F362519
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 251 | 148 | 251 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300031711|Ga0265314_10187911|Ga0265314_101879112 |
| Length | 198 |
| Sequence | VSGLVLASASPVRARLLRAAGIDFEVHPALVDESEIKAKLLAKGKDGVQIADALAEAKALGVSHIFPQATVLGCDQIVLFEGRLIGKSANLSQARILLQQLQGNAHVLATACVLAIGGTPIWRRQERITMRMRPVGDKFIEDYLNAEGDGILGSVGCYHFEGRGAQLFEAAEGDYFSVLGLPLLPLLAALRDQGIIER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 98 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 103 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 104 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 105 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 106 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 107 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 108 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 117 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 118 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 126 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 140 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 141 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 142 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 143 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 144 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 145 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 146 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 147 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.98 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 92.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000035 | 3300003214 | Bacteria | 290723 |
| 2 | JGI25153J46596_10000400 | 3300003215 | Bacteria | 29140 |
| 3 | rootH2_10011554 | 3300003320 | Bacteria | 1230 |
| 4 | Ga0070658_10010006 | 3300005327 | Bacteria | 7617 |
| 5 | Ga0070676_10017083 | 3300005328 | Bacteria | 4012 |
| 6 | Ga0070677_10087194 | 3300005333 | Bacteria | 1350 |
| 7 | Ga0068869_100048935 | 3300005334 | Bacteria | 3059 |
| 8 | Ga0068869_100067023 | 3300005334 | Bacteria | 2647 |
| 9 | Ga0070680_100055048 | 3300005336 | Bacteria | 3250 |
| 10 | Ga0068868_100052577 | 3300005338 | Bacteria | 3207 |
| 11 | Ga0068868_100164000 | 3300005338 | Bacteria | 1837 |
| 12 | Ga0070660_100085621 | 3300005339 | Bacteria | 2479 |
| 13 | Ga0070660_100105722 | 3300005339 | Bacteria | 2234 |
| 14 | Ga0070661_100200696 | 3300005344 | Bacteria | 1524 |
| 15 | Ga0070661_100499704 | 3300005344 | Bacteria | 973 |
| 16 | Ga0070675_100050497 | 3300005354 | Bacteria | 3415 |
| 17 | Ga0070671_100254761 | 3300005355 | Bacteria | 1491 |
| 18 | Ga0070673_100022431 | 3300005364 | Bacteria | 4595 |
| 19 | Ga0070673_100037721 | 3300005364 | Bacteria | 3684 |
| 20 | Ga0070659_100046092 | 3300005366 | Bacteria | 3417 |
| 21 | Ga0070667_100014309 | 3300005367 | Bacteria | 6555 |
| 22 | Ga0070713_100439288 | 3300005436 | Bacteria | 1224 |
| 23 | Ga0070701_10274404 | 3300005438 | Bacteria | 1027 |
| 24 | Ga0070678_100076986 | 3300005456 | Bacteria | 2515 |
| 25 | Ga0070678_100300646 | 3300005456 | Bacteria | 1364 |
| 26 | Ga0070678_100533459 | 3300005456 | Bacteria | 1040 |
| 27 | Ga0070678_100773924 | 3300005456 | Bacteria | 870 |
| 28 | Ga0068867_100006768 | 3300005459 | Bacteria | 8100 |
| 29 | Ga0070679_100006583 | 3300005530 | Bacteria | 10825 |
| 30 | Ga0070679_100029438 | 3300005530 | Bacteria | 5418 |
| 31 | Ga0070684_100057818 | 3300005535 | Bacteria | 3387 |
| 32 | Ga0068853_100753583 | 3300005539 | Bacteria | 931 |
| 33 | Ga0068853_100820955 | 3300005539 | Bacteria | 891 |
| 34 | Ga0070672_100107345 | 3300005543 | Bacteria | 2272 |
| 35 | Ga0070672_100457262 | 3300005543 | Bacteria | 1100 |
| 36 | Ga0070665_100001302 | 3300005548 | Bacteria | 29816 |
| 37 | Ga0070665_100339897 | 3300005548 | Unclassified | 1506 |
| 38 | Ga0070665_100424874 | 3300005548 | Bacteria | 1338 |
| 39 | Ga0070665_100763991 | 3300005548 | Bacteria | 979 |
| 40 | Ga0068855_100072950 | 3300005563 | Bacteria | 3989 |
| 41 | Ga0068855_100092930 | 3300005563 | Bacteria | 3479 |
| 42 | Ga0068855_100118411 | 3300005563 | Bacteria | 3033 |
| 43 | Ga0070664_100636063 | 3300005564 | Bacteria | 991 |
| 44 | Ga0068857_100359595 | 3300005577 | Bacteria | 1349 |
| 45 | Ga0068857_100685243 | 3300005577 | Bacteria | 973 |
| 46 | Ga0068854_100286666 | 3300005578 | Bacteria | 1328 |
| 47 | Ga0068856_100175082 | 3300005614 | Bacteria | 2158 |
| 48 | Ga0068856_100239024 | 3300005614 | Bacteria | 1832 |
| 49 | Ga0068866_10109023 | 3300005718 | Bacteria | 1541 |
| 50 | Ga0068862_101165344 | 3300005844 | Unclassified | 768 |
| 51 | Ga0097621_100000645 | 3300006237 | Bacteria | 24626 |
| 52 | Ga0097621_100013492 | 3300006237 | Bacteria | 6091 |
| 53 | Ga0097621_100021274 | 3300006237 | Bacteria | 5014 |
| 54 | Ga0097621_100714210 | 3300006237 | Unclassified | 924 |
| 55 | Ga0068871_100000378 | 3300006358 | Bacteria | 31128 |
| 56 | Ga0068871_100004686 | 3300006358 | Bacteria | 9558 |
| 57 | Ga0068871_100014898 | 3300006358 | Bacteria | 5811 |
| 58 | Ga0068871_100086984 | 3300006358 | Bacteria | 2597 |
| 59 | Ga0068871_100103994 | 3300006358 | Bacteria | 2381 |
| 60 | Ga0068871_100257388 | 3300006358 | Bacteria | 1522 |
| 61 | Ga0068865_100115437 | 3300006881 | Bacteria | 1987 |
| 62 | Ga0105240_10022529 | 3300009093 | Bacteria | 8348 |
| 63 | Ga0105240_10126249 | 3300009093 | Bacteria | 3074 |
| 64 | Ga0105240_10145714 | 3300009093 | Bacteria | 2826 |
| 65 | Ga0105240_10330835 | 3300009093 | Bacteria | 1734 |
| 66 | Ga0105240_10363452 | 3300009093 | Bacteria | 1639 |
| 67 | Ga0105240_10929882 | 3300009093 | Bacteria | 934 |
| 68 | Ga0105245_10047039 | 3300009098 | Bacteria | 3857 |
| 69 | Ga0105245_10291406 | 3300009098 | Bacteria | 1599 |
| 70 | Ga0105245_10411567 | 3300009098 | Unclassified | 1353 |
| 71 | Ga0105247_10264497 | 3300009101 | Bacteria | 1180 |
| 72 | Ga0105243_10004582 | 3300009148 | Bacteria | 10901 |
| 73 | Ga0105243_10360971 | 3300009148 | Bacteria | 1337 |
| 74 | Ga0105241_10042078 | 3300009174 | Bacteria | 3454 |
| 75 | Ga0105241_10076514 | 3300009174 | Bacteria | 2610 |
| 76 | Ga0105241_10085005 | 3300009174 | Bacteria | 2486 |
| 77 | Ga0105241_10109216 | 3300009174 | Bacteria | 2212 |
| 78 | Ga0105241_10110736 | 3300009174 | Bacteria | 2197 |
| 79 | Ga0105241_10216397 | 3300009174 | Bacteria | 1608 |
| 80 | Ga0105242_10032335 | 3300009176 | Bacteria | 4183 |
| 81 | Ga0105242_10119041 | 3300009176 | Bacteria | 2263 |
| 82 | Ga0105237_10048908 | 3300009545 | Bacteria | 4251 |
| 83 | Ga0105237_10439351 | 3300009545 | Bacteria | 1310 |
| 84 | Ga0105238_10255247 | 3300009551 | Unclassified | 1732 |
| 85 | Ga0105238_10439806 | 3300009551 | Bacteria | 1300 |
| 86 | Ga0105238_10446938 | 3300009551 | Bacteria | 1289 |
| 87 | Ga0105249_10425421 | 3300009553 | Bacteria | 1362 |
| 88 | Ga0105249_10885797 | 3300009553 | Unclassified | 959 |
| 89 | Ga0105239_10520547 | 3300010375 | Bacteria | 1353 |
| 90 | Ga0105239_11668973 | 3300010375 | Bacteria | 737 |
| 91 | Ga0105246_10020319 | 3300011119 | Bacteria | 4258 |
| 92 | Ga0105246_10031434 | 3300011119 | Bacteria | 3513 |
| 93 | Ga0157373_10191593 | 3300013100 | Bacteria | 1441 |
| 94 | Ga0157370_10063084 | 3300013104 | Bacteria | 3512 |
| 95 | Ga0157369_10222688 | 3300013105 | Bacteria | 1974 |
| 96 | Ga0157369_10481864 | 3300013105 | Bacteria | 1284 |
| 97 | Ga0157378_10084333 | 3300013297 | Bacteria | 2876 |
| 98 | Ga0157378_10147173 | 3300013297 | Bacteria | 2192 |
| 99 | Ga0157378_10421460 | 3300013297 | Bacteria | 1319 |
| 100 | Ga0163162_10016765 | 3300013306 | Bacteria | 7161 |
| 101 | Ga0163162_11050021 | 3300013306 | Bacteria | 922 |
| 102 | Ga0157375_10182768 | 3300013308 | Bacteria | 2249 |
| 103 | Ga0163163_10000012 | 3300014325 | Bacteria | 257369 |
| 104 | Ga0157377_10197958 | 3300014745 | Bacteria | 1274 |
| 105 | Ga0157379_10017806 | 3300014968 | Bacteria | 6258 |
| 106 | Ga0157379_10118495 | 3300014968 | Bacteria | 2381 |
| 107 | Ga0157376_10520277 | 3300014969 | Bacteria | 1172 |
| 108 | Ga0157376_11001178 | 3300014969 | Bacteria | 858 |
| 109 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 110 | Ga0209233_1002462 | 3300025261 | Bacteria | 6795 |
| 111 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 112 | Ga0207642_10075141 | 3300025899 | Bacteria | 1622 |
| 113 | Ga0207642_10381403 | 3300025899 | Bacteria | 839 |
| 114 | Ga0207645_10011653 | 3300025907 | Bacteria | 5995 |
| 115 | Ga0207705_10038327 | 3300025909 | Bacteria | 3431 |
| 116 | Ga0207705_10294292 | 3300025909 | Bacteria | 1244 |
| 117 | Ga0207654_10034752 | 3300025911 | Bacteria | 2802 |
| 118 | Ga0207654_10126392 | 3300025911 | Bacteria | 1612 |
| 119 | Ga0207695_10037015 | 3300025913 | Bacteria | 5268 |
| 120 | Ga0207695_10331576 | 3300025913 | Bacteria | 1410 |
| 121 | Ga0207695_10448897 | 3300025913 | Bacteria | 1173 |
| 122 | Ga0207663_10086367 | 3300025916 | Bacteria | 2069 |
| 123 | Ga0207660_10027363 | 3300025917 | Bacteria | 3890 |
| 124 | Ga0207657_10041036 | 3300025919 | Bacteria | 4095 |
| 125 | Ga0207657_10044443 | 3300025919 | Bacteria | 3905 |
| 126 | Ga0207657_10289863 | 3300025919 | Bacteria | 1298 |
| 127 | Ga0207649_10085564 | 3300025920 | Bacteria | 2052 |
| 128 | Ga0207652_10006846 | 3300025921 | Bacteria | 9186 |
| 129 | Ga0207694_10189598 | 3300025924 | Bacteria | 1670 |
| 130 | Ga0207694_10268805 | 3300025924 | Bacteria | 1398 |
| 131 | Ga0207694_10453093 | 3300025924 | Bacteria | 1071 |
| 132 | Ga0207659_10051692 | 3300025926 | Bacteria | 2924 |
| 133 | Ga0207687_10089972 | 3300025927 | Bacteria | 2236 |
| 134 | Ga0207700_10031638 | 3300025928 | Bacteria | 3762 |
| 135 | Ga0207644_10224595 | 3300025931 | Unclassified | 1490 |
| 136 | Ga0207690_10268984 | 3300025932 | Bacteria | 1323 |
| 137 | Ga0207686_10024615 | 3300025934 | Bacteria | 3491 |
| 138 | Ga0207709_10026963 | 3300025935 | Bacteria | 3305 |
| 139 | Ga0207709_10218781 | 3300025935 | Bacteria | 1372 |
| 140 | Ga0207704_10109744 | 3300025938 | Bacteria | 1862 |
| 141 | Ga0207691_10076792 | 3300025940 | Bacteria | 3010 |
| 142 | Ga0207691_10393191 | 3300025940 | Bacteria | 1183 |
| 143 | Ga0207689_10239024 | 3300025942 | Unclassified | 1501 |
| 144 | Ga0207661_10145369 | 3300025944 | Bacteria | 2045 |
| 145 | Ga0207679_10667432 | 3300025945 | Bacteria | 941 |
| 146 | Ga0207667_10144449 | 3300025949 | Bacteria | 2449 |
| 147 | Ga0207667_10202058 | 3300025949 | Bacteria | 2038 |
| 148 | Ga0207651_10022119 | 3300025960 | Bacteria | 3880 |
| 149 | Ga0207712_11239545 | 3300025961 | Unclassified | 666 |
| 150 | Ga0207668_11173039 | 3300025972 | Unclassified | 690 |
| 151 | Ga0207677_10027703 | 3300026023 | Bacteria | 3574 |
| 152 | Ga0207677_10094170 | 3300026023 | Bacteria | 2186 |
| 153 | Ga0207639_10111974 | 3300026041 | Bacteria | 2226 |
| 154 | Ga0207639_10526136 | 3300026041 | Bacteria | 1083 |
| 155 | Ga0207702_10140614 | 3300026078 | Bacteria | 2184 |
| 156 | Ga0207702_10265341 | 3300026078 | Bacteria | 1618 |
| 157 | Ga0207702_10361619 | 3300026078 | Bacteria | 1391 |
| 158 | Ga0207648_10015507 | 3300026089 | Bacteria | 7006 |
| 159 | Ga0207676_10559158 | 3300026095 | Bacteria | 1094 |
| 160 | Ga0207676_11494304 | 3300026095 | Bacteria | 672 |
| 161 | Ga0207674_10169935 | 3300026116 | Bacteria | 2134 |
| 162 | Ga0207674_10227707 | 3300026116 | Bacteria | 1812 |
| 163 | Ga0207674_10360067 | 3300026116 | Bacteria | 1406 |
| 164 | Ga0207683_10061762 | 3300026121 | Bacteria | 3298 |
| 165 | Ga0207683_10074936 | 3300026121 | Bacteria | 2995 |
| 166 | Ga0207683_10179152 | 3300026121 | Bacteria | 1921 |
| 167 | Ga0207683_10449354 | 3300026121 | Bacteria | 1188 |
| 168 | Ga0207698_10074578 | 3300026142 | Bacteria | 2707 |
| 169 | Ga0268266_10000847 | 3300028379 | Bacteria | 39858 |
| 170 | Ga0268266_10020890 | 3300028379 | Bacteria | 5582 |
| 171 | Ga0268266_10242095 | 3300028379 | Bacteria | 1665 |
| 172 | Ga0268266_10296702 | 3300028379 | Bacteria | 1507 |
| 173 | Ga0268264_10022837 | 3300028381 | Bacteria | 5104 |
| 174 | Ga0265338_10004163 | 3300028800 | Bacteria | 19762 |
| 175 | Ga0265328_10041844 | 3300031239 | Bacteria | 1687 |
| 176 | Ga0265314_10019520 | 3300031711 | Bacteria | 5252 |
| 177 | Ga0265314_10187911 | 3300031711 | Bacteria | 1232 |
| 178 | Ga0265342_10209731 | 3300031712 | Bacteria | 1054 |
| 179 | Ga0373942_0124734 | 3300035207 | Bacteria | 808 |
| 180 | Ga0373937_0534471 | 3300036401 | Unclassified | 1114 |
| 181 | Ga0395900_1081230 | 3300037418 | Bacteria | 720 |
| 182 | Ga0395901_0007907 | 3300038443 | Bacteria | 10728 |
| 183 | Ga0436365_1772165 | 3300039437 | Bacteria | 1793 |
| 184 | Ga0436360_0594672 | 3300039438 | Bacteria | 668 |
| 185 | Ga0436361_0833633 | 3300039447 | Bacteria | 1539 |
| 186 | Ga0466967_0543708 | 3300045976 | Bacteria | 1143 |
| 187 | Ga0495618_0335032 | 3300046514 | Bacteria | 935 |
| 188 | Ga0495654_0031268 | 3300046530 | Bacteria | 2703 |
| 189 | Ga0495622_0003848 | 3300046557 | Bacteria | 7010 |
| 190 | Ga0495633_0404645 | 3300046558 | Bacteria | 617 |
| 191 | Ga0495657_0235764 | 3300046675 | Bacteria | 1105 |
| 192 | Ga0495604_0130430 | 3300047317 | Bacteria | 1808 |
| 193 | Ga0495672_0071562 | 3300047320 | Bacteria | 1962 |
| 194 | Ga0495602_0109442 | 3300048088 | Bacteria | 2247 |
| 195 | Ga0496121_0001324 | 3300048924 | Bacteria | 42408 |
| 196 | Ga0496126_0184743 | 3300048929 | Unclassified | 1769 |
| 197 | Ga0501032_0006720 | 3300049569 | Bacteria | 8442 |
| 198 | Ga0501033_0006487 | 3300049570 | Bacteria | 9154 |
| 199 | Ga0501033_0062610 | 3300049570 | Bacteria | 2739 |
| 200 | Ga0501033_0116061 | 3300049570 | Bacteria | 1945 |
| 201 | Ga0501033_0191251 | 3300049570 | Bacteria | 1464 |
| 202 | Ga0501034_0088413 | 3300049571 | Bacteria | 3096 |
| 203 | Ga0501034_0172732 | 3300049571 | Bacteria | 2128 |
| 204 | Ga0501034_0424003 | 3300049571 | Unclassified | 1251 |
| 205 | Ga0501036_0021259 | 3300049572 | Bacteria | 5452 |
| 206 | Ga0501036_0290341 | 3300049572 | Bacteria | 1368 |
| 207 | Ga0501036_0969643 | 3300049572 | Bacteria | 696 |
| 208 | Ga0501037_0002338 | 3300049573 | Bacteria | 13695 |
| 209 | Ga0501037_0131138 | 3300049573 | Bacteria | 1797 |
| 210 | Ga0501038_0007059 | 3300049574 | Bacteria | 10370 |
| 211 | Ga0501038_0113500 | 3300049574 | Bacteria | 2242 |
| 212 | Ga0501038_0127400 | 3300049574 | Bacteria | 2094 |
| 213 | Ga0501039_0405326 | 3300049575 | Bacteria | 1071 |
| 214 | Ga0501042_0040575 | 3300049578 | Bacteria | 3309 |
| 215 | Ga0501043_0029545 | 3300049579 | Bacteria | 4307 |
| 216 | Ga0501046_0018738 | 3300049580 | Bacteria | 5752 |
| 217 | Ga0501046_0149255 | 3300049580 | Bacteria | 1764 |
| 218 | Ga0501046_0159663 | 3300049580 | Bacteria | 1696 |
| 219 | Ga0501047_0013462 | 3300049581 | Bacteria | 7754 |
| 220 | Ga0501047_0019777 | 3300049581 | Bacteria | 6463 |
| 221 | Ga0501047_0037385 | 3300049581 | Bacteria | 4695 |
| 222 | Ga0501047_0121859 | 3300049581 | Bacteria | 2489 |
| 223 | Ga0501048_0024256 | 3300049582 | Bacteria | 4427 |
| 224 | Ga0501067_0003570 | 3300049583 | Bacteria | 8565 |
| 225 | Ga0501070_0008382 | 3300049586 | Bacteria | 8731 |
| 226 | Ga0501072_0016344 | 3300049588 | Bacteria | 5694 |
| 227 | Ga0501073_0174138 | 3300049589 | Bacteria | 1489 |
| 228 | Ga0501073_0761600 | 3300049589 | Unclassified | 667 |
| 229 | Ga0501074_0006786 | 3300049590 | Bacteria | 8265 |
| 230 | Ga0501079_0010616 | 3300049741 | Bacteria | 7009 |
| 231 | Ga0501080_0017530 | 3300049742 | Bacteria | 6622 |
| 232 | Ga0501035_0034206 | 3300049822 | Bacteria | 4619 |
| 233 | Ga0501035_0051128 | 3300049822 | Bacteria | 3701 |
| 234 | Ga0501035_0162500 | 3300049822 | Bacteria | 1932 |
| 235 | Ga0501035_0308133 | 3300049822 | Bacteria | 1333 |
| 236 | Ga0501044_0002877 | 3300049823 | Bacteria | 19588 |
| 237 | Ga0501044_0085207 | 3300049823 | Bacteria | 3193 |
| 238 | Ga0501044_0289594 | 3300049823 | Bacteria | 1569 |
| 239 | Ga0501044_0950165 | 3300049823 | Bacteria | 733 |
| 240 | Ga0500635_0040918 | 3300053080 | Bacteria | 1548 |
| 241 | Ga0500643_000027 | 3300053087 | Bacteria | 251062 |
| 242 | Ga0500555_109555 | 3300053103 | Unclassified | 696 |
| 243 | Ga0500594_0131029 | 3300053118 | Bacteria | 794 |
| 244 | Ga0500595_003834 | 3300053119 | Bacteria | 6912 |
| 245 | Ga0500595_004398 | 3300053119 | Bacteria | 6331 |
| 246 | Ga0500595_067944 | 3300053119 | Bacteria | 1062 |
| 247 | Ga0500559_0050049 | 3300053136 | Bacteria | 1843 |
| 248 | Ga0500611_013878 | 3300053727 | Bacteria | 1393 |
| 249 | Ga0500587_026462 | 3300053739 | Bacteria | 778 |
| 250 | Ga0501084_0008317 | 3300054114 | Bacteria | 8563 |
| 251 | Ga0501082_0010204 | 3300060353 | Bacteria | 8086 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0088413 | Ga0501034_0088413_1048_1635 | 165 |
| 2 | 3300049823 | Ga0501044_0085207 | Ga0501044_0085207_343_930 | 165 |
| 3 | 3300005366 | Ga0070659_100046092 | Ga0070659_1000460922 | 169 |
| 4 | 3300005577 | Ga0068857_100359595 | Ga0068857_1003595952 | 169 |
| 5 | 3300025909 | Ga0207705_10294292 | Ga0207705_102942922 | 169 |
| 6 | 3300025919 | Ga0207657_10289863 | Ga0207657_102898632 | 169 |
| 7 | 3300026116 | Ga0207674_10169935 | Ga0207674_101699352 | 169 |
| 8 | 3300039438 | Ga0436360_0594672 | Ga0436360_0594672_28_615 | 174 |
| 9 | 3300039447 | Ga0436361_0833633 | Ga0436361_0833633_647_1234 | 174 |
| 10 | 3300049575 | Ga0501039_0405326 | Ga0501039_0405326_322_909 | 175 |
| 11 | 3300049570 | Ga0501033_0116061 | Ga0501033_0116061_631_1176 | 181 |
| 12 | 3300049571 | Ga0501034_0424003 | Ga0501034_0424003_604_1149 | 181 |
| 13 | 3300049573 | Ga0501037_0131138 | Ga0501037_0131138_1029_1574 | 181 |
| 14 | 3300049574 | Ga0501038_0127400 | Ga0501038_0127400_1220_1765 | 181 |
| 15 | 3300049579 | Ga0501043_0029545 | Ga0501043_0029545_917_1462 | 181 |
| 16 | 3300049580 | Ga0501046_0149255 | Ga0501046_0149255_196_741 | 181 |
| 17 | 3300049581 | Ga0501047_0013462 | Ga0501047_0013462_5060_5605 | 181 |
| 18 | 3300049822 | Ga0501035_0034206 | Ga0501035_0034206_2392_2937 | 181 |
| 19 | 3300049823 | Ga0501044_0002877 | Ga0501044_0002877_17551_18096 | 181 |
| 20 | 3300006358 | Ga0068871_100004686 | Ga0068871_1000046866 | 182 |
| 21 | 3300009148 | Ga0105243_10360971 | Ga0105243_103609712 | 182 |
| 22 | 3300025935 | Ga0207709_10218781 | Ga0207709_102187812 | 182 |
| 23 | 3300049570 | Ga0501033_0062610 | Ga0501033_0062610_2139_2726 | 184 |
| 24 | 3300049572 | Ga0501036_0021259 | Ga0501036_0021259_4852_5439 | 184 |
| 25 | 3300049573 | Ga0501037_0002338 | Ga0501037_0002338_7879_8466 | 184 |
| 26 | 3300049580 | Ga0501046_0018738 | Ga0501046_0018738_3100_3687 | 184 |
| 27 | 3300049586 | Ga0501070_0008382 | Ga0501070_0008382_5963_6550 | 184 |
| 28 | 3300049588 | Ga0501072_0016344 | Ga0501072_0016344_4799_5386 | 184 |
| 29 | 3300049589 | Ga0501073_0761600 | Ga0501073_0761600_14_601 | 184 |
| 30 | 3300049742 | Ga0501080_0017530 | Ga0501080_0017530_73_660 | 184 |
| 31 | 3300046558 | Ga0495633_0404645 | Ga0495633_0404645_14_574 | 186 |
| 32 | 3300049569 | Ga0501032_0006720 | Ga0501032_0006720_708_1295 | 187 |
| 33 | 3300049570 | Ga0501033_0191251 | Ga0501033_0191251_14_601 | 187 |
| 34 | 3300049572 | Ga0501036_0290341 | Ga0501036_0290341_14_601 | 187 |
| 35 | 3300049574 | Ga0501038_0007059 | Ga0501038_0007059_8417_9004 | 187 |
| 36 | 3300049578 | Ga0501042_0040575 | Ga0501042_0040575_2133_2720 | 187 |
| 37 | 3300049582 | Ga0501048_0024256 | Ga0501048_0024256_390_977 | 187 |
| 38 | 3300049583 | Ga0501067_0003570 | Ga0501067_0003570_454_1041 | 187 |
| 39 | 3300049589 | Ga0501073_0174138 | Ga0501073_0174138_889_1476 | 187 |
| 40 | 3300049590 | Ga0501074_0006786 | Ga0501074_0006786_864_1451 | 187 |
| 41 | 3300049741 | Ga0501079_0010616 | Ga0501079_0010616_5575_6162 | 187 |
| 42 | 3300049822 | Ga0501035_0051128 | Ga0501035_0051128_15_602 | 187 |
| 43 | 3300049822 | Ga0501035_0162500 | Ga0501035_0162500_228_809 | 187 |
| 44 | 3300054114 | Ga0501084_0008317 | Ga0501084_0008317_7348_7935 | 187 |
| 45 | 3300060353 | Ga0501082_0010204 | Ga0501082_0010204_82_669 | 187 |
| 46 | 3300009093 | Ga0105240_10929882 | Ga0105240_109298822 | 192 |
| 47 | 3300009174 | Ga0105241_10216397 | Ga0105241_102163972 | 192 |
| 48 | 3300013105 | Ga0157369_10222688 | Ga0157369_102226883 | 192 |
| 49 | 3300013297 | Ga0157378_10084333 | Ga0157378_100843333 | 193 |
| 50 | 3300049572 | Ga0501036_0969643 | Ga0501036_0969643_67_648 | 193 |
| 51 | 3300049580 | Ga0501046_0159663 | Ga0501046_0159663_91_672 | 193 |
| 52 | 3300049581 | Ga0501047_0121859 | Ga0501047_0121859_833_1414 | 193 |
| 53 | 3300049823 | Ga0501044_0950165 | Ga0501044_0950165_10_591 | 193 |
| 54 | 3300053739 | Ga0500587_026462 | Ga0500587_026462_113_694 | 193 |
| 55 | 3300003320 | rootH2_10011554 | rootH2_100115542 | 195 |
| 56 | 3300005327 | Ga0070658_10010006 | Ga0070658_100100062 | 195 |
| 57 | 3300005328 | Ga0070676_10017083 | Ga0070676_100170834 | 195 |
| 58 | 3300005333 | Ga0070677_10087194 | Ga0070677_100871942 | 195 |
| 59 | 3300005334 | Ga0068869_100048935 | Ga0068869_1000489352 | 195 |
| 60 | 3300005334 | Ga0068869_100067023 | Ga0068869_1000670233 | 195 |
| 61 | 3300005336 | Ga0070680_100055048 | Ga0070680_1000550483 | 195 |
| 62 | 3300005338 | Ga0068868_100052577 | Ga0068868_1000525774 | 195 |
| 63 | 3300005338 | Ga0068868_100164000 | Ga0068868_1001640002 | 195 |
| 64 | 3300005339 | Ga0070660_100085621 | Ga0070660_1000856212 | 195 |
| 65 | 3300005339 | Ga0070660_100105722 | Ga0070660_1001057222 | 195 |
| 66 | 3300005344 | Ga0070661_100200696 | Ga0070661_1002006962 | 195 |
| 67 | 3300005344 | Ga0070661_100499704 | Ga0070661_1004997041 | 195 |
| 68 | 3300005354 | Ga0070675_100050497 | Ga0070675_1000504973 | 195 |
| 69 | 3300005355 | Ga0070671_100254761 | Ga0070671_1002547612 | 195 |
| 70 | 3300005364 | Ga0070673_100022431 | Ga0070673_1000224313 | 195 |
| 71 | 3300005364 | Ga0070673_100037721 | Ga0070673_1000377214 | 195 |
| 72 | 3300005367 | Ga0070667_100014309 | Ga0070667_1000143093 | 195 |
| 73 | 3300005436 | Ga0070713_100439288 | Ga0070713_1004392882 | 195 |
| 74 | 3300005438 | Ga0070701_10274404 | Ga0070701_102744042 | 195 |
| 75 | 3300005456 | Ga0070678_100076986 | Ga0070678_1000769863 | 195 |
| 76 | 3300005456 | Ga0070678_100300646 | Ga0070678_1003006462 | 195 |
| 77 | 3300005456 | Ga0070678_100533459 | Ga0070678_1005334591 | 195 |
| 78 | 3300005456 | Ga0070678_100773924 | Ga0070678_1007739242 | 195 |
| 79 | 3300005459 | Ga0068867_100006768 | Ga0068867_1000067686 | 195 |
| 80 | 3300005530 | Ga0070679_100006583 | Ga0070679_1000065837 | 195 |
| 81 | 3300005530 | Ga0070679_100029438 | Ga0070679_1000294386 | 195 |
| 82 | 3300005535 | Ga0070684_100057818 | Ga0070684_1000578184 | 195 |
| 83 | 3300005539 | Ga0068853_100753583 | Ga0068853_1007535832 | 195 |
| 84 | 3300005539 | Ga0068853_100820955 | Ga0068853_1008209551 | 195 |
| 85 | 3300005543 | Ga0070672_100107345 | Ga0070672_1001073452 | 195 |
| 86 | 3300005543 | Ga0070672_100457262 | Ga0070672_1004572622 | 195 |
| 87 | 3300005548 | Ga0070665_100001302 | Ga0070665_10000130221 | 195 |
| 88 | 3300005548 | Ga0070665_100339897 | Ga0070665_1003398972 | 195 |
| 89 | 3300005548 | Ga0070665_100424874 | Ga0070665_1004248742 | 195 |
| 90 | 3300005563 | Ga0068855_100072950 | Ga0068855_1000729501 | 195 |
| 91 | 3300005563 | Ga0068855_100092930 | Ga0068855_1000929303 | 195 |
| 92 | 3300005563 | Ga0068855_100118411 | Ga0068855_1001184114 | 195 |
| 93 | 3300005564 | Ga0070664_100636063 | Ga0070664_1006360631 | 195 |
| 94 | 3300005578 | Ga0068854_100286666 | Ga0068854_1002866662 | 195 |
| 95 | 3300005614 | Ga0068856_100175082 | Ga0068856_1001750822 | 195 |
| 96 | 3300005614 | Ga0068856_100239024 | Ga0068856_1002390242 | 195 |
| 97 | 3300005718 | Ga0068866_10109023 | Ga0068866_101090232 | 195 |
| 98 | 3300005844 | Ga0068862_101165344 | Ga0068862_1011653442 | 195 |
| 99 | 3300006237 | Ga0097621_100000645 | Ga0097621_10000064520 | 195 |
| 100 | 3300006237 | Ga0097621_100013492 | Ga0097621_1000134924 | 195 |
| 101 | 3300006237 | Ga0097621_100021274 | Ga0097621_1000212743 | 195 |
| 102 | 3300006237 | Ga0097621_100714210 | Ga0097621_1007142102 | 195 |
| 103 | 3300006358 | Ga0068871_100000378 | Ga0068871_10000037815 | 195 |
| 104 | 3300006358 | Ga0068871_100014898 | Ga0068871_1000148987 | 195 |
| 105 | 3300006358 | Ga0068871_100086984 | Ga0068871_1000869842 | 195 |
| 106 | 3300006358 | Ga0068871_100103994 | Ga0068871_1001039942 | 195 |
| 107 | 3300006358 | Ga0068871_100257388 | Ga0068871_1002573882 | 195 |
| 108 | 3300006881 | Ga0068865_100115437 | Ga0068865_1001154372 | 195 |
| 109 | 3300009093 | Ga0105240_10022529 | Ga0105240_100225293 | 195 |
| 110 | 3300009093 | Ga0105240_10126249 | Ga0105240_101262492 | 195 |
| 111 | 3300009093 | Ga0105240_10145714 | Ga0105240_101457142 | 195 |
| 112 | 3300009093 | Ga0105240_10330835 | Ga0105240_103308352 | 195 |
| 113 | 3300009093 | Ga0105240_10363452 | Ga0105240_103634522 | 195 |
| 114 | 3300009098 | Ga0105245_10047039 | Ga0105245_100470392 | 195 |
| 115 | 3300009098 | Ga0105245_10291406 | Ga0105245_102914062 | 195 |
| 116 | 3300009098 | Ga0105245_10411567 | Ga0105245_104115672 | 195 |
| 117 | 3300009101 | Ga0105247_10264497 | Ga0105247_102644972 | 195 |
| 118 | 3300009148 | Ga0105243_10004582 | Ga0105243_100045829 | 195 |
| 119 | 3300009174 | Ga0105241_10042078 | Ga0105241_100420784 | 195 |
| 120 | 3300009174 | Ga0105241_10076514 | Ga0105241_100765142 | 195 |
| 121 | 3300009174 | Ga0105241_10085005 | Ga0105241_100850052 | 195 |
| 122 | 3300009174 | Ga0105241_10109216 | Ga0105241_101092162 | 195 |
| 123 | 3300009174 | Ga0105241_10110736 | Ga0105241_101107362 | 195 |
| 124 | 3300009176 | Ga0105242_10032335 | Ga0105242_100323353 | 195 |
| 125 | 3300009176 | Ga0105242_10119041 | Ga0105242_101190412 | 195 |
| 126 | 3300009545 | Ga0105237_10048908 | Ga0105237_100489084 | 195 |
| 127 | 3300009545 | Ga0105237_10439351 | Ga0105237_104393512 | 195 |
| 128 | 3300009551 | Ga0105238_10255247 | Ga0105238_102552473 | 195 |
| 129 | 3300009551 | Ga0105238_10439806 | Ga0105238_104398061 | 195 |
| 130 | 3300009551 | Ga0105238_10446938 | Ga0105238_104469382 | 195 |
| 131 | 3300009553 | Ga0105249_10425421 | Ga0105249_104254212 | 195 |
| 132 | 3300009553 | Ga0105249_10885797 | Ga0105249_108857972 | 195 |
| 133 | 3300010375 | Ga0105239_10520547 | Ga0105239_105205472 | 195 |
| 134 | 3300010375 | Ga0105239_11668973 | Ga0105239_116689731 | 195 |
| 135 | 3300011119 | Ga0105246_10020319 | Ga0105246_100203193 | 195 |
| 136 | 3300011119 | Ga0105246_10031434 | Ga0105246_100314343 | 195 |
| 137 | 3300013100 | Ga0157373_10191593 | Ga0157373_101915932 | 195 |
| 138 | 3300013104 | Ga0157370_10063084 | Ga0157370_100630845 | 195 |
| 139 | 3300013105 | Ga0157369_10481864 | Ga0157369_104818642 | 195 |
| 140 | 3300013297 | Ga0157378_10147173 | Ga0157378_101471733 | 195 |
| 141 | 3300013297 | Ga0157378_10421460 | Ga0157378_104214602 | 195 |
| 142 | 3300013306 | Ga0163162_10016765 | Ga0163162_100167653 | 195 |
| 143 | 3300013306 | Ga0163162_11050021 | Ga0163162_110500212 | 195 |
| 144 | 3300013308 | Ga0157375_10182768 | Ga0157375_101827683 | 195 |
| 145 | 3300014325 | Ga0163163_10000012 | Ga0163163_10000012112 | 195 |
| 146 | 3300014745 | Ga0157377_10197958 | Ga0157377_101979582 | 195 |
| 147 | 3300014968 | Ga0157379_10017806 | Ga0157379_100178065 | 195 |
| 148 | 3300014968 | Ga0157379_10118495 | Ga0157379_101184953 | 195 |
| 149 | 3300014969 | Ga0157376_10520277 | Ga0157376_105202772 | 195 |
| 150 | 3300014969 | Ga0157376_11001178 | Ga0157376_110011781 | 195 |
| 151 | 3300025899 | Ga0207642_10075141 | Ga0207642_100751412 | 195 |
| 152 | 3300025899 | Ga0207642_10381403 | Ga0207642_103814032 | 195 |
| 153 | 3300025907 | Ga0207645_10011653 | Ga0207645_100116535 | 195 |
| 154 | 3300025909 | Ga0207705_10038327 | Ga0207705_100383272 | 195 |
| 155 | 3300025911 | Ga0207654_10034752 | Ga0207654_100347522 | 195 |
| 156 | 3300025911 | Ga0207654_10126392 | Ga0207654_101263922 | 195 |
| 157 | 3300025913 | Ga0207695_10037015 | Ga0207695_100370153 | 195 |
| 158 | 3300025913 | Ga0207695_10331576 | Ga0207695_103315762 | 195 |
| 159 | 3300025913 | Ga0207695_10448897 | Ga0207695_104488972 | 195 |
| 160 | 3300025916 | Ga0207663_10086367 | Ga0207663_100863672 | 195 |
| 161 | 3300025917 | Ga0207660_10027363 | Ga0207660_100273636 | 195 |
| 162 | 3300025919 | Ga0207657_10041036 | Ga0207657_100410363 | 195 |
| 163 | 3300025919 | Ga0207657_10044443 | Ga0207657_100444434 | 195 |
| 164 | 3300025920 | Ga0207649_10085564 | Ga0207649_100855642 | 195 |
| 165 | 3300025921 | Ga0207652_10006846 | Ga0207652_100068462 | 195 |
| 166 | 3300025924 | Ga0207694_10189598 | Ga0207694_101895982 | 195 |
| 167 | 3300025924 | Ga0207694_10268805 | Ga0207694_102688052 | 195 |
| 168 | 3300025924 | Ga0207694_10453093 | Ga0207694_104530932 | 195 |
| 169 | 3300025926 | Ga0207659_10051692 | Ga0207659_100516923 | 195 |
| 170 | 3300025927 | Ga0207687_10089972 | Ga0207687_100899722 | 195 |
| 171 | 3300025928 | Ga0207700_10031638 | Ga0207700_100316386 | 195 |
| 172 | 3300025931 | Ga0207644_10224595 | Ga0207644_102245952 | 195 |
| 173 | 3300025932 | Ga0207690_10268984 | Ga0207690_102689842 | 195 |
| 174 | 3300025934 | Ga0207686_10024615 | Ga0207686_100246153 | 195 |
| 175 | 3300025935 | Ga0207709_10026963 | Ga0207709_100269631 | 195 |
| 176 | 3300025938 | Ga0207704_10109744 | Ga0207704_101097443 | 195 |
| 177 | 3300025940 | Ga0207691_10076792 | Ga0207691_100767923 | 195 |
| 178 | 3300025940 | Ga0207691_10393191 | Ga0207691_103931912 | 195 |
| 179 | 3300025942 | Ga0207689_10239024 | Ga0207689_102390242 | 195 |
| 180 | 3300025944 | Ga0207661_10145369 | Ga0207661_101453692 | 195 |
| 181 | 3300025945 | Ga0207679_10667432 | Ga0207679_106674322 | 195 |
| 182 | 3300025949 | Ga0207667_10144449 | Ga0207667_101444493 | 195 |
| 183 | 3300025949 | Ga0207667_10202058 | Ga0207667_102020583 | 195 |
| 184 | 3300025960 | Ga0207651_10022119 | Ga0207651_100221193 | 195 |
| 185 | 3300025961 | Ga0207712_11239545 | Ga0207712_112395451 | 195 |
| 186 | 3300025972 | Ga0207668_11173039 | Ga0207668_111730392 | 195 |
| 187 | 3300026023 | Ga0207677_10027703 | Ga0207677_100277034 | 195 |
| 188 | 3300026023 | Ga0207677_10094170 | Ga0207677_100941702 | 195 |
| 189 | 3300026041 | Ga0207639_10111974 | Ga0207639_101119743 | 195 |
| 190 | 3300026041 | Ga0207639_10526136 | Ga0207639_105261362 | 195 |
| 191 | 3300026078 | Ga0207702_10140614 | Ga0207702_101406142 | 195 |
| 192 | 3300026078 | Ga0207702_10265341 | Ga0207702_102653412 | 195 |
| 193 | 3300026078 | Ga0207702_10361619 | Ga0207702_103616192 | 195 |
| 194 | 3300026089 | Ga0207648_10015507 | Ga0207648_100155077 | 195 |
| 195 | 3300026095 | Ga0207676_10559158 | Ga0207676_105591582 | 195 |
| 196 | 3300026095 | Ga0207676_11494304 | Ga0207676_114943041 | 195 |
| 197 | 3300026116 | Ga0207674_10227707 | Ga0207674_102277073 | 195 |
| 198 | 3300026121 | Ga0207683_10061762 | Ga0207683_100617623 | 195 |
| 199 | 3300026121 | Ga0207683_10074936 | Ga0207683_100749362 | 195 |
| 200 | 3300026121 | Ga0207683_10179152 | Ga0207683_101791523 | 195 |
| 201 | 3300026121 | Ga0207683_10449354 | Ga0207683_104493542 | 195 |
| 202 | 3300026142 | Ga0207698_10074578 | Ga0207698_100745783 | 195 |
| 203 | 3300028379 | Ga0268266_10000847 | Ga0268266_1000084715 | 195 |
| 204 | 3300028379 | Ga0268266_10020890 | Ga0268266_100208902 | 195 |
| 205 | 3300028379 | Ga0268266_10242095 | Ga0268266_102420952 | 195 |
| 206 | 3300028381 | Ga0268264_10022837 | Ga0268264_100228372 | 195 |
| 207 | 3300028800 | Ga0265338_10004163 | Ga0265338_1000416321 | 195 |
| 208 | 3300031239 | Ga0265328_10041844 | Ga0265328_100418442 | 195 |
| 209 | 3300031711 | Ga0265314_10019520 | Ga0265314_100195204 | 195 |
| 210 | 3300035207 | Ga0373942_0124734 | Ga0373942_0124734_146_748 | 195 |
| 211 | 3300036401 | Ga0373937_0534471 | Ga0373937_0534471_351_953 | 195 |
| 212 | 3300037418 | Ga0395900_1081230 | Ga0395900_1081230_118_705 | 195 |
| 213 | 3300038443 | Ga0395901_0007907 | Ga0395901_0007907_4063_4668 | 195 |
| 214 | 3300039437 | Ga0436365_1772165 | Ga0436365_1772165_659_1246 | 195 |
| 215 | 3300045976 | Ga0466967_0543708 | Ga0466967_0543708_498_1103 | 195 |
| 216 | 3300046514 | Ga0495618_0335032 | Ga0495618_0335032_275_862 | 195 |
| 217 | 3300046557 | Ga0495622_0003848 | Ga0495622_0003848_1719_2306 | 195 |
| 218 | 3300046675 | Ga0495657_0235764 | Ga0495657_0235764_360_947 | 195 |
| 219 | 3300047320 | Ga0495672_0071562 | Ga0495672_0071562_897_1484 | 195 |
| 220 | 3300048924 | Ga0496121_0001324 | Ga0496121_0001324_4329_4931 | 195 |
| 221 | 3300048929 | Ga0496126_0184743 | Ga0496126_0184743_425_1015 | 195 |
| 222 | 3300049570 | Ga0501033_0006487 | Ga0501033_0006487_3278_3865 | 195 |
| 223 | 3300049571 | Ga0501034_0172732 | Ga0501034_0172732_157_759 | 195 |
| 224 | 3300049574 | Ga0501038_0113500 | Ga0501038_0113500_87_674 | 195 |
| 225 | 3300049581 | Ga0501047_0019777 | Ga0501047_0019777_4968_5555 | 195 |
| 226 | 3300049581 | Ga0501047_0037385 | Ga0501047_0037385_833_1420 | 195 |
| 227 | 3300049822 | Ga0501035_0308133 | Ga0501035_0308133_255_842 | 195 |
| 228 | 3300049823 | Ga0501044_0289594 | Ga0501044_0289594_269_856 | 195 |
| 229 | 3300053080 | Ga0500635_0040918 | Ga0500635_0040918_606_1193 | 195 |
| 230 | 3300053087 | Ga0500643_000027 | Ga0500643_000027_35152_35739 | 195 |
| 231 | 3300053103 | Ga0500555_109555 | Ga0500555_109555_63_650 | 195 |
| 232 | 3300053118 | Ga0500594_0131029 | Ga0500594_0131029_127_714 | 195 |
| 233 | 3300053119 | Ga0500595_003834 | Ga0500595_003834_1544_2134 | 195 |
| 234 | 3300053119 | Ga0500595_004398 | Ga0500595_004398_4233_4820 | 195 |
| 235 | 3300053119 | Ga0500595_067944 | Ga0500595_067944_381_983 | 195 |
| 236 | 3300053136 | Ga0500559_0050049 | Ga0500559_0050049_460_1047 | 195 |
| 237 | 3300053727 | Ga0500611_013878 | Ga0500611_013878_294_881 | 195 |
| 238 | 3300003214 | JGI25165J46597_1000035 | JGI25165J46597_1000035138 | 197 |
| 239 | 3300003215 | JGI25153J46596_10000400 | JGI25153J46596_1000040016 | 197 |
| 240 | 3300005548 | Ga0070665_100763991 | Ga0070665_1007639912 | 197 |
| 241 | 3300005577 | Ga0068857_100685243 | Ga0068857_1006852432 | 197 |
| 242 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006631 | 197 |
| 243 | 3300025261 | Ga0209233_1002462 | Ga0209233_10024624 | 197 |
| 244 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008307 | 197 |
| 245 | 3300026116 | Ga0207674_10360067 | Ga0207674_103600672 | 197 |
| 246 | 3300028379 | Ga0268266_10296702 | Ga0268266_102967021 | 197 |
| 247 | 3300031711 | Ga0265314_10187911 | Ga0265314_101879112 | 197 |
| 248 | 3300031712 | Ga0265342_10209731 | Ga0265342_102097312 | 197 |
| 249 | 3300046530 | Ga0495654_0031268 | Ga0495654_0031268_100_702 | 197 |
| 250 | 3300047317 | Ga0495604_0130430 | Ga0495604_0130430_971_1567 | 197 |
| 251 | 3300048088 | Ga0495602_0109442 | Ga0495602_0109442_738_1334 | 197 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4heb-assembly1.cif.gz_A | the crystal structure of maf protein of bacillus subtilis | 0.921 | 1 | 191 |
| 1exc-assembly1.cif.gz_A | crystal structure of b. subtilis maf protein complexed with d-(utp) | 0.9176 | 2 | 191 |
| 4heb-assembly1.cif.gz_B | the crystal structure of maf protein of bacillus subtilis | 0.9164 | 2 | 195 |
| 4heb-assembly1.cif.gz_A | the crystal structure of maf protein of bacillus subtilis | 0.9115 | 1 | 191 |
| 4jhc-assembly1.cif.gz_B | crystal structure of the uncharacterized maf protein ycef from e. coli | 0.9055 | 1 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hebA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.921 | 1 | 191 | 3.90.950.10 |
| 4hebA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9115 | 1 | 191 | 3.90.950.10 |
| 4p0uA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.8959 | 2 | 195 | 3.90.950.10 |
| 4p0uA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.8913 | 2 | 195 | 3.90.950.10 |
| af_Q86BM0_10_204_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.8881 | 2 | 191 | 3.90.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H9EC17-F1-model_v4 | Nucleoside triphosphate pyrophosphatase (EC 3.6.1.9) (Nucleotide pyrophosphatase) (Nucleotide PPase) | 0.9817 | 2 | 191 |
GO:0005737
GO:0009117 GO:0106379 |
| AF-A0A523FQK1-F1-model_v4 | Nucleoside triphosphate pyrophosphatase (EC 3.6.1.9) (Nucleotide pyrophosphatase) (Nucleotide PPase) | 0.9781 | 3 | 197 |
GO:0005737
GO:0009117 GO:0106379 |
| AF-A0A1S7M4D4-F1-model_v4 | deleted | 0.9779 | 1 | 197 |
|
| AF-A0A356FVI0-F1-model_v4 | Nucleoside triphosphate pyrophosphatase (EC 3.6.1.9) (Nucleotide pyrophosphatase) (Nucleotide PPase) | 0.9775 | 2 | 197 |
GO:0005737
GO:0009117 GO:0106379 |
| AF-A0A857ANF6-F1-model_v4 | deleted | 0.9772 | 1 | 197 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar