F362519

General Info

Members Datasets Scaffolds Average Seq Length
251 148 251 194

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10187911|Ga0265314_101879112
Length 198
Sequence VSGLVLASASPVRARLLRAAGIDFEVHPALVDESEIKAKLLAKGKDGVQIADALAEAKALGVSHIFPQATVLGCDQIVLFEGRLIGKSANLSQARILLQQLQGNAHVLATACVLAIGGTPIWRRQERITMRMRPVGDKFIEDYLNAEGDGILGSVGCYHFEGRGAQLFEAAEGDYFSVLGLPLLPLLAALRDQGIIER

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
111 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
140 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
141 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
142 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
143 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
144 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
145 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
146 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.98
Nodule 0
Rhizoplane 0
Rhizosphere 92.43
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000035 3300003214 Bacteria 290723
2 JGI25153J46596_10000400 3300003215 Bacteria 29140
3 rootH2_10011554 3300003320 Bacteria 1230
4 Ga0070658_10010006 3300005327 Bacteria 7617
5 Ga0070676_10017083 3300005328 Bacteria 4012
6 Ga0070677_10087194 3300005333 Bacteria 1350
7 Ga0068869_100048935 3300005334 Bacteria 3059
8 Ga0068869_100067023 3300005334 Bacteria 2647
9 Ga0070680_100055048 3300005336 Bacteria 3250
10 Ga0068868_100052577 3300005338 Bacteria 3207
11 Ga0068868_100164000 3300005338 Bacteria 1837
12 Ga0070660_100085621 3300005339 Bacteria 2479
13 Ga0070660_100105722 3300005339 Bacteria 2234
14 Ga0070661_100200696 3300005344 Bacteria 1524
15 Ga0070661_100499704 3300005344 Bacteria 973
16 Ga0070675_100050497 3300005354 Bacteria 3415
17 Ga0070671_100254761 3300005355 Bacteria 1491
18 Ga0070673_100022431 3300005364 Bacteria 4595
19 Ga0070673_100037721 3300005364 Bacteria 3684
20 Ga0070659_100046092 3300005366 Bacteria 3417
21 Ga0070667_100014309 3300005367 Bacteria 6555
22 Ga0070713_100439288 3300005436 Bacteria 1224
23 Ga0070701_10274404 3300005438 Bacteria 1027
24 Ga0070678_100076986 3300005456 Bacteria 2515
25 Ga0070678_100300646 3300005456 Bacteria 1364
26 Ga0070678_100533459 3300005456 Bacteria 1040
27 Ga0070678_100773924 3300005456 Bacteria 870
28 Ga0068867_100006768 3300005459 Bacteria 8100
29 Ga0070679_100006583 3300005530 Bacteria 10825
30 Ga0070679_100029438 3300005530 Bacteria 5418
31 Ga0070684_100057818 3300005535 Bacteria 3387
32 Ga0068853_100753583 3300005539 Bacteria 931
33 Ga0068853_100820955 3300005539 Bacteria 891
34 Ga0070672_100107345 3300005543 Bacteria 2272
35 Ga0070672_100457262 3300005543 Bacteria 1100
36 Ga0070665_100001302 3300005548 Bacteria 29816
37 Ga0070665_100339897 3300005548 Unclassified 1506
38 Ga0070665_100424874 3300005548 Bacteria 1338
39 Ga0070665_100763991 3300005548 Bacteria 979
40 Ga0068855_100072950 3300005563 Bacteria 3989
41 Ga0068855_100092930 3300005563 Bacteria 3479
42 Ga0068855_100118411 3300005563 Bacteria 3033
43 Ga0070664_100636063 3300005564 Bacteria 991
44 Ga0068857_100359595 3300005577 Bacteria 1349
45 Ga0068857_100685243 3300005577 Bacteria 973
46 Ga0068854_100286666 3300005578 Bacteria 1328
47 Ga0068856_100175082 3300005614 Bacteria 2158
48 Ga0068856_100239024 3300005614 Bacteria 1832
49 Ga0068866_10109023 3300005718 Bacteria 1541
50 Ga0068862_101165344 3300005844 Unclassified 768
51 Ga0097621_100000645 3300006237 Bacteria 24626
52 Ga0097621_100013492 3300006237 Bacteria 6091
53 Ga0097621_100021274 3300006237 Bacteria 5014
54 Ga0097621_100714210 3300006237 Unclassified 924
55 Ga0068871_100000378 3300006358 Bacteria 31128
56 Ga0068871_100004686 3300006358 Bacteria 9558
57 Ga0068871_100014898 3300006358 Bacteria 5811
58 Ga0068871_100086984 3300006358 Bacteria 2597
59 Ga0068871_100103994 3300006358 Bacteria 2381
60 Ga0068871_100257388 3300006358 Bacteria 1522
61 Ga0068865_100115437 3300006881 Bacteria 1987
62 Ga0105240_10022529 3300009093 Bacteria 8348
63 Ga0105240_10126249 3300009093 Bacteria 3074
64 Ga0105240_10145714 3300009093 Bacteria 2826
65 Ga0105240_10330835 3300009093 Bacteria 1734
66 Ga0105240_10363452 3300009093 Bacteria 1639
67 Ga0105240_10929882 3300009093 Bacteria 934
68 Ga0105245_10047039 3300009098 Bacteria 3857
69 Ga0105245_10291406 3300009098 Bacteria 1599
70 Ga0105245_10411567 3300009098 Unclassified 1353
71 Ga0105247_10264497 3300009101 Bacteria 1180
72 Ga0105243_10004582 3300009148 Bacteria 10901
73 Ga0105243_10360971 3300009148 Bacteria 1337
74 Ga0105241_10042078 3300009174 Bacteria 3454
75 Ga0105241_10076514 3300009174 Bacteria 2610
76 Ga0105241_10085005 3300009174 Bacteria 2486
77 Ga0105241_10109216 3300009174 Bacteria 2212
78 Ga0105241_10110736 3300009174 Bacteria 2197
79 Ga0105241_10216397 3300009174 Bacteria 1608
80 Ga0105242_10032335 3300009176 Bacteria 4183
81 Ga0105242_10119041 3300009176 Bacteria 2263
82 Ga0105237_10048908 3300009545 Bacteria 4251
83 Ga0105237_10439351 3300009545 Bacteria 1310
84 Ga0105238_10255247 3300009551 Unclassified 1732
85 Ga0105238_10439806 3300009551 Bacteria 1300
86 Ga0105238_10446938 3300009551 Bacteria 1289
87 Ga0105249_10425421 3300009553 Bacteria 1362
88 Ga0105249_10885797 3300009553 Unclassified 959
89 Ga0105239_10520547 3300010375 Bacteria 1353
90 Ga0105239_11668973 3300010375 Bacteria 737
91 Ga0105246_10020319 3300011119 Bacteria 4258
92 Ga0105246_10031434 3300011119 Bacteria 3513
93 Ga0157373_10191593 3300013100 Bacteria 1441
94 Ga0157370_10063084 3300013104 Bacteria 3512
95 Ga0157369_10222688 3300013105 Bacteria 1974
96 Ga0157369_10481864 3300013105 Bacteria 1284
97 Ga0157378_10084333 3300013297 Bacteria 2876
98 Ga0157378_10147173 3300013297 Bacteria 2192
99 Ga0157378_10421460 3300013297 Bacteria 1319
100 Ga0163162_10016765 3300013306 Bacteria 7161
101 Ga0163162_11050021 3300013306 Bacteria 922
102 Ga0157375_10182768 3300013308 Bacteria 2249
103 Ga0163163_10000012 3300014325 Bacteria 257369
104 Ga0157377_10197958 3300014745 Bacteria 1274
105 Ga0157379_10017806 3300014968 Bacteria 6258
106 Ga0157379_10118495 3300014968 Bacteria 2381
107 Ga0157376_10520277 3300014969 Bacteria 1172
108 Ga0157376_11001178 3300014969 Bacteria 858
109 Ga0209233_1000006 3300025261 Bacteria 1473685
110 Ga0209233_1002462 3300025261 Bacteria 6795
111 Ga0209758_1000008 3300025297 Bacteria 1215263
112 Ga0207642_10075141 3300025899 Bacteria 1622
113 Ga0207642_10381403 3300025899 Bacteria 839
114 Ga0207645_10011653 3300025907 Bacteria 5995
115 Ga0207705_10038327 3300025909 Bacteria 3431
116 Ga0207705_10294292 3300025909 Bacteria 1244
117 Ga0207654_10034752 3300025911 Bacteria 2802
118 Ga0207654_10126392 3300025911 Bacteria 1612
119 Ga0207695_10037015 3300025913 Bacteria 5268
120 Ga0207695_10331576 3300025913 Bacteria 1410
121 Ga0207695_10448897 3300025913 Bacteria 1173
122 Ga0207663_10086367 3300025916 Bacteria 2069
123 Ga0207660_10027363 3300025917 Bacteria 3890
124 Ga0207657_10041036 3300025919 Bacteria 4095
125 Ga0207657_10044443 3300025919 Bacteria 3905
126 Ga0207657_10289863 3300025919 Bacteria 1298
127 Ga0207649_10085564 3300025920 Bacteria 2052
128 Ga0207652_10006846 3300025921 Bacteria 9186
129 Ga0207694_10189598 3300025924 Bacteria 1670
130 Ga0207694_10268805 3300025924 Bacteria 1398
131 Ga0207694_10453093 3300025924 Bacteria 1071
132 Ga0207659_10051692 3300025926 Bacteria 2924
133 Ga0207687_10089972 3300025927 Bacteria 2236
134 Ga0207700_10031638 3300025928 Bacteria 3762
135 Ga0207644_10224595 3300025931 Unclassified 1490
136 Ga0207690_10268984 3300025932 Bacteria 1323
137 Ga0207686_10024615 3300025934 Bacteria 3491
138 Ga0207709_10026963 3300025935 Bacteria 3305
139 Ga0207709_10218781 3300025935 Bacteria 1372
140 Ga0207704_10109744 3300025938 Bacteria 1862
141 Ga0207691_10076792 3300025940 Bacteria 3010
142 Ga0207691_10393191 3300025940 Bacteria 1183
143 Ga0207689_10239024 3300025942 Unclassified 1501
144 Ga0207661_10145369 3300025944 Bacteria 2045
145 Ga0207679_10667432 3300025945 Bacteria 941
146 Ga0207667_10144449 3300025949 Bacteria 2449
147 Ga0207667_10202058 3300025949 Bacteria 2038
148 Ga0207651_10022119 3300025960 Bacteria 3880
149 Ga0207712_11239545 3300025961 Unclassified 666
150 Ga0207668_11173039 3300025972 Unclassified 690
151 Ga0207677_10027703 3300026023 Bacteria 3574
152 Ga0207677_10094170 3300026023 Bacteria 2186
153 Ga0207639_10111974 3300026041 Bacteria 2226
154 Ga0207639_10526136 3300026041 Bacteria 1083
155 Ga0207702_10140614 3300026078 Bacteria 2184
156 Ga0207702_10265341 3300026078 Bacteria 1618
157 Ga0207702_10361619 3300026078 Bacteria 1391
158 Ga0207648_10015507 3300026089 Bacteria 7006
159 Ga0207676_10559158 3300026095 Bacteria 1094
160 Ga0207676_11494304 3300026095 Bacteria 672
161 Ga0207674_10169935 3300026116 Bacteria 2134
162 Ga0207674_10227707 3300026116 Bacteria 1812
163 Ga0207674_10360067 3300026116 Bacteria 1406
164 Ga0207683_10061762 3300026121 Bacteria 3298
165 Ga0207683_10074936 3300026121 Bacteria 2995
166 Ga0207683_10179152 3300026121 Bacteria 1921
167 Ga0207683_10449354 3300026121 Bacteria 1188
168 Ga0207698_10074578 3300026142 Bacteria 2707
169 Ga0268266_10000847 3300028379 Bacteria 39858
170 Ga0268266_10020890 3300028379 Bacteria 5582
171 Ga0268266_10242095 3300028379 Bacteria 1665
172 Ga0268266_10296702 3300028379 Bacteria 1507
173 Ga0268264_10022837 3300028381 Bacteria 5104
174 Ga0265338_10004163 3300028800 Bacteria 19762
175 Ga0265328_10041844 3300031239 Bacteria 1687
176 Ga0265314_10019520 3300031711 Bacteria 5252
177 Ga0265314_10187911 3300031711 Bacteria 1232
178 Ga0265342_10209731 3300031712 Bacteria 1054
179 Ga0373942_0124734 3300035207 Bacteria 808
180 Ga0373937_0534471 3300036401 Unclassified 1114
181 Ga0395900_1081230 3300037418 Bacteria 720
182 Ga0395901_0007907 3300038443 Bacteria 10728
183 Ga0436365_1772165 3300039437 Bacteria 1793
184 Ga0436360_0594672 3300039438 Bacteria 668
185 Ga0436361_0833633 3300039447 Bacteria 1539
186 Ga0466967_0543708 3300045976 Bacteria 1143
187 Ga0495618_0335032 3300046514 Bacteria 935
188 Ga0495654_0031268 3300046530 Bacteria 2703
189 Ga0495622_0003848 3300046557 Bacteria 7010
190 Ga0495633_0404645 3300046558 Bacteria 617
191 Ga0495657_0235764 3300046675 Bacteria 1105
192 Ga0495604_0130430 3300047317 Bacteria 1808
193 Ga0495672_0071562 3300047320 Bacteria 1962
194 Ga0495602_0109442 3300048088 Bacteria 2247
195 Ga0496121_0001324 3300048924 Bacteria 42408
196 Ga0496126_0184743 3300048929 Unclassified 1769
197 Ga0501032_0006720 3300049569 Bacteria 8442
198 Ga0501033_0006487 3300049570 Bacteria 9154
199 Ga0501033_0062610 3300049570 Bacteria 2739
200 Ga0501033_0116061 3300049570 Bacteria 1945
201 Ga0501033_0191251 3300049570 Bacteria 1464
202 Ga0501034_0088413 3300049571 Bacteria 3096
203 Ga0501034_0172732 3300049571 Bacteria 2128
204 Ga0501034_0424003 3300049571 Unclassified 1251
205 Ga0501036_0021259 3300049572 Bacteria 5452
206 Ga0501036_0290341 3300049572 Bacteria 1368
207 Ga0501036_0969643 3300049572 Bacteria 696
208 Ga0501037_0002338 3300049573 Bacteria 13695
209 Ga0501037_0131138 3300049573 Bacteria 1797
210 Ga0501038_0007059 3300049574 Bacteria 10370
211 Ga0501038_0113500 3300049574 Bacteria 2242
212 Ga0501038_0127400 3300049574 Bacteria 2094
213 Ga0501039_0405326 3300049575 Bacteria 1071
214 Ga0501042_0040575 3300049578 Bacteria 3309
215 Ga0501043_0029545 3300049579 Bacteria 4307
216 Ga0501046_0018738 3300049580 Bacteria 5752
217 Ga0501046_0149255 3300049580 Bacteria 1764
218 Ga0501046_0159663 3300049580 Bacteria 1696
219 Ga0501047_0013462 3300049581 Bacteria 7754
220 Ga0501047_0019777 3300049581 Bacteria 6463
221 Ga0501047_0037385 3300049581 Bacteria 4695
222 Ga0501047_0121859 3300049581 Bacteria 2489
223 Ga0501048_0024256 3300049582 Bacteria 4427
224 Ga0501067_0003570 3300049583 Bacteria 8565
225 Ga0501070_0008382 3300049586 Bacteria 8731
226 Ga0501072_0016344 3300049588 Bacteria 5694
227 Ga0501073_0174138 3300049589 Bacteria 1489
228 Ga0501073_0761600 3300049589 Unclassified 667
229 Ga0501074_0006786 3300049590 Bacteria 8265
230 Ga0501079_0010616 3300049741 Bacteria 7009
231 Ga0501080_0017530 3300049742 Bacteria 6622
232 Ga0501035_0034206 3300049822 Bacteria 4619
233 Ga0501035_0051128 3300049822 Bacteria 3701
234 Ga0501035_0162500 3300049822 Bacteria 1932
235 Ga0501035_0308133 3300049822 Bacteria 1333
236 Ga0501044_0002877 3300049823 Bacteria 19588
237 Ga0501044_0085207 3300049823 Bacteria 3193
238 Ga0501044_0289594 3300049823 Bacteria 1569
239 Ga0501044_0950165 3300049823 Bacteria 733
240 Ga0500635_0040918 3300053080 Bacteria 1548
241 Ga0500643_000027 3300053087 Bacteria 251062
242 Ga0500555_109555 3300053103 Unclassified 696
243 Ga0500594_0131029 3300053118 Bacteria 794
244 Ga0500595_003834 3300053119 Bacteria 6912
245 Ga0500595_004398 3300053119 Bacteria 6331
246 Ga0500595_067944 3300053119 Bacteria 1062
247 Ga0500559_0050049 3300053136 Bacteria 1843
248 Ga0500611_013878 3300053727 Bacteria 1393
249 Ga0500587_026462 3300053739 Bacteria 778
250 Ga0501084_0008317 3300054114 Bacteria 8563
251 Ga0501082_0010204 3300060353 Bacteria 8086

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0088413 Ga0501034_0088413_1048_1635 165
2 3300049823 Ga0501044_0085207 Ga0501044_0085207_343_930 165
3 3300005366 Ga0070659_100046092 Ga0070659_1000460922 169
4 3300005577 Ga0068857_100359595 Ga0068857_1003595952 169
5 3300025909 Ga0207705_10294292 Ga0207705_102942922 169
6 3300025919 Ga0207657_10289863 Ga0207657_102898632 169
7 3300026116 Ga0207674_10169935 Ga0207674_101699352 169
8 3300039438 Ga0436360_0594672 Ga0436360_0594672_28_615 174
9 3300039447 Ga0436361_0833633 Ga0436361_0833633_647_1234 174
10 3300049575 Ga0501039_0405326 Ga0501039_0405326_322_909 175
11 3300049570 Ga0501033_0116061 Ga0501033_0116061_631_1176 181
12 3300049571 Ga0501034_0424003 Ga0501034_0424003_604_1149 181
13 3300049573 Ga0501037_0131138 Ga0501037_0131138_1029_1574 181
14 3300049574 Ga0501038_0127400 Ga0501038_0127400_1220_1765 181
15 3300049579 Ga0501043_0029545 Ga0501043_0029545_917_1462 181
16 3300049580 Ga0501046_0149255 Ga0501046_0149255_196_741 181
17 3300049581 Ga0501047_0013462 Ga0501047_0013462_5060_5605 181
18 3300049822 Ga0501035_0034206 Ga0501035_0034206_2392_2937 181
19 3300049823 Ga0501044_0002877 Ga0501044_0002877_17551_18096 181
20 3300006358 Ga0068871_100004686 Ga0068871_1000046866 182
21 3300009148 Ga0105243_10360971 Ga0105243_103609712 182
22 3300025935 Ga0207709_10218781 Ga0207709_102187812 182
23 3300049570 Ga0501033_0062610 Ga0501033_0062610_2139_2726 184
24 3300049572 Ga0501036_0021259 Ga0501036_0021259_4852_5439 184
25 3300049573 Ga0501037_0002338 Ga0501037_0002338_7879_8466 184
26 3300049580 Ga0501046_0018738 Ga0501046_0018738_3100_3687 184
27 3300049586 Ga0501070_0008382 Ga0501070_0008382_5963_6550 184
28 3300049588 Ga0501072_0016344 Ga0501072_0016344_4799_5386 184
29 3300049589 Ga0501073_0761600 Ga0501073_0761600_14_601 184
30 3300049742 Ga0501080_0017530 Ga0501080_0017530_73_660 184
31 3300046558 Ga0495633_0404645 Ga0495633_0404645_14_574 186
32 3300049569 Ga0501032_0006720 Ga0501032_0006720_708_1295 187
33 3300049570 Ga0501033_0191251 Ga0501033_0191251_14_601 187
34 3300049572 Ga0501036_0290341 Ga0501036_0290341_14_601 187
35 3300049574 Ga0501038_0007059 Ga0501038_0007059_8417_9004 187
36 3300049578 Ga0501042_0040575 Ga0501042_0040575_2133_2720 187
37 3300049582 Ga0501048_0024256 Ga0501048_0024256_390_977 187
38 3300049583 Ga0501067_0003570 Ga0501067_0003570_454_1041 187
39 3300049589 Ga0501073_0174138 Ga0501073_0174138_889_1476 187
40 3300049590 Ga0501074_0006786 Ga0501074_0006786_864_1451 187
41 3300049741 Ga0501079_0010616 Ga0501079_0010616_5575_6162 187
42 3300049822 Ga0501035_0051128 Ga0501035_0051128_15_602 187
43 3300049822 Ga0501035_0162500 Ga0501035_0162500_228_809 187
44 3300054114 Ga0501084_0008317 Ga0501084_0008317_7348_7935 187
45 3300060353 Ga0501082_0010204 Ga0501082_0010204_82_669 187
46 3300009093 Ga0105240_10929882 Ga0105240_109298822 192
47 3300009174 Ga0105241_10216397 Ga0105241_102163972 192
48 3300013105 Ga0157369_10222688 Ga0157369_102226883 192
49 3300013297 Ga0157378_10084333 Ga0157378_100843333 193
50 3300049572 Ga0501036_0969643 Ga0501036_0969643_67_648 193
51 3300049580 Ga0501046_0159663 Ga0501046_0159663_91_672 193
52 3300049581 Ga0501047_0121859 Ga0501047_0121859_833_1414 193
53 3300049823 Ga0501044_0950165 Ga0501044_0950165_10_591 193
54 3300053739 Ga0500587_026462 Ga0500587_026462_113_694 193
55 3300003320 rootH2_10011554 rootH2_100115542 195
56 3300005327 Ga0070658_10010006 Ga0070658_100100062 195
57 3300005328 Ga0070676_10017083 Ga0070676_100170834 195
58 3300005333 Ga0070677_10087194 Ga0070677_100871942 195
59 3300005334 Ga0068869_100048935 Ga0068869_1000489352 195
60 3300005334 Ga0068869_100067023 Ga0068869_1000670233 195
61 3300005336 Ga0070680_100055048 Ga0070680_1000550483 195
62 3300005338 Ga0068868_100052577 Ga0068868_1000525774 195
63 3300005338 Ga0068868_100164000 Ga0068868_1001640002 195
64 3300005339 Ga0070660_100085621 Ga0070660_1000856212 195
65 3300005339 Ga0070660_100105722 Ga0070660_1001057222 195
66 3300005344 Ga0070661_100200696 Ga0070661_1002006962 195
67 3300005344 Ga0070661_100499704 Ga0070661_1004997041 195
68 3300005354 Ga0070675_100050497 Ga0070675_1000504973 195
69 3300005355 Ga0070671_100254761 Ga0070671_1002547612 195
70 3300005364 Ga0070673_100022431 Ga0070673_1000224313 195
71 3300005364 Ga0070673_100037721 Ga0070673_1000377214 195
72 3300005367 Ga0070667_100014309 Ga0070667_1000143093 195
73 3300005436 Ga0070713_100439288 Ga0070713_1004392882 195
74 3300005438 Ga0070701_10274404 Ga0070701_102744042 195
75 3300005456 Ga0070678_100076986 Ga0070678_1000769863 195
76 3300005456 Ga0070678_100300646 Ga0070678_1003006462 195
77 3300005456 Ga0070678_100533459 Ga0070678_1005334591 195
78 3300005456 Ga0070678_100773924 Ga0070678_1007739242 195
79 3300005459 Ga0068867_100006768 Ga0068867_1000067686 195
80 3300005530 Ga0070679_100006583 Ga0070679_1000065837 195
81 3300005530 Ga0070679_100029438 Ga0070679_1000294386 195
82 3300005535 Ga0070684_100057818 Ga0070684_1000578184 195
83 3300005539 Ga0068853_100753583 Ga0068853_1007535832 195
84 3300005539 Ga0068853_100820955 Ga0068853_1008209551 195
85 3300005543 Ga0070672_100107345 Ga0070672_1001073452 195
86 3300005543 Ga0070672_100457262 Ga0070672_1004572622 195
87 3300005548 Ga0070665_100001302 Ga0070665_10000130221 195
88 3300005548 Ga0070665_100339897 Ga0070665_1003398972 195
89 3300005548 Ga0070665_100424874 Ga0070665_1004248742 195
90 3300005563 Ga0068855_100072950 Ga0068855_1000729501 195
91 3300005563 Ga0068855_100092930 Ga0068855_1000929303 195
92 3300005563 Ga0068855_100118411 Ga0068855_1001184114 195
93 3300005564 Ga0070664_100636063 Ga0070664_1006360631 195
94 3300005578 Ga0068854_100286666 Ga0068854_1002866662 195
95 3300005614 Ga0068856_100175082 Ga0068856_1001750822 195
96 3300005614 Ga0068856_100239024 Ga0068856_1002390242 195
97 3300005718 Ga0068866_10109023 Ga0068866_101090232 195
98 3300005844 Ga0068862_101165344 Ga0068862_1011653442 195
99 3300006237 Ga0097621_100000645 Ga0097621_10000064520 195
100 3300006237 Ga0097621_100013492 Ga0097621_1000134924 195
101 3300006237 Ga0097621_100021274 Ga0097621_1000212743 195
102 3300006237 Ga0097621_100714210 Ga0097621_1007142102 195
103 3300006358 Ga0068871_100000378 Ga0068871_10000037815 195
104 3300006358 Ga0068871_100014898 Ga0068871_1000148987 195
105 3300006358 Ga0068871_100086984 Ga0068871_1000869842 195
106 3300006358 Ga0068871_100103994 Ga0068871_1001039942 195
107 3300006358 Ga0068871_100257388 Ga0068871_1002573882 195
108 3300006881 Ga0068865_100115437 Ga0068865_1001154372 195
109 3300009093 Ga0105240_10022529 Ga0105240_100225293 195
110 3300009093 Ga0105240_10126249 Ga0105240_101262492 195
111 3300009093 Ga0105240_10145714 Ga0105240_101457142 195
112 3300009093 Ga0105240_10330835 Ga0105240_103308352 195
113 3300009093 Ga0105240_10363452 Ga0105240_103634522 195
114 3300009098 Ga0105245_10047039 Ga0105245_100470392 195
115 3300009098 Ga0105245_10291406 Ga0105245_102914062 195
116 3300009098 Ga0105245_10411567 Ga0105245_104115672 195
117 3300009101 Ga0105247_10264497 Ga0105247_102644972 195
118 3300009148 Ga0105243_10004582 Ga0105243_100045829 195
119 3300009174 Ga0105241_10042078 Ga0105241_100420784 195
120 3300009174 Ga0105241_10076514 Ga0105241_100765142 195
121 3300009174 Ga0105241_10085005 Ga0105241_100850052 195
122 3300009174 Ga0105241_10109216 Ga0105241_101092162 195
123 3300009174 Ga0105241_10110736 Ga0105241_101107362 195
124 3300009176 Ga0105242_10032335 Ga0105242_100323353 195
125 3300009176 Ga0105242_10119041 Ga0105242_101190412 195
126 3300009545 Ga0105237_10048908 Ga0105237_100489084 195
127 3300009545 Ga0105237_10439351 Ga0105237_104393512 195
128 3300009551 Ga0105238_10255247 Ga0105238_102552473 195
129 3300009551 Ga0105238_10439806 Ga0105238_104398061 195
130 3300009551 Ga0105238_10446938 Ga0105238_104469382 195
131 3300009553 Ga0105249_10425421 Ga0105249_104254212 195
132 3300009553 Ga0105249_10885797 Ga0105249_108857972 195
133 3300010375 Ga0105239_10520547 Ga0105239_105205472 195
134 3300010375 Ga0105239_11668973 Ga0105239_116689731 195
135 3300011119 Ga0105246_10020319 Ga0105246_100203193 195
136 3300011119 Ga0105246_10031434 Ga0105246_100314343 195
137 3300013100 Ga0157373_10191593 Ga0157373_101915932 195
138 3300013104 Ga0157370_10063084 Ga0157370_100630845 195
139 3300013105 Ga0157369_10481864 Ga0157369_104818642 195
140 3300013297 Ga0157378_10147173 Ga0157378_101471733 195
141 3300013297 Ga0157378_10421460 Ga0157378_104214602 195
142 3300013306 Ga0163162_10016765 Ga0163162_100167653 195
143 3300013306 Ga0163162_11050021 Ga0163162_110500212 195
144 3300013308 Ga0157375_10182768 Ga0157375_101827683 195
145 3300014325 Ga0163163_10000012 Ga0163163_10000012112 195
146 3300014745 Ga0157377_10197958 Ga0157377_101979582 195
147 3300014968 Ga0157379_10017806 Ga0157379_100178065 195
148 3300014968 Ga0157379_10118495 Ga0157379_101184953 195
149 3300014969 Ga0157376_10520277 Ga0157376_105202772 195
150 3300014969 Ga0157376_11001178 Ga0157376_110011781 195
151 3300025899 Ga0207642_10075141 Ga0207642_100751412 195
152 3300025899 Ga0207642_10381403 Ga0207642_103814032 195
153 3300025907 Ga0207645_10011653 Ga0207645_100116535 195
154 3300025909 Ga0207705_10038327 Ga0207705_100383272 195
155 3300025911 Ga0207654_10034752 Ga0207654_100347522 195
156 3300025911 Ga0207654_10126392 Ga0207654_101263922 195
157 3300025913 Ga0207695_10037015 Ga0207695_100370153 195
158 3300025913 Ga0207695_10331576 Ga0207695_103315762 195
159 3300025913 Ga0207695_10448897 Ga0207695_104488972 195
160 3300025916 Ga0207663_10086367 Ga0207663_100863672 195
161 3300025917 Ga0207660_10027363 Ga0207660_100273636 195
162 3300025919 Ga0207657_10041036 Ga0207657_100410363 195
163 3300025919 Ga0207657_10044443 Ga0207657_100444434 195
164 3300025920 Ga0207649_10085564 Ga0207649_100855642 195
165 3300025921 Ga0207652_10006846 Ga0207652_100068462 195
166 3300025924 Ga0207694_10189598 Ga0207694_101895982 195
167 3300025924 Ga0207694_10268805 Ga0207694_102688052 195
168 3300025924 Ga0207694_10453093 Ga0207694_104530932 195
169 3300025926 Ga0207659_10051692 Ga0207659_100516923 195
170 3300025927 Ga0207687_10089972 Ga0207687_100899722 195
171 3300025928 Ga0207700_10031638 Ga0207700_100316386 195
172 3300025931 Ga0207644_10224595 Ga0207644_102245952 195
173 3300025932 Ga0207690_10268984 Ga0207690_102689842 195
174 3300025934 Ga0207686_10024615 Ga0207686_100246153 195
175 3300025935 Ga0207709_10026963 Ga0207709_100269631 195
176 3300025938 Ga0207704_10109744 Ga0207704_101097443 195
177 3300025940 Ga0207691_10076792 Ga0207691_100767923 195
178 3300025940 Ga0207691_10393191 Ga0207691_103931912 195
179 3300025942 Ga0207689_10239024 Ga0207689_102390242 195
180 3300025944 Ga0207661_10145369 Ga0207661_101453692 195
181 3300025945 Ga0207679_10667432 Ga0207679_106674322 195
182 3300025949 Ga0207667_10144449 Ga0207667_101444493 195
183 3300025949 Ga0207667_10202058 Ga0207667_102020583 195
184 3300025960 Ga0207651_10022119 Ga0207651_100221193 195
185 3300025961 Ga0207712_11239545 Ga0207712_112395451 195
186 3300025972 Ga0207668_11173039 Ga0207668_111730392 195
187 3300026023 Ga0207677_10027703 Ga0207677_100277034 195
188 3300026023 Ga0207677_10094170 Ga0207677_100941702 195
189 3300026041 Ga0207639_10111974 Ga0207639_101119743 195
190 3300026041 Ga0207639_10526136 Ga0207639_105261362 195
191 3300026078 Ga0207702_10140614 Ga0207702_101406142 195
192 3300026078 Ga0207702_10265341 Ga0207702_102653412 195
193 3300026078 Ga0207702_10361619 Ga0207702_103616192 195
194 3300026089 Ga0207648_10015507 Ga0207648_100155077 195
195 3300026095 Ga0207676_10559158 Ga0207676_105591582 195
196 3300026095 Ga0207676_11494304 Ga0207676_114943041 195
197 3300026116 Ga0207674_10227707 Ga0207674_102277073 195
198 3300026121 Ga0207683_10061762 Ga0207683_100617623 195
199 3300026121 Ga0207683_10074936 Ga0207683_100749362 195
200 3300026121 Ga0207683_10179152 Ga0207683_101791523 195
201 3300026121 Ga0207683_10449354 Ga0207683_104493542 195
202 3300026142 Ga0207698_10074578 Ga0207698_100745783 195
203 3300028379 Ga0268266_10000847 Ga0268266_1000084715 195
204 3300028379 Ga0268266_10020890 Ga0268266_100208902 195
205 3300028379 Ga0268266_10242095 Ga0268266_102420952 195
206 3300028381 Ga0268264_10022837 Ga0268264_100228372 195
207 3300028800 Ga0265338_10004163 Ga0265338_1000416321 195
208 3300031239 Ga0265328_10041844 Ga0265328_100418442 195
209 3300031711 Ga0265314_10019520 Ga0265314_100195204 195
210 3300035207 Ga0373942_0124734 Ga0373942_0124734_146_748 195
211 3300036401 Ga0373937_0534471 Ga0373937_0534471_351_953 195
212 3300037418 Ga0395900_1081230 Ga0395900_1081230_118_705 195
213 3300038443 Ga0395901_0007907 Ga0395901_0007907_4063_4668 195
214 3300039437 Ga0436365_1772165 Ga0436365_1772165_659_1246 195
215 3300045976 Ga0466967_0543708 Ga0466967_0543708_498_1103 195
216 3300046514 Ga0495618_0335032 Ga0495618_0335032_275_862 195
217 3300046557 Ga0495622_0003848 Ga0495622_0003848_1719_2306 195
218 3300046675 Ga0495657_0235764 Ga0495657_0235764_360_947 195
219 3300047320 Ga0495672_0071562 Ga0495672_0071562_897_1484 195
220 3300048924 Ga0496121_0001324 Ga0496121_0001324_4329_4931 195
221 3300048929 Ga0496126_0184743 Ga0496126_0184743_425_1015 195
222 3300049570 Ga0501033_0006487 Ga0501033_0006487_3278_3865 195
223 3300049571 Ga0501034_0172732 Ga0501034_0172732_157_759 195
224 3300049574 Ga0501038_0113500 Ga0501038_0113500_87_674 195
225 3300049581 Ga0501047_0019777 Ga0501047_0019777_4968_5555 195
226 3300049581 Ga0501047_0037385 Ga0501047_0037385_833_1420 195
227 3300049822 Ga0501035_0308133 Ga0501035_0308133_255_842 195
228 3300049823 Ga0501044_0289594 Ga0501044_0289594_269_856 195
229 3300053080 Ga0500635_0040918 Ga0500635_0040918_606_1193 195
230 3300053087 Ga0500643_000027 Ga0500643_000027_35152_35739 195
231 3300053103 Ga0500555_109555 Ga0500555_109555_63_650 195
232 3300053118 Ga0500594_0131029 Ga0500594_0131029_127_714 195
233 3300053119 Ga0500595_003834 Ga0500595_003834_1544_2134 195
234 3300053119 Ga0500595_004398 Ga0500595_004398_4233_4820 195
235 3300053119 Ga0500595_067944 Ga0500595_067944_381_983 195
236 3300053136 Ga0500559_0050049 Ga0500559_0050049_460_1047 195
237 3300053727 Ga0500611_013878 Ga0500611_013878_294_881 195
238 3300003214 JGI25165J46597_1000035 JGI25165J46597_1000035138 197
239 3300003215 JGI25153J46596_10000400 JGI25153J46596_1000040016 197
240 3300005548 Ga0070665_100763991 Ga0070665_1007639912 197
241 3300005577 Ga0068857_100685243 Ga0068857_1006852432 197
242 3300025261 Ga0209233_1000006 Ga0209233_1000006631 197
243 3300025261 Ga0209233_1002462 Ga0209233_10024624 197
244 3300025297 Ga0209758_1000008 Ga0209758_1000008307 197
245 3300026116 Ga0207674_10360067 Ga0207674_103600672 197
246 3300028379 Ga0268266_10296702 Ga0268266_102967021 197
247 3300031711 Ga0265314_10187911 Ga0265314_101879112 197
248 3300031712 Ga0265342_10209731 Ga0265342_102097312 197
249 3300046530 Ga0495654_0031268 Ga0495654_0031268_100_702 197
250 3300047317 Ga0495604_0130430 Ga0495604_0130430_971_1567 197
251 3300048088 Ga0495602_0109442 Ga0495602_0109442_738_1334 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02545

Maf

Maf-like protein

3

193

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.921 1 191
1exc-assembly1.cif.gz_A crystal structure of b. subtilis maf protein complexed with d-(utp) 0.9176 2 191
4heb-assembly1.cif.gz_B the crystal structure of maf protein of bacillus subtilis 0.9164 2 195
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.9115 1 191
4jhc-assembly1.cif.gz_B crystal structure of the uncharacterized maf protein ycef from e. coli 0.9055 1 193
ID Description Score Start End Superfamily
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.921 1 191 3.90.950.10
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9115 1 191 3.90.950.10
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8959 2 195 3.90.950.10
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8913 2 195 3.90.950.10
af_Q86BM0_10_204_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8881 2 191 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A1H9EC17-F1-model_v4 Nucleoside triphosphate pyrophosphatase (EC 3.6.1.9) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9817 2 191 GO:0005737
GO:0009117
GO:0106379
AF-A0A523FQK1-F1-model_v4 Nucleoside triphosphate pyrophosphatase (EC 3.6.1.9) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9781 3 197 GO:0005737
GO:0009117
GO:0106379
AF-A0A1S7M4D4-F1-model_v4 deleted 0.9779 1 197
AF-A0A356FVI0-F1-model_v4 Nucleoside triphosphate pyrophosphatase (EC 3.6.1.9) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9775 2 197 GO:0005737
GO:0009117
GO:0106379
AF-A0A857ANF6-F1-model_v4 deleted 0.9772 1 197

Feature Viewer

pLDDT pTM Quality
95.1 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map