
172 3300048920 Ga0496117_0015527 Ga0496117_0015527_5181_6197 338
173 3300048922 Ga0496119_0000107 Ga0496119_0000107_13641_14657 338
174 3300048923 Ga0496120_0000011 Ga0496120_0000011_102170_103186 338
175 3300048924 Ga0496121_0003029 Ga0496121_0003029_3998_5014 338
176 3300048926 Ga0496123_0024777 Ga0496123_0024777_260_1276 338
177 3300048928 Ga0496125_0005219 Ga0496125_0005219_3617_4633 338
178 3300048929 Ga0496126_0033936 Ga0496126_0033936_2643_3659 338
179 3300048929 Ga0496126_0104893 Ga0496126_0104893_1343_2359 338
180 iso_pu_bacteria 2551306416 2553004796 338
181 iso_pu_bacteria 2636415599 2637225630 338
182 iso_pu_bacteria 2775507074 2777024364 338
183 iso_pu_bacteria 2842333319 2842338188 338
184 iso_pu_bacteria 2904513164 2904513509 338
185 iso_pu_bacteria 2923510766 2923515629 338
186 iso_pu_bacteria 2928130867 2928134997 338
187 iso_pu_bacteria 2969079654 2969082627 338
188 iso_pu_bacteria 2984559226 2984559690 338
189 iso_pu_bacteria 2984595703 2984597772 338
190 3300003320 rootH2_10049140 rootH2_100491404 339
191 3300003761 Ga0055535_1000391 Ga0055535_10003916 339
192 3300003762 Ga0055542_1000095 Ga0055542_100009537 339
193 3300005339 Ga0070660_100182294 Ga0070660_1001822942 339
194 3300005457 Ga0070662_100003582 Ga0070662_1000035826 339
195 3300005614 Ga0068856_100053629 Ga0068856_1000536292 339
196 3300005983 Ga0081540_1027198 Ga0081540_10271985 339
197 3300006195 Ga0075366_10167619 Ga0075366_101676191 339
198 3300013102 Ga0157371_10047368 Ga0157371_100473683 339
199 3300013104 Ga0157370_10038020 Ga0157370_100380204 339
200 3300013307 Ga0157372_10025186 Ga0157372_100251863 339
201 3300025229 Ga0209147_100778 Ga0209147_10077812 339
202 3300025242 Ga0209258_100069 Ga0209258_10006959 339
203 3300025253 Ga0209677_101063 Ga0209677_1010636 339
204 3300025253 Ga0209677_101942 Ga0209677_1019427 339
205 3300025254 Ga0209148_1000076 Ga0209148_1000076197 339
206 3300025933 Ga0207706_10004062 Ga0207706_100040628 339
207 3300046457 Ga0495590_0000011 Ga0495590_0000011_238336_239355 339
208 3300046538 Ga0495609_0007471 Ga0495609_0007471_2642_3691 339
209 3300046616 Ga0495668_0000045 Ga0495668_0000045_219397_220416 339
210 3300046810 Ga0495660_0088857 Ga0495660_0088857_21_1163 339
211 3300047469 Ga0495673_0021210 Ga0495673_0021210_777_1796 339
212 3300048921 Ga0496118_0043901 Ga0496118_0043901_965_2035 339
213 3300048925 Ga0496122_0000185 Ga0496122_0000185_95952_96980 339
214 3300048925 Ga0496122_0208721 Ga0496122_0208721_47_1066 339
215 3300048926 Ga0496123_0000105 Ga0496123_0000105_47237_48265 339
216 3300048927 Ga0496124_0163419 Ga0496124_0163419_323_1351 339
217 3300048928 Ga0496125_0002513 Ga0496125_0002513_5253_6275 339
218 3300050493 nmdc:mga0k408_162235_c1 nmdc:mga0k408_162235_c1_138_1157 339
219 3300053156 Ga0500622_0009486 Ga0500622_0009486_2993_4039 339
220 3300053177 Ga0500636_0019919 Ga0500636_0019919_2454_3473 339
221 iso_pu_bacteria 2643221577 2643894784 339
222 iso_pu_bacteria 2818991457 2819661466 339
223 iso_pu_bacteria 2852684882 2852687333 339
224 iso_pu_bacteria 2993480792 2993480815 339
225 3300006028 Ga0070717_10071023 Ga0070717_100710233 340
226 3300046507 Ga0495606_0001435 Ga0495606_0001435_1140_2162 340
227 3300005327 Ga0070658_10129282 Ga0070658_101292823 341
228 3300006048 Ga0075363_100061844 Ga0075363_1000618442 341
229 3300013105 Ga0157369_10533978 Ga0157369_105339781 341
230 3300025909 Ga0207705_10206450 Ga0207705_102064501 341
231 3300025949 Ga0207667_10187855 Ga0207667_101878552 341
232 3300026041 Ga0207639_10135473 Ga0207639_101354732 341
233 3300050495 nmdc:mga04h51_35831_c1 nmdc:mga04h51_35831_c1_356_1387 341
234 3300002704 JGI25155J39150_1000096 JGI25155J39150_100009644 342
235 3300002705 JGI25156J39149_1002307 JGI25156J39149_10023074 342
236 3300002738 JGI25154J39366_1000146 JGI25154J39366_100014647 342
237 3300002772 JGI25164J39214_1002397 JGI25164J39214_10023973 342
238 3300025206 Ga0209435_100057 Ga0209435_10005775 342
239 3300025231 Ga0207427_100212 Ga0207427_10021225 342
240 3300025246 Ga0209646_1000061 Ga0209646_1000061229 342
241 3300025250 Ga0209026_1003637 Ga0209026_10036376 342
242 3300025256 Ga0209759_1000371 Ga0209759_10003714 342
243 3300025913 Ga0207695_10009159 Ga0207695_1000915910 342
244 3300025949 Ga0207667_10000115 Ga0207667_1000011528 342
245 3300027312 Ga0209371_1002085 Ga0209371_10020853 342
246 3300030500 Ga0268256_1001836 Ga0268256_10018363 342
247 3300049572 Ga0501036_0018961 Ga0501036_0018961_1124_2152 342
248 3300049573 Ga0501037_0098463 Ga0501037_0098463_496_1524 342
249 3300049579 Ga0501043_0072629 Ga0501043_0072629_966_1994 342
250 3300049581 Ga0501047_0001038 Ga0501047_0001038_4261_5289 342
251 3300049823 Ga0501044_0258835 Ga0501044_0258835_202_1230 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

256

377

0.84

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

72

170

0.83

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

225

343

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.9009 5 339
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.8972 2 339
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8954 5 339
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.8793 3 338
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.8768 3 338
ID Description Score Start End Superfamily
4a27B01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9312 5 137 3.90.180.10
af_A0A0P0W8W7_12_109_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9266 21 128 3.90.180.10
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9243 6 146 3.90.180.10
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9235 6 133 3.90.180.10
af_A0A0P0W8W7_12_109_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9176 21 128 3.90.180.10
ID Description Score Start End GO Terms
AF-B6A117-F1-model_v4 deleted 0.9959 6 339
AF-B6A117-F1-model_v4 deleted 0.9929 6 339
AF-A0A8B4TPP6-F1-model_v4 Bifunctional zinc-containing alcohol dehydrogenase/quinone oxidoreductase (EC 1.6.5.5) 0.9902 1 325 GO:0008270
GO:0016491
AF-A0A4Q5QYW0-F1-model_v4 NADP-dependent oxidoreductase 0.9891 43 338 GO:0008270
GO:0016491
AF-A0A7Y2W8E6-F1-model_v4 NADP-dependent oxidoreductase 0.9867 67 339 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.21 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map