F362559

General Info

Members Datasets Scaffolds Average Seq Length
251 149 240 453

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0039493|Ga0316584_0039493_1137_2639
Length 500
Sequence MTKRLLTQTLSTILYSVLLSVSITFLITACGKKPEPAAPSXXXXSDANQTAGTQGEHISSDPQTHTHEYRLDNGLKLIIREDHRAPVVVSQVWYKAGSSYEQNGTTGVAHVLEHMMFKGTDKYGPNEFSKVIAANGGRENAFTGQDYTAYFQQLEKSRLHISFEMEADRMQNLNLSGEEFGKEIQVVMEERRMRTDDKPESLTYEQFLATAFVNSPYHHPIIGWMNDLQNMTVEDAQAWYSHYYAPNNATLVVVGDVDPEQVFQLAQKYYGKVPTRDIPPLKPQREIAQNGIKRITVKAPAQLPYMVMGYKVPVVKTGEVDWEPYALEMLAHVLDGGDSARFTKNLVRGQQVAQSIGTSYDLYARLDELFTVVGTPAQAKSVQDLESAIRAQIQQVKDELVTEEELQRIKAQVVASKVYEKDSVFYQAMQIGTLETVGLDWRLSDQYVDKIRAITPEQIQQVARKYLVDERLTVAVLDPQPLNNIAKNNMANAHGGNYAH

Samples

Sample ID Description Type Environment
1 2511231012 Pseudomonas sp. GM33 Isolate Nodule
2 2511231014 Pseudomonas sp. GM48 Isolate Nodule
3 2511231015 Pseudomonas sp. GM49 Isolate Nodule
4 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
7 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
8 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
9 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
10 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
11 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
82 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
88 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
92 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
93 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
94 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
95 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
104 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
105 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
106 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
107 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
108 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
109 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
110 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
111 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
112 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
119 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
149 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.86
Metatranscriptomes 10.76
Isolates 4.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.57
Nodule 1.99
Rhizoplane 0
Rhizosphere 76.89
Stem 0
Stem Tuber 0
Unclassified 13.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000038 3300003751 Bacteria 186588
2 Ga0055539_1000049 3300003752 Bacteria 186588
3 Ga0055533_1000060 3300003756 Bacteria 186588
4 Ga0055525_1000068 3300003759 Bacteria 186588
5 Ga0055541_1000036 3300003841 Bacteria 186588
6 Ga0065714_10068011 3300005288 Bacteria 5035
7 Ga0070680_100133874 3300005336 Bacteria 2075
8 Ga0070689_100002214 3300005340 Bacteria 12599
9 Ga0070701_10000692 3300005438 Bacteria 11934
10 Ga0070705_100028651 3300005440 Bacteria 3052
11 Ga0070700_100000380 3300005441 Bacteria 22788
12 Ga0070678_100063154 3300005456 Bacteria 2739
13 Ga0070681_10083755 3300005458 Bacteria 3142
14 Ga0068853_100123353 3300005539 Bacteria 2313
15 Ga0070686_100000276 3300005544 Bacteria 35087
16 Ga0070693_100003562 3300005547 Bacteria 7266
17 Ga0070704_100032788 3300005549 Bacteria 3507
18 Ga0068855_100000702 3300005563 Bacteria 40994
19 Ga0068855_100240959 3300005563 Bacteria 2021
20 Ga0070702_100000127 3300005615 Bacteria 23222
21 Ga0068866_10000297 3300005718 Bacteria 23691
22 Ga0068861_100001043 3300005719 Bacteria 17016
23 Ga0068858_100000442 3300005842 Bacteria 43385
24 Ga0068862_100034397 3300005844 Bacteria 4287
25 Ga0075364_10073986 3300006051 Bacteria 2246
26 Ga0075432_10006979 3300006058 Bacteria 3847
27 Ga0075432_10009965 3300006058 Bacteria 3228
28 Ga0075362_10008981 3300006177 Bacteria 3844
29 Ga0075369_10005376 3300006186 Bacteria 4782
30 Ga0097621_100012622 3300006237 Bacteria 6270
31 Ga0068871_100007811 3300006358 Bacteria 7661
32 Ga0068865_100000225 3300006881 Bacteria 31327
33 Ga0079104_1000158 3300006946 Bacteria 96620
34 Ga0105244_10013693 3300009036 Bacteria 4725
35 Ga0105244_10049516 3300009036 Bacteria 2146
36 Ga0105250_10012400 3300009092 Bacteria 3519
37 Ga0105250_10015636 3300009092 Bacteria 3106
38 Ga0105243_10000328 3300009148 Bacteria 52003
39 Ga0105243_10010160 3300009148 Bacteria 7156
40 Ga0105238_10000037 3300009551 Bacteria 163954
41 Ga0105249_10007353 3300009553 Bacteria 9601
42 Ga0105239_10008926 3300010375 Bacteria 11342
43 Ga0157378_10000585 3300013297 Bacteria 34248
44 Ga0163162_10045160 3300013306 Bacteria 4414
45 Ga0157380_10008799 3300014326 Bacteria 7214
46 Ga0182008_10004029 3300014497 Bacteria 8670
47 Ga0182008_10005646 3300014497 Bacteria 7087
48 Ga0182006_1000756 3300015261 Bacteria 22100
49 Ga0182006_1004568 3300015261 Bacteria 6805
50 Ga0163161_10091911 3300017792 Bacteria 2246
51 Ga0163161_10164629 3300017792 Bacteria 1692
52 Ga0209784_100021 3300025224 Bacteria 408534
53 Ga0209566_100039 3300025225 Bacteria 303368
54 Ga0209674_100036 3300025226 Bacteria 408534
55 Ga0209563_100040 3300025230 Bacteria 408534
56 Ga0209677_100023 3300025253 Bacteria 408534
57 Ga0209676_1002552 3300025292 Bacteria 12636
58 Ga0209050_1000913 3300025298 Bacteria 39020
59 Ga0209051_1007325 3300025303 Bacteria 6052
60 Ga0207655_1012031 3300025728 Bacteria 5096
61 Ga0207655_1025937 3300025728 Bacteria 2828
62 Ga0207713_1004196 3300025735 Bacteria 9449
63 Ga0207642_10002758 3300025899 Bacteria 5482
64 Ga0207671_10009894 3300025914 Bacteria 7926
65 Ga0207694_10000054 3300025924 Bacteria 152124
66 Ga0207687_10001812 3300025927 Bacteria 14698
67 Ga0207686_10000376 3300025934 Bacteria 31107
68 Ga0207709_10004038 3300025935 Bacteria 8548
69 Ga0207709_10033777 3300025935 Bacteria 3008
70 Ga0207704_10002422 3300025938 Bacteria 8390
71 Ga0207689_10000877 3300025942 Bacteria 28952
72 Ga0207667_10000043 3300025949 Bacteria 261426
73 Ga0207667_10094159 3300025949 Bacteria 3093
74 Ga0207703_10004284 3300026035 Bacteria 11738
75 Ga0207639_10041857 3300026041 Bacteria 3431
76 Ga0207678_10211584 3300026067 Bacteria 1659
77 Ga0207708_10000281 3300026075 Bacteria 39935
78 Ga0207648_10000121 3300026089 Bacteria 76270
79 Ga0207675_100000143 3300026118 Bacteria 61743
80 Ga0207683_10012275 3300026121 Bacteria 7312
81 Ga0209281_1000016 3300027111 Bacteria 588107
82 Ga0209999_1003228 3300027543 Bacteria 2910
83 Ga0209971_1002907 3300027682 Bacteria 4092
84 Ga0207428_10035578 3300027907 Bacteria 4070
85 Ga0207428_10061251 3300027907 Bacteria 2980
86 Ga0265327_10000915 3300031251 Bacteria 43244
87 Ga0265327_10001464 3300031251 Bacteria 29600
88 Ga0265316_10000264 3300031344 Bacteria 59436
89 Ga0316575_10000124 3300031665 Bacteria 19543
90 Ga0316575_10013745 3300031665 Bacteria 3028
91 Ga0316575_10019433 3300031665 Bacteria 2598
92 Ga0316575_10024883 3300031665 Bacteria 2319
93 Ga0316579_10000052 3300031691 Bacteria 27901
94 Ga0316579_10000563 3300031691 Bacteria 12385
95 Ga0316579_10003515 3300031691 Bacteria 6127
96 Ga0316579_10005889 3300031691 Bacteria 4971
97 Ga0316579_10013683 3300031691 Bacteria 3493
98 Ga0316579_10073748 3300031691 Bacteria 1619
99 Ga0316576_10000412 3300031727 Bacteria 19713
100 Ga0316576_10006436 3300031727 Bacteria 7312
101 Ga0316576_10036238 3300031727 Bacteria 3526
102 Ga0316576_10092202 3300031727 Bacteria 2257
103 Ga0316578_10001282 3300031728 Bacteria 10055
104 Ga0316578_10004454 3300031728 Bacteria 6620
105 Ga0316578_10006586 3300031728 Bacteria 5748
106 Ga0316578_10014083 3300031728 Bacteria 4260
107 Ga0316578_10018442 3300031728 Bacteria 3825
108 Ga0316577_10000558 3300031733 Bacteria 15172
109 Ga0316577_10001497 3300031733 Bacteria 11070
110 Ga0316577_10052420 3300031733 Bacteria 2276
111 Ga0316583_10000610 3300032133 Bacteria 10896
112 Ga0316583_10000969 3300032133 Bacteria 9247
113 Ga0316583_10009854 3300032133 Bacteria 3443
114 Ga0316585_10000237 3300032137 Bacteria 11669
115 Ga0316585_10004076 3300032137 Bacteria 4054
116 Ga0316580_10000076 3300032139 Bacteria 17100
117 Ga0316580_10000470 3300032139 Bacteria 9309
118 Ga0316580_10010483 3300032139 Bacteria 2803
119 Ga0316580_10027457 3300032139 Bacteria 1759
120 Ga0316593_10000567 3300032168 Bacteria 6956
121 Ga0316593_10002071 3300032168 Bacteria 4648
122 Ga0316593_10004169 3300032168 Bacteria 3679
123 Ga0316593_10005246 3300032168 Bacteria 3400
124 Ga0316593_10005724 3300032168 Bacteria 3306
125 Ga0316593_10006440 3300032168 Bacteria 3168
126 Ga0316593_10010869 3300032168 Bacteria 2627
127 Ga0316593_10012996 3300032168 Bacteria 2456
128 Ga0316593_10029736 3300032168 Bacteria 1769
129 Ga0316593_10041631 3300032168 Bacteria 1529
130 Ga0316592_1000184 3300033524 Bacteria 7406
131 Ga0316592_1000430 3300033524 Bacteria 5712
132 Ga0316592_1000770 3300033524 Bacteria 4761
133 Ga0316592_1001665 3300033524 Bacteria 3665
134 Ga0316592_1008814 3300033524 Bacteria 2005
135 Ga0316592_1016911 3300033524 Bacteria 1528
136 Ga0316588_1000172 3300033528 Bacteria 7249
137 Ga0316588_1002076 3300033528 Bacteria 3433
138 Ga0316587_1000928 3300033529 Bacteria 3349
139 Ga0316587_1000996 3300033529 Bacteria 3271
140 Ga0316587_1001288 3300033529 Bacteria 3037
141 Ga0316587_1001302 3300033529 Bacteria 3031
142 Ga0316587_1004145 3300033529 Bacteria 2088
143 Ga0316596_1001067 3300033541 Bacteria 5319
144 Ga0316596_1003204 3300033541 Bacteria 3564
145 Ga0316596_1004288 3300033541 Bacteria 3189
146 Ga0316596_1005281 3300033541 Bacteria 2946
147 Ga0316574_0003504 3300035398 Bacteria 8098
148 Ga0316574_0015542 3300035398 Bacteria 4418
149 Ga0316574_0024497 3300035398 Bacteria 3612
150 Ga0316574_0064610 3300035398 Bacteria 2303
151 Ga0316582_0000060 3300036647 Bacteria 27489
152 Ga0316582_0002016 3300036647 Bacteria 9326
153 Ga0316582_0002443 3300036647 Bacteria 8735
154 Ga0316582_0003103 3300036647 Bacteria 8042
155 Ga0316582_0010165 3300036647 Bacteria 5142
156 Ga0316582_0012380 3300036647 Bacteria 4758
157 Ga0316582_0041933 3300036647 Bacteria 2864
158 Ga0316582_0114263 3300036647 Bacteria 1800
159 Ga0316584_0005611 3300036712 Bacteria 8447
160 Ga0316584_0007166 3300036712 Bacteria 7603
161 Ga0316584_0007411 3300036712 Bacteria 7499
162 Ga0316584_0029224 3300036712 Bacteria 4068
163 Ga0316584_0029648 3300036712 Bacteria 4039
164 Ga0316584_0036343 3300036712 Bacteria 3655
165 Ga0316584_0039493 3300036712 Bacteria 3513
166 Ga0316581_0000667 3300037588 Bacteria 6938
167 Ga0316581_0001138 3300037588 Bacteria 5802
168 Ga0400484_15786 3300038725 Bacteria 3046
169 Ga0400484_27271 3300038725 Bacteria 18600
170 Ga0400484_42730 3300038725 Bacteria 39745
171 Ga0400490_19219 3300038726 Bacteria 23609
172 Ga0400490_39921 3300038726 Bacteria 14830
173 Ga0400490_47428 3300038726 Bacteria 16823
174 Ga0400491_20256 3300038727 Bacteria 8514
175 Ga0400485_14891 3300038735 Bacteria 46169
176 Ga0400485_15602 3300038735 Bacteria 2768
177 Ga0400485_20001 3300038735 Bacteria 16027
178 Ga0400488_07398 3300038741 Bacteria 5483
179 Ga0400488_27231 3300038741 Bacteria 8039
180 Ga0400486_00236 3300038742 Bacteria 13699
181 Ga0400486_18673 3300038742 Bacteria 17661
182 Ga0400486_24621 3300038742 Bacteria 19534
183 Ga0400486_24999 3300038742 Bacteria 33040
184 Ga0400483_025407 3300039062 Bacteria 15056
185 Ga0400483_210603 3300039062 Bacteria 7548
186 Ga0400483_230910 3300039062 Bacteria 7672
187 Ga0400483_256973 3300039062 Bacteria 8571
188 Ga0400487_21430 3300039110 Bacteria 187786
189 Ga0400487_23433 3300039110 Bacteria 4769
190 Ga0400487_34165 3300039110 Bacteria 27871
191 Ga0400487_66353 3300039110 Bacteria 11859
192 Ga0439438_003199 3300041405 Bacteria 6700
193 Ga0439438_013007 3300041405 Bacteria 2528
194 Ga0439466_0004874 3300041411 Bacteria 5160
195 Ga0439452_000758 3300042010 Bacteria 15471
196 Ga0453684_0001932 3300044712 Bacteria 53485
197 Ga0453684_0002102 3300044712 Bacteria 50310
198 Ga0495617_000838 3300046452 Bacteria 14639
199 Ga0495617_006224 3300046452 Bacteria 4199
200 Ga0495603_0112413 3300046455 Bacteria 1588
201 Ga0495590_0000551 3300046457 Bacteria 17897
202 Ga0495591_009064 3300046458 Bacteria 3994
203 Ga0495638_0003893 3300046460 Bacteria 11556
204 Ga0495638_0010063 3300046460 Bacteria 6592
205 Ga0495605_0008116 3300046474 Bacteria 5937
206 Ga0495585_0016747 3300046492 Bacteria 4246
207 Ga0495610_0015256 3300046512 Bacteria 4472
208 Ga0495610_0018924 3300046512 Bacteria 3871
209 Ga0495648_0006448 3300046524 Bacteria 9575
210 Ga0495648_0011759 3300046524 Bacteria 6568
211 Ga0495648_0036155 3300046524 Bacteria 3191
212 Ga0495642_0000610 3300046528 Bacteria 17996
213 Ga0495654_0004561 3300046530 Bacteria 8191
214 Ga0495654_0051653 3300046530 Bacteria 2005
215 Ga0495609_0016348 3300046538 Bacteria 3457
216 Ga0495668_0002806 3300046616 Bacteria 13867
217 Ga0495588_0025206 3300046674 Bacteria 2961
218 Ga0495669_0010655 3300046684 Bacteria 3889
219 Ga0495670_0002354 3300046691 Bacteria 9301
220 Ga0495671_0006566 3300046692 Bacteria 6706
221 Ga0495649_0003269 3300046694 Bacteria 11042
222 Ga0495589_0013823 3300046794 Bacteria 4163
223 Ga0495660_0037267 3300046810 Bacteria 2709
224 Ga0495672_0002450 3300047320 Bacteria 17080
225 Ga0495672_0009480 3300047320 Bacteria 7051
226 Ga0495687_004110 3300047443 Bacteria 10066
227 Ga0495673_0007329 3300047469 Bacteria 6362
228 Ga0495681_0002101 3300047470 Bacteria 14485
229 Ga0495626_0002292 3300048091 Bacteria 13558
230 Ga0495626_0015902 3300048091 Bacteria 3839
231 Ga0496117_0008259 3300048920 Bacteria 9917
232 Ga0496118_0014092 3300048921 Bacteria 7502
233 Ga0496124_0042419 3300048927 Bacteria 3918
234 Ga0501070_0022445 3300049586 Bacteria 5286
235 Ga0501070_0038870 3300049586 Bacteria 3970
236 Ga0501035_0167090 3300049822 Bacteria 1902
237 nmdc:mga00v17_63361_c1 3300050491 Bacteria 2277
238 nmdc:mga08x19_38964_c1 3300050514 Bacteria 3019
239 nmdc:mga0sz30_6713_c1 3300050516 Bacteria 4287
240 Ga0500618_001375 3300053125 Bacteria 11031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046455 Ga0495603_0112413 Ga0495603_0112413_432_1550 335
2 3300041405 Ga0439438_003199 Ga0439438_003199_3389_4615 371
3 3300032168 Ga0316593_10004169 Ga0316593_100041691 391
4 3300038741 Ga0400488_07398 Ga0400488_07398_3804_5165 394
5 3300039110 Ga0400487_66353 Ga0400487_66353_3702_5063 394
6 3300050516 nmdc:mga0sz30_6713_c1 nmdc:mga0sz30_6713_c1_824_2170 401
7 3300026067 Ga0207678_10211584 Ga0207678_102115841 403
8 3300038735 Ga0400485_14891 Ga0400485_14891_8842_10164 407
9 3300038742 Ga0400486_24999 Ga0400486_24999_8852_10174 407
10 3300039110 Ga0400487_21430 Ga0400487_21430_8747_10069 407
11 iso_pu_bacteria 2511231012 2511302196 407
12 iso_pu_bacteria 2511231014 2511314496 407
13 iso_pu_bacteria 2511231015 2511318662 407
14 iso_pu_bacteria 2643221565 2643842892 407
15 iso_pu_bacteria 2643221589 2643955706 407
16 iso_pu_bacteria 2643221602 2644020500 407
17 iso_pu_bacteria 2738543004 2739198984 407
18 iso_pu_bacteria 2738543015 2739258927 407
19 3300044712 Ga0453684_0002102 Ga0453684_0002102_35348_36694 409
20 3300041411 Ga0439466_0004874 Ga0439466_0004874_2070_3416 410
21 3300005288 Ga0065714_10068011 Ga0065714_100680111 411
22 3300006051 Ga0075364_10073986 Ga0075364_100739863 411
23 3300006058 Ga0075432_10006979 Ga0075432_100069792 411
24 3300006058 Ga0075432_10009965 Ga0075432_100099652 411
25 3300006177 Ga0075362_10008981 Ga0075362_100089813 411
26 3300006186 Ga0075369_10005376 Ga0075369_100053763 411
27 3300006946 Ga0079104_1000158 Ga0079104_100015811 411
28 3300009036 Ga0105244_10013693 Ga0105244_100136934 411
29 3300009036 Ga0105244_10049516 Ga0105244_100495162 411
30 3300009092 Ga0105250_10012400 Ga0105250_100124001 411
31 3300009092 Ga0105250_10015636 Ga0105250_100156362 411
32 3300009148 Ga0105243_10010160 Ga0105243_100101603 411
33 3300014497 Ga0182008_10004029 Ga0182008_100040294 411
34 3300014497 Ga0182008_10005646 Ga0182008_100056463 411
35 3300015261 Ga0182006_1004568 Ga0182006_10045681 411
36 3300017792 Ga0163161_10091911 Ga0163161_100919112 411
37 3300017792 Ga0163161_10164629 Ga0163161_101646292 411
38 3300025292 Ga0209676_1002552 Ga0209676_10025525 411
39 3300025298 Ga0209050_1000913 Ga0209050_100091311 411
40 3300025303 Ga0209051_1007325 Ga0209051_10073254 411
41 3300025728 Ga0207655_1012031 Ga0207655_10120312 411
42 3300025728 Ga0207655_1025937 Ga0207655_10259372 411
43 3300025735 Ga0207713_1004196 Ga0207713_10041962 411
44 3300025935 Ga0207709_10033777 Ga0207709_100337772 411
45 3300027111 Ga0209281_1000016 Ga0209281_1000016242 411
46 3300027907 Ga0207428_10035578 Ga0207428_100355783 411
47 3300027907 Ga0207428_10061251 Ga0207428_100612512 411
48 3300032168 Ga0316593_10012996 Ga0316593_100129962 411
49 3300038725 Ga0400484_42730 Ga0400484_42730_30100_31437 411
50 3300041405 Ga0439438_013007 Ga0439438_013007_627_1976 411
51 3300042010 Ga0439452_000758 Ga0439452_000758_8938_10287 411
52 3300046452 Ga0495617_000838 Ga0495617_000838_3508_4854 411
53 3300046452 Ga0495617_006224 Ga0495617_006224_540_1886 411
54 3300046457 Ga0495590_0000551 Ga0495590_0000551_15814_17160 411
55 3300046458 Ga0495591_009064 Ga0495591_009064_2192_3538 411
56 3300046460 Ga0495638_0003893 Ga0495638_0003893_5165_6511 411
57 3300046460 Ga0495638_0010063 Ga0495638_0010063_4552_5898 411
58 3300046474 Ga0495605_0008116 Ga0495605_0008116_2806_4152 411
59 3300046492 Ga0495585_0016747 Ga0495585_0016747_2822_4168 411
60 3300046512 Ga0495610_0015256 Ga0495610_0015256_2385_3731 411
61 3300046512 Ga0495610_0018924 Ga0495610_0018924_1970_3316 411
62 3300046524 Ga0495648_0006448 Ga0495648_0006448_3112_4458 411
63 3300046524 Ga0495648_0011759 Ga0495648_0011759_4680_6026 411
64 3300046524 Ga0495648_0036155 Ga0495648_0036155_344_1690 411
65 3300046528 Ga0495642_0000610 Ga0495642_0000610_5230_6576 411
66 3300046530 Ga0495654_0004561 Ga0495654_0004561_640_1986 411
67 3300046530 Ga0495654_0051653 Ga0495654_0051653_209_1555 411
68 3300046538 Ga0495609_0016348 Ga0495609_0016348_183_1529 411
69 3300046616 Ga0495668_0002806 Ga0495668_0002806_12127_13473 411
70 3300046674 Ga0495588_0025206 Ga0495588_0025206_618_1964 411
71 3300046684 Ga0495669_0010655 Ga0495669_0010655_1743_3089 411
72 3300046691 Ga0495670_0002354 Ga0495670_0002354_473_1819 411
73 3300046692 Ga0495671_0006566 Ga0495671_0006566_503_1849 411
74 3300046694 Ga0495649_0003269 Ga0495649_0003269_3194_4540 411
75 3300046794 Ga0495589_0013823 Ga0495589_0013823_2164_3510 411
76 3300046810 Ga0495660_0037267 Ga0495660_0037267_56_1402 411
77 3300047320 Ga0495672_0002450 Ga0495672_0002450_10577_11923 411
78 3300047320 Ga0495672_0009480 Ga0495672_0009480_4958_6304 411
79 3300047443 Ga0495687_004110 Ga0495687_004110_4706_6052 411
80 3300047469 Ga0495673_0007329 Ga0495673_0007329_585_1931 411
81 3300047470 Ga0495681_0002101 Ga0495681_0002101_3957_5303 411
82 3300048091 Ga0495626_0002292 Ga0495626_0002292_9051_10397 411
83 3300048091 Ga0495626_0015902 Ga0495626_0015902_416_1762 411
84 3300048920 Ga0496117_0008259 Ga0496117_0008259_4970_6316 411
85 3300048921 Ga0496118_0014092 Ga0496118_0014092_140_1486 411
86 3300048927 Ga0496124_0042419 Ga0496124_0042419_1094_2440 411
87 3300050491 nmdc:mga00v17_63361_c1 nmdc:mga00v17_63361_c1_525_1871 411
88 3300050514 nmdc:mga08x19_38964_c1 nmdc:mga08x19_38964_c1_384_1730 411
89 3300031691 Ga0316579_10073748 Ga0316579_100737481 412
90 3300031733 Ga0316577_10052420 Ga0316577_100524202 412
91 3300032133 Ga0316583_10000969 Ga0316583_100009699 412
92 3300032139 Ga0316580_10027457 Ga0316580_100274572 412
93 3300033529 Ga0316587_1001302 Ga0316587_10013023 412
94 3300033541 Ga0316596_1004288 Ga0316596_10042883 412
95 3300035398 Ga0316574_0024497 Ga0316574_0024497_1986_3344 412
96 3300036647 Ga0316582_0002016 Ga0316582_0002016_5767_7125 412
97 3300036712 Ga0316584_0007411 Ga0316584_0007411_3534_4892 412
98 3300038725 Ga0400484_27271 Ga0400484_27271_7795_9135 412
99 3300039062 Ga0400483_256973 Ga0400483_256973_2491_3864 412
100 3300005458 Ga0070681_10083755 Ga0070681_100837552 414
101 3300038741 Ga0400488_27231 Ga0400488_27231_4255_5604 414
102 3300038726 Ga0400490_19219 Ga0400490_19219_18193_19545 415
103 3300038727 Ga0400491_20256 Ga0400491_20256_3238_4587 415
104 3300039062 Ga0400483_210603 Ga0400483_210603_5135_6487 415
105 3300005563 Ga0068855_100000702 Ga0068855_10000070227 417
106 3300025949 Ga0207667_10000043 Ga0207667_1000004380 417
107 3300038742 Ga0400486_00236 Ga0400486_00236_6295_7656 418
108 3300031691 Ga0316579_10013683 Ga0316579_100136831 419
109 3300031727 Ga0316576_10092202 Ga0316576_100922022 419
110 3300031728 Ga0316578_10004454 Ga0316578_100044541 419
111 3300032168 Ga0316593_10005724 Ga0316593_100057242 419
112 3300033524 Ga0316592_1001665 Ga0316592_10016653 419
113 3300033528 Ga0316588_1002076 Ga0316588_10020763 419
114 3300033529 Ga0316587_1004145 Ga0316587_10041452 419
115 3300033541 Ga0316596_1001067 Ga0316596_10010676 419
116 3300035398 Ga0316574_0015542 Ga0316574_0015542_2132_3496 419
117 3300036647 Ga0316582_0041933 Ga0316582_0041933_208_1584 419
118 3300036712 Ga0316584_0029648 Ga0316584_0029648_1650_3026 419
119 3300038725 Ga0400484_15786 Ga0400484_15786_778_2142 419
120 3300038726 Ga0400490_39921 Ga0400490_39921_4372_5736 419
121 3300038726 Ga0400490_47428 Ga0400490_47428_9040_10404 419
122 3300038735 Ga0400485_20001 Ga0400485_20001_8770_10134 419
123 3300038742 Ga0400486_18673 Ga0400486_18673_6481_7845 419
124 3300038742 Ga0400486_24621 Ga0400486_24621_7152_8516 419
125 3300039062 Ga0400483_025407 Ga0400483_025407_1568_2932 419
126 3300039062 Ga0400483_230910 Ga0400483_230910_164_1528 419
127 3300039110 Ga0400487_23433 Ga0400487_23433_584_1948 419
128 3300031665 Ga0316575_10019433 Ga0316575_100194332 420
129 3300031728 Ga0316578_10014083 Ga0316578_100140833 420
130 3300031728 Ga0316578_10018442 Ga0316578_100184423 420
131 3300032139 Ga0316580_10010483 Ga0316580_100104832 420
132 3300032168 Ga0316593_10000567 Ga0316593_100005678 420
133 3300032168 Ga0316593_10010869 Ga0316593_100108692 420
134 3300033524 Ga0316592_1000770 Ga0316592_10007701 420
135 3300033524 Ga0316592_1008814 Ga0316592_10088142 420
136 3300033529 Ga0316587_1000928 Ga0316587_10009281 420
137 3300036647 Ga0316582_0012380 Ga0316582_0012380_1268_2644 420
138 3300036712 Ga0316584_0036343 Ga0316584_0036343_46_1422 420
139 3300044712 Ga0453684_0001932 Ga0453684_0001932_33940_35313 420
140 3300005336 Ga0070680_100133874 Ga0070680_1001338742 421
141 3300005340 Ga0070689_100002214 Ga0070689_1000022142 421
142 3300005438 Ga0070701_10000692 Ga0070701_100006923 421
143 3300005440 Ga0070705_100028651 Ga0070705_1000286512 421
144 3300005441 Ga0070700_100000380 Ga0070700_1000003805 421
145 3300005456 Ga0070678_100063154 Ga0070678_1000631542 421
146 3300005539 Ga0068853_100123353 Ga0068853_1001233532 421
147 3300005544 Ga0070686_100000276 Ga0070686_1000002765 421
148 3300005547 Ga0070693_100003562 Ga0070693_1000035625 421
149 3300005549 Ga0070704_100032788 Ga0070704_1000327882 421
150 3300005563 Ga0068855_100240959 Ga0068855_1002409592 421
151 3300005615 Ga0070702_100000127 Ga0070702_10000012714 421
152 3300005718 Ga0068866_10000297 Ga0068866_1000029723 421
153 3300005719 Ga0068861_100001043 Ga0068861_1000010432 421
154 3300005842 Ga0068858_100000442 Ga0068858_10000044246 421
155 3300005844 Ga0068862_100034397 Ga0068862_1000343975 421
156 3300006237 Ga0097621_100012622 Ga0097621_1000126228 421
157 3300006358 Ga0068871_100007811 Ga0068871_1000078113 421
158 3300006881 Ga0068865_100000225 Ga0068865_10000022529 421
159 3300009148 Ga0105243_10000328 Ga0105243_1000032838 421
160 3300009553 Ga0105249_10007353 Ga0105249_100073532 421
161 3300013297 Ga0157378_10000585 Ga0157378_1000058511 421
162 3300013306 Ga0163162_10045160 Ga0163162_100451605 421
163 3300014326 Ga0157380_10008799 Ga0157380_100087992 421
164 3300025899 Ga0207642_10002758 Ga0207642_100027582 421
165 3300025927 Ga0207687_10001812 Ga0207687_1000181213 421
166 3300025934 Ga0207686_10000376 Ga0207686_1000037624 421
167 3300025935 Ga0207709_10004038 Ga0207709_100040388 421
168 3300025938 Ga0207704_10002422 Ga0207704_100024223 421
169 3300025942 Ga0207689_10000877 Ga0207689_1000087724 421
170 3300026035 Ga0207703_10004284 Ga0207703_100042843 421
171 3300026041 Ga0207639_10041857 Ga0207639_100418572 421
172 3300026075 Ga0207708_10000281 Ga0207708_100002818 421
173 3300026089 Ga0207648_10000121 Ga0207648_1000012151 421
174 3300026118 Ga0207675_100000143 Ga0207675_10000014318 421
175 3300026121 Ga0207683_10012275 Ga0207683_100122752 421
176 3300032168 Ga0316593_10006440 Ga0316593_100064402 421
177 3300036647 Ga0316582_0010165 Ga0316582_0010165_652_2031 421
178 3300037588 Ga0316581_0000667 Ga0316581_0000667_2672_4051 421
179 3300038735 Ga0400485_15602 Ga0400485_15602_556_1929 421
180 3300039110 Ga0400487_34165 Ga0400487_34165_14942_16330 421
181 3300009551 Ga0105238_10000037 Ga0105238_1000003775 422
182 3300010375 Ga0105239_10008926 Ga0105239_1000892611 422
183 3300015261 Ga0182006_1000756 Ga0182006_100075619 422
184 3300025914 Ga0207671_10009894 Ga0207671_100098941 422
185 3300025924 Ga0207694_10000054 Ga0207694_1000005476 422
186 3300025949 Ga0207667_10094159 Ga0207667_100941592 422
187 3300031251 Ga0265327_10000915 Ga0265327_1000091538 422
188 3300031251 Ga0265327_10001464 Ga0265327_1000146420 422
189 3300031344 Ga0265316_10000264 Ga0265316_1000026431 422
190 3300031691 Ga0316579_10003515 Ga0316579_100035152 422
191 3300032168 Ga0316593_10005246 Ga0316593_100052461 422
192 3300036647 Ga0316582_0114263 Ga0316582_0114263_184_1566 422
193 3300036712 Ga0316584_0029224 Ga0316584_0029224_1448_2830 422
194 3300037588 Ga0316581_0001138 Ga0316581_0001138_3492_4874 422
195 3300053125 Ga0500618_001375 Ga0500618_001375_8353_9720 422
196 iso_pu_bacteria 2521172590 2521560119 422
197 iso_pu_bacteria 2551306416 2553004905 422
198 iso_pu_bacteria 2818991449 2819616473 422
199 3300032168 Ga0316593_10041631 Ga0316593_100416311 423
200 3300033524 Ga0316592_1016911 Ga0316592_10169111 423
201 3300035398 Ga0316574_0064610 Ga0316574_0064610_362_1810 423
202 3300049586 Ga0501070_0038870 Ga0501070_0038870_2568_3947 423
203 3300031665 Ga0316575_10000124 Ga0316575_100001249 424
204 3300031691 Ga0316579_10000052 Ga0316579_100000529 424
205 3300031691 Ga0316579_10005889 Ga0316579_100058894 424
206 3300031727 Ga0316576_10000412 Ga0316576_1000041217 424
207 3300031728 Ga0316578_10006586 Ga0316578_100065863 424
208 3300031733 Ga0316577_10000558 Ga0316577_1000055815 424
209 3300032133 Ga0316583_10000610 Ga0316583_100006109 424
210 3300032137 Ga0316585_10004076 Ga0316585_100040762 424
211 3300032139 Ga0316580_10000076 Ga0316580_100000764 424
212 3300032168 Ga0316593_10002071 Ga0316593_100020711 424
213 3300033524 Ga0316592_1000184 Ga0316592_10001841 424
214 3300033528 Ga0316588_1000172 Ga0316588_10001723 424
215 3300033529 Ga0316587_1000996 Ga0316587_10009961 424
216 3300033541 Ga0316596_1005281 Ga0316596_10052811 424
217 3300035398 Ga0316574_0003504 Ga0316574_0003504_3464_4852 424
218 3300036647 Ga0316582_0003103 Ga0316582_0003103_5134_6522 424
219 3300036712 Ga0316584_0005611 Ga0316584_0005611_5375_6763 424
220 3300049822 Ga0501035_0167090 Ga0501035_0167090_114_1535 424
221 3300027543 Ga0209999_1003228 Ga0209999_10032282 425
222 3300027682 Ga0209971_1002907 Ga0209971_10029072 425
223 3300033529 Ga0316587_1001288 Ga0316587_10012881 425
224 3300049586 Ga0501070_0022445 Ga0501070_0022445_3045_4469 426
225 3300031665 Ga0316575_10024883 Ga0316575_100248831 427
226 3300031691 Ga0316579_10000563 Ga0316579_100005636 427
227 3300031727 Ga0316576_10006436 Ga0316576_100064366 427
228 3300031727 Ga0316576_10036238 Ga0316576_100362382 427
229 3300031728 Ga0316578_10001282 Ga0316578_100012827 427
230 3300031733 Ga0316577_10001497 Ga0316577_100014977 427
231 3300032137 Ga0316585_10000237 Ga0316585_100002375 427
232 3300032139 Ga0316580_10000470 Ga0316580_100004704 427
233 3300032168 Ga0316593_10029736 Ga0316593_100297361 427
234 3300033524 Ga0316592_1000430 Ga0316592_10004304 427
235 3300033541 Ga0316596_1003204 Ga0316596_10032044 427
236 3300036647 Ga0316582_0000060 Ga0316582_0000060_7039_8454 427
237 3300036712 Ga0316584_0007166 Ga0316584_0007166_5955_7385 427
238 3300031665 Ga0316575_10013745 Ga0316575_100137452 428
239 3300032133 Ga0316583_10009854 Ga0316583_100098543 428
240 3300036647 Ga0316582_0002443 Ga0316582_0002443_4040_5521 428
241 3300036712 Ga0316584_0039493 Ga0316584_0039493_1137_2639 430
242 3300003751 Ga0055538_1000038 Ga0055538_100003870 433
243 3300003752 Ga0055539_1000049 Ga0055539_100004970 433
244 3300003756 Ga0055533_1000060 Ga0055533_100006070 433
245 3300003759 Ga0055525_1000068 Ga0055525_1000068124 433
246 3300003841 Ga0055541_1000036 Ga0055541_1000036124 433
247 3300025224 Ga0209784_100021 Ga0209784_100021170 433
248 3300025225 Ga0209566_100039 Ga0209566_100039171 433
249 3300025226 Ga0209674_100036 Ga0209674_100036170 433
250 3300025230 Ga0209563_100040 Ga0209563_100040170 433
251 3300025253 Ga0209677_100023 Ga0209677_100023170 433

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05193

Peptidase_M16_C

Peptidase M16 inactive domain

230

413

0.95

PF00675

Peptidase_M16

Insulinase (Peptidase family M16)

76

224

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3amj-assembly1.cif.gz_C the crystal structure of the heterodimer of m16b peptidase from sphingomonas sp. a1 0.9437 36 418
5euf-assembly1.cif.gz_A the crystal structure of a protease from helicobacter pylori 0.9121 33 416
8dwz-assembly1.cif.gz_A ca domain of vansa histidine kinase, 7 kev data 0.8992 99 124
4nnz-assembly2.cif.gz_B subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.8958 35 417
4nnz-assembly2.cif.gz_A subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.8925 35 417
ID Description Score Start End Superfamily
3amjC01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9906 36 252 3.30.830.10
4nnzB01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9773 35 252 3.30.830.10
5eufA01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9655 33 253 3.30.830.10
1ntkA01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9629 37 243 3.30.830.10
4nnzB01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9628 35 252 3.30.830.10
ID Description Score Start End GO Terms
AF-A0A7Y4JLK4-F1-model_v4 deleted 0.9744 52 173
AF-A0A352KIY5-F1-model_v4 Peptidase M16 0.9726 36 286 GO:0004222
GO:0006508
GO:0046872
AF-W4V9M2-F1-model_v4 Peptidase 0.9647 36 182 GO:0004222
GO:0006508
GO:0046872
AF-A0A7J5EAA3-F1-model_v4 Insulinase family protein 0.9616 34 219 GO:0004222
GO:0006508
GO:0046872
AF-A0A519WVY2-F1-model_v4 deleted 0.9609 29 187

Feature Viewer

pLDDT pTM Quality
83.12 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map