F362395

General Info

Members Datasets Scaffolds Average Seq Length
251 167 502 223

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10080450|Ga0105249_100804503
Length 251
Sequence VADIGATQNDKDVSVPFRFLRTYAARTTRSPRRLVLVTTVRPALDPALRHTIALRTEALFRSSGAFREGHFLLKSGRHGDAYVEKFQVLQDPAATSELCGFFAEHGRAADRELLVDLVAGPTTGGIILAFETARQLGVRSIFAEEVRADDGTTHREFRRGFRIVPGERVLLVDDILTTGGSLLAMIPAVEARTTLTSPSTGRVYAVRSLWELDLPTYEPGPATCPRCADGTPLYAPGSTGTGSIAAGAAAS

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
107 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
110 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
111 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.75
Rhizosphere 86.45
Stem 0
Stem Tuber 0
Unclassified 11.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10080450 3300009553 Bacteria 3027
2 Ga0070690_100028878 3300005330 Bacteria 3438
3 Ga0070670_100313716 3300005331 Bacteria 1373
4 Ga0068869_100104418 3300005334 Bacteria 2148
5 Ga0070680_100388420 3300005336 Bacteria 1189
6 Ga0070682_100023110 3300005337 Bacteria 3690
7 Ga0068868_100084829 3300005338 Bacteria 2544
8 Ga0070660_100071137 3300005339 Bacteria 2716
9 Ga0070689_100007541 3300005340 Bacteria 7617
10 Ga0070661_100052265 3300005344 Bacteria 2991
11 Ga0070668_100107750 3300005347 Bacteria 2215
12 Ga0070669_100220923 3300005353 Bacteria 1498
13 Ga0070675_100032270 3300005354 Bacteria 4237
14 Ga0070674_100017508 3300005356 Bacteria 4510
15 Ga0070674_100038125 3300005356 Bacteria 3237
16 Ga0070673_100002091 3300005364 Bacteria 12056
17 Ga0070688_100009015 3300005365 Bacteria 5438
18 Ga0070688_100449684 3300005365 Bacteria 963
19 Ga0070659_100009425 3300005366 Bacteria 7169
20 Ga0070659_100390721 3300005366 Bacteria 1173
21 Ga0070701_10027904 3300005438 Bacteria 2771
22 Ga0070705_100157923 3300005440 Unclassified 1513
23 Ga0070708_100001796 3300005445 Bacteria 16471
24 Ga0070708_100017911 3300005445 Bacteria 5921
25 Ga0070678_100058301 3300005456 Bacteria 2833
26 Ga0070662_100066191 3300005457 Bacteria 2651
27 Ga0070681_10685733 3300005458 Bacteria 940
28 Ga0068867_100006980 3300005459 Bacteria 7983
29 Ga0068867_100704590 3300005459 Unclassified 891
30 Ga0068867_100735419 3300005459 Bacteria 874
31 Ga0070685_10003052 3300005466 Bacteria 8537
32 Ga0070707_100390317 3300005468 Unclassified 1352
33 Ga0070698_100067529 3300005471 Bacteria 3595
34 Ga0070699_100200462 3300005518 Bacteria 1775
35 Ga0070679_100988894 3300005530 Bacteria 785
36 Ga0070672_100355088 3300005543 Bacteria 1250
37 Ga0070686_100004646 3300005544 Bacteria 7572
38 Ga0070693_100045422 3300005547 Bacteria 2490
39 Ga0070693_100256599 3300005547 Bacteria 1161
40 Ga0070693_100324671 3300005547 Unclassified 1045
41 Ga0070665_100296933 3300005548 Bacteria 1618
42 Ga0070704_100090883 3300005549 Bacteria 2275
43 Ga0070704_100844026 3300005549 Bacteria 821
44 Ga0070664_100131771 3300005564 Bacteria 2196
45 Ga0068857_100473537 3300005577 Unclassified 1173
46 Ga0068857_100777073 3300005577 Bacteria 913
47 Ga0068864_100044225 3300005618 Unclassified 3816
48 Ga0068864_100598263 3300005618 Unclassified 1070
49 Ga0068866_10032619 3300005718 Bacteria 2520
50 Ga0068851_10126585 3300005834 Bacteria 1378
51 Ga0068870_10012136 3300005840 Bacteria 4018
52 Ga0068863_100073627 3300005841 Unclassified 3232
53 Ga0068863_100425002 3300005841 Unclassified 1302
54 Ga0068863_100676497 3300005841 Bacteria 1025
55 Ga0068858_100023052 3300005842 Bacteria 5807
56 Ga0068858_100271554 3300005842 Bacteria 1614
57 Ga0068858_100536576 3300005842 Bacteria 1132
58 Ga0068860_100052693 3300005843 Bacteria 3869
59 Ga0068862_100183360 3300005844 Bacteria 1880
60 Ga0081455_10255605 3300005937 Bacteria 1278
61 Ga0075434_100184347 3300006871 Bacteria 2108
62 Ga0068865_100014898 3300006881 Bacteria 4950
63 Ga0075436_100213008 3300006914 Bacteria 1370
64 Ga0111539_10011372 3300009094 Bacteria 11173
65 Ga0111539_10062864 3300009094 Bacteria 4393
66 Ga0111539_10131201 3300009094 Bacteria 2934
67 Ga0105245_10140697 3300009098 Bacteria 2272
68 Ga0105247_10084974 3300009101 Bacteria 2000
69 Ga0114129_10051317 3300009147 Bacteria 5791
70 Ga0114129_10174989 3300009147 Bacteria 2924
71 Ga0105243_10005482 3300009148 Bacteria 9896
72 Ga0105241_10103336 3300009174 Bacteria 2269
73 Ga0105242_10005542 3300009176 Bacteria 9745
74 Ga0105242_10094318 3300009176 Bacteria 2524
75 Ga0105242_10273518 3300009176 Bacteria 1531
76 Ga0105248_10015925 3300009177 Bacteria 8280
77 Ga0105248_10522517 3300009177 Bacteria 1338
78 Ga0105249_10007339 3300009553 Bacteria 9611
79 Ga0105246_10021473 3300011119 Bacteria 4155
80 Ga0105246_10748860 3300011119 Bacteria 861
81 Ga0105246_10828609 3300011119 Bacteria 823
82 Ga0157375_10006260 3300013308 Bacteria 10368
83 Ga0157375_11852626 3300013308 Bacteria 716
84 Ga0163163_10013964 3300014325 Bacteria 7370
85 Ga0163163_10077379 3300014325 Bacteria 3322
86 Ga0163163_10110976 3300014325 Bacteria 2771
87 Ga0163163_10272383 3300014325 Unclassified 1744
88 Ga0157380_10005834 3300014326 Bacteria 8622
89 Ga0157380_10211386 3300014326 Bacteria 1729
90 Ga0157380_10672913 3300014326 Bacteria 1036
91 Ga0182008_10215932 3300014497 Bacteria 980
92 Ga0157377_10123509 3300014745 Bacteria 1572
93 Ga0157379_10037095 3300014968 Unclassified 4346
94 Ga0157379_10052391 3300014968 Bacteria 3645
95 Ga0157379_10579519 3300014968 Unclassified 1046
96 Ga0163161_10023907 3300017792 Bacteria 4313
97 Ga0163161_10079856 3300017792 Bacteria 2406
98 Ga0163161_10199746 3300017792 Bacteria 1540
99 Ga0207642_10045947 3300025899 Bacteria 1942
100 Ga0207688_10008876 3300025901 Bacteria 5469
101 Ga0207643_10003062 3300025908 Bacteria 8992
102 Ga0207684_10004235 3300025910 Bacteria 13614
103 Ga0207707_10186790 3300025912 Bacteria 1809
104 Ga0207663_10391491 3300025916 Bacteria 1061
105 Ga0207649_10450502 3300025920 Bacteria 971
106 Ga0207652_10538430 3300025921 Bacteria 1050
107 Ga0207646_10460189 3300025922 Bacteria 1147
108 Ga0207681_10411490 3300025923 Bacteria 1094
109 Ga0207650_10252817 3300025925 Bacteria 1427
110 Ga0207659_10212558 3300025926 Bacteria 1551
111 Ga0207700_10609450 3300025928 Bacteria 972
112 Ga0207690_10301306 3300025932 Bacteria 1254
113 Ga0207690_10381955 3300025932 Bacteria 1120
114 Ga0207706_10022728 3300025933 Bacteria 5629
115 Ga0207706_10146280 3300025933 Bacteria 2079
116 Ga0207706_10360540 3300025933 Bacteria 1263
117 Ga0207686_10164835 3300025934 Bacteria 1557
118 Ga0207665_10235575 3300025939 Bacteria 1347
119 Ga0207689_10612276 3300025942 Bacteria 916
120 Ga0207679_10119441 3300025945 Bacteria 2095
121 Ga0207651_10139454 3300025960 Bacteria 1870
122 Ga0207712_10061269 3300025961 Bacteria 2670
123 Ga0207668_10163360 3300025972 Bacteria 1738
124 Ga0207640_10021036 3300025981 Bacteria 3881
125 Ga0207640_10243174 3300025981 Bacteria 1392
126 Ga0207677_10028563 3300026023 Bacteria 3530
127 Ga0207703_10260387 3300026035 Bacteria 1568
128 Ga0207703_10364601 3300026035 Bacteria 1333
129 Ga0207678_10010529 3300026067 Bacteria 8121
130 Ga0207678_10314896 3300026067 Unclassified 1346
131 Ga0207708_10001098 3300026075 Bacteria 20259
132 Ga0207708_10652098 3300026075 Bacteria 896
133 Ga0207708_10703959 3300026075 Bacteria 864
134 Ga0207702_10261985 3300026078 Bacteria 1628
135 Ga0207641_10060062 3300026088 Bacteria 3240
136 Ga0207641_10076539 3300026088 Bacteria 2893
137 Ga0207641_10101404 3300026088 Bacteria 2537
138 Ga0207641_10629270 3300026088 Bacteria 1053
139 Ga0207648_10007157 3300026089 Bacteria 11002
140 Ga0207676_10144966 3300026095 Unclassified 2038
141 Ga0207676_10737676 3300026095 Bacteria 957
142 Ga0207674_10012073 3300026116 Bacteria 9675
143 Ga0207674_10295396 3300026116 Bacteria 1569
144 Ga0207675_100053019 3300026118 Bacteria 3785
145 Ga0207675_100551246 3300026118 Bacteria 1152
146 Ga0207675_100582510 3300026118 Bacteria 1120
147 Ga0207683_10025769 3300026121 Bacteria 5073
148 Ga0207683_10080290 3300026121 Unclassified 2893
149 Ga0207683_10285708 3300026121 Bacteria 1508
150 Ga0207698_10022748 3300026142 Bacteria 4365
151 Ga0209974_10024936 3300027876 Bacteria 1979
152 Ga0207428_10056630 3300027907 Bacteria 3114
153 Ga0268265_10167127 3300028380 Bacteria 1876
154 Ga0268264_10042253 3300028381 Bacteria 3773
155 Ga0265314_10134856 3300031711 Bacteria 1535
156 Ga0316576_10006942 3300031727 Bacteria 7080
157 Ga0316576_10313551 3300031727 Unclassified 1171
158 Ga0316578_10196654 3300031728 Bacteria 1214
159 Ga0316577_10000112 3300031733 Bacteria 22926
160 Ga0307407_10145722 3300031903 Bacteria 1533
161 Ga0373952_0031961 3300035092 Bacteria 1173
162 Ga0373942_0086097 3300035207 Bacteria 940
163 Ga0373962_0017834 3300035242 Bacteria 1842
164 Ga0316574_0013524 3300035398 Bacteria 4695
165 Ga0316574_0023940 3300035398 Bacteria 3651
166 Ga0316581_0069160 3300037588 Bacteria 1084
167 Ga0395901_0883441 3300038443 Bacteria 877
168 Ga0451853_1259533 3300041512 Bacteria 2895
169 Ga0451853_2936535 3300041512 Unclassified 1665
170 Ga0451577_0660890 3300042876 Bacteria 947
171 Ga0495651_0021907 3300046462 Bacteria 4969
172 Ga0495644_0149341 3300046523 Bacteria 894
173 Ga0495656_0148925 3300046615 Bacteria 1129
174 Ga0495634_0281430 3300046642 Bacteria 1010
175 Ga0495669_0168130 3300046684 Bacteria 1042
176 Ga0495613_0195100 3300046689 Unclassified 1430
177 Ga0495600_0269266 3300046809 Bacteria 1081
178 Ga0495680_0040510 3300047322 Bacteria 3711
179 Ga0495680_0105120 3300047322 Unclassified 2100
180 Ga0496100_0099014 3300048903 Unclassified 2005
181 Ga0496101_0025234 3300048904 Bacteria 4122
182 Ga0496101_0162555 3300048904 Bacteria 1713
183 Ga0496101_0208567 3300048904 Bacteria 1513
184 Ga0496102_0121388 3300048905 Bacteria 2441
185 Ga0496102_0185426 3300048905 Unclassified 1961
186 Ga0496104_0022695 3300048907 Bacteria 5764
187 Ga0496104_0197484 3300048907 Bacteria 1924
188 Ga0496104_0201267 3300048907 Bacteria 1903
189 Ga0496105_0173487 3300048908 Bacteria 1767
190 Ga0496105_0252287 3300048908 Bacteria 1429
191 Ga0496106_0025615 3300048909 Bacteria 4391
192 Ga0496108_0019523 3300048911 Bacteria 5567
193 Ga0496108_0049596 3300048911 Bacteria 3511
194 Ga0496109_0054679 3300048912 Bacteria 3641
195 Ga0496109_0077288 3300048912 Bacteria 3063
196 Ga0496109_0112110 3300048912 Bacteria 2536
197 Ga0496109_0119693 3300048912 Bacteria 2452
198 Ga0496109_0129428 3300048912 Bacteria 2355
199 Ga0496109_0212542 3300048912 Unclassified 1819
200 Ga0496110_0014724 3300048913 Bacteria 6499
201 Ga0496110_0016843 3300048913 Bacteria 6108
202 Ga0496110_0844190 3300048913 Bacteria 821
203 Ga0496111_0052814 3300048914 Bacteria 2935
204 Ga0496111_0073481 3300048914 Unclassified 2490
205 Ga0496111_0299787 3300048914 Bacteria 1191
206 Ga0496112_0199886 3300048915 Bacteria 1958
207 Ga0496112_0492807 3300048915 Bacteria 1161
208 Ga0496112_0665978 3300048915 Bacteria 970
209 Ga0496113_0265566 3300048916 Bacteria 1371
210 Ga0496114_0011314 3300048917 Bacteria 7127
211 Ga0496114_0568100 3300048917 Bacteria 1001
212 Ga0501036_0373407 3300049572 Unclassified 1190
213 Ga0501039_0035743 3300049575 Bacteria 3835
214 Ga0501040_0005713 3300049576 Bacteria 8048
215 Ga0501041_0015006 3300049577 Bacteria 4601
216 Ga0501042_0450811 3300049578 Bacteria 933
217 Ga0501043_0215101 3300049579 Unclassified 1489
218 Ga0501043_0438020 3300049579 Bacteria 984
219 Ga0501046_0114326 3300049580 Unclassified 2059
220 Ga0501048_0071725 3300049582 Bacteria 2445
221 Ga0501068_0085194 3300049584 Unclassified 1945
222 Ga0501068_0425665 3300049584 Bacteria 857
223 Ga0501069_0094017 3300049585 Bacteria 1696
224 Ga0501069_0417825 3300049585 Bacteria 795
225 Ga0501071_0012522 3300049587 Bacteria 5755
226 Ga0501071_0375978 3300049587 Bacteria 1083
227 Ga0501072_0011113 3300049588 Bacteria 6872
228 Ga0501074_0132981 3300049590 Bacteria 1779
229 Ga0501075_0095000 3300049591 Bacteria 2262
230 Ga0501076_0029837 3300049592 Bacteria 4243
231 Ga0501076_0047893 3300049592 Bacteria 3380
232 Ga0501076_0103200 3300049592 Unclassified 2300
233 Ga0501079_0270819 3300049741 Unclassified 1327
234 Ga0501080_0672604 3300049742 Bacteria 915
235 Ga0501081_0175810 3300049743 Bacteria 1547
236 Ga0501083_0040132 3300049744 Bacteria 3178
237 Ga0501035_0295549 3300049822 Bacteria 1366
238 Ga0501045_0108510 3300049824 Bacteria 2057
239 Ga0501045_0305890 3300049824 Bacteria 1183
240 Ga0501045_0757390 3300049824 Bacteria 716
241 nmdc:mga05p37_86035_c1 3300050507 Bacteria 3874
242 nmdc:mga08y16_292394_c1 3300050511 Bacteria 1680
243 nmdc:mga0n895_32720_c1 3300050512 Bacteria 4992
244 nmdc:mga0rr50_171424_c1 3300050513 Bacteria 759
245 Ga0495601_0018424 3300053077 Bacteria 4250
246 Ga0495595_0010255 3300053084 Bacteria 3891
247 Ga0495595_0118221 3300053084 Bacteria 1290
248 Ga0495619_0093895 3300053085 Bacteria 2034
249 Ga0501084_0093495 3300054114 Bacteria 2525
250 Ga0501084_0143062 3300054114 Unclassified 2014
251 Ga0501082_0022430 3300060353 Bacteria 5438
252 Ga0105249_10080450
253 Ga0070690_100028878
254 Ga0070670_100313716
255 Ga0068869_100104418
256 Ga0070680_100388420
257 Ga0070682_100023110
258 Ga0068868_100084829
259 Ga0070660_100071137
260 Ga0070689_100007541
261 Ga0070661_100052265
262 Ga0070668_100107750
263 Ga0070669_100220923
264 Ga0070675_100032270
265 Ga0070674_100017508
266 Ga0070674_100038125
267 Ga0070673_100002091
268 Ga0070688_100009015
269 Ga0070688_100449684
270 Ga0070659_100009425
271 Ga0070659_100390721
272 Ga0070701_10027904
273 Ga0070705_100157923
274 Ga0070708_100001796
275 Ga0070708_100017911
276 Ga0070678_100058301
277 Ga0070662_100066191
278 Ga0070681_10685733
279 Ga0068867_100006980
280 Ga0068867_100704590
281 Ga0068867_100735419
282 Ga0070685_10003052
283 Ga0070707_100390317
284 Ga0070698_100067529
285 Ga0070699_100200462
286 Ga0070679_100988894
287 Ga0070672_100355088
288 Ga0070686_100004646
289 Ga0070693_100045422
290 Ga0070693_100256599
291 Ga0070693_100324671
292 Ga0070665_100296933
293 Ga0070704_100090883
294 Ga0070704_100844026
295 Ga0070664_100131771
296 Ga0068857_100473537
297 Ga0068857_100777073
298 Ga0068864_100044225
299 Ga0068864_100598263
300 Ga0068866_10032619
301 Ga0068851_10126585
302 Ga0068870_10012136
303 Ga0068863_100073627
304 Ga0068863_100425002
305 Ga0068863_100676497
306 Ga0068858_100023052
307 Ga0068858_100271554
308 Ga0068858_100536576
309 Ga0068860_100052693
310 Ga0068862_100183360
311 Ga0081455_10255605
312 Ga0075434_100184347
313 Ga0068865_100014898
314 Ga0075436_100213008
315 Ga0111539_10011372
316 Ga0111539_10062864
317 Ga0111539_10131201
318 Ga0105245_10140697
319 Ga0105247_10084974
320 Ga0114129_10051317
321 Ga0114129_10174989
322 Ga0105243_10005482
323 Ga0105241_10103336
324 Ga0105242_10005542
325 Ga0105242_10094318
326 Ga0105242_10273518
327 Ga0105248_10015925
328 Ga0105248_10522517
329 Ga0105249_10007339
330 Ga0105246_10021473
331 Ga0105246_10748860
332 Ga0105246_10828609
333 Ga0157375_10006260
334 Ga0157375_11852626
335 Ga0163163_10013964
336 Ga0163163_10077379
337 Ga0163163_10110976
338 Ga0163163_10272383
339 Ga0157380_10005834
340 Ga0157380_10211386
341 Ga0157380_10672913
342 Ga0182008_10215932
343 Ga0157377_10123509
344 Ga0157379_10037095
345 Ga0157379_10052391
346 Ga0157379_10579519
347 Ga0163161_10023907
348 Ga0163161_10079856
349 Ga0163161_10199746
350 Ga0207642_10045947
351 Ga0207688_10008876
352 Ga0207643_10003062
353 Ga0207684_10004235
354 Ga0207707_10186790
355 Ga0207663_10391491
356 Ga0207649_10450502
357 Ga0207652_10538430
358 Ga0207646_10460189
359 Ga0207681_10411490
360 Ga0207650_10252817
361 Ga0207659_10212558
362 Ga0207700_10609450
363 Ga0207690_10301306
364 Ga0207690_10381955
365 Ga0207706_10022728
366 Ga0207706_10146280
367 Ga0207706_10360540
368 Ga0207686_10164835
369 Ga0207665_10235575
370 Ga0207689_10612276
371 Ga0207679_10119441
372 Ga0207651_10139454
373 Ga0207712_10061269
374 Ga0207668_10163360
375 Ga0207640_10021036
376 Ga0207640_10243174
377 Ga0207677_10028563
378 Ga0207703_10260387
379 Ga0207703_10364601
380 Ga0207678_10010529
381 Ga0207678_10314896
382 Ga0207708_10001098
383 Ga0207708_10652098
384 Ga0207708_10703959
385 Ga0207702_10261985
386 Ga0207641_10060062
387 Ga0207641_10076539
388 Ga0207641_10101404
389 Ga0207641_10629270
390 Ga0207648_10007157
391 Ga0207676_10144966
392 Ga0207676_10737676
393 Ga0207674_10012073
394 Ga0207674_10295396
395 Ga0207675_100053019
396 Ga0207675_100551246
397 Ga0207675_100582510
398 Ga0207683_10025769
399 Ga0207683_10080290
400 Ga0207683_10285708
401 Ga0207698_10022748
402 Ga0209974_10024936
403 Ga0207428_10056630
404 Ga0268265_10167127
405 Ga0268264_10042253
406 Ga0265314_10134856
407 Ga0316576_10006942
408 Ga0316576_10313551
409 Ga0316578_10196654
410 Ga0316577_10000112
411 Ga0307407_10145722
412 Ga0373952_0031961
413 Ga0373942_0086097
414 Ga0373962_0017834
415 Ga0316574_0013524
416 Ga0316574_0023940
417 Ga0316581_0069160
418 Ga0395901_0883441
419 Ga0451853_1259533
420 Ga0451853_2936535
421 Ga0451577_0660890
422 Ga0495651_0021907
423 Ga0495644_0149341
424 Ga0495656_0148925
425 Ga0495634_0281430
426 Ga0495669_0168130
427 Ga0495613_0195100
428 Ga0495600_0269266
429 Ga0495680_0040510
430 Ga0495680_0105120
431 Ga0496100_0099014
432 Ga0496101_0025234
433 Ga0496101_0162555
434 Ga0496101_0208567
435 Ga0496102_0121388
436 Ga0496102_0185426
437 Ga0496104_0022695
438 Ga0496104_0197484
439 Ga0496104_0201267
440 Ga0496105_0173487
441 Ga0496105_0252287
442 Ga0496106_0025615
443 Ga0496108_0019523
444 Ga0496108_0049596
445 Ga0496109_0054679
446 Ga0496109_0077288
447 Ga0496109_0112110
448 Ga0496109_0119693
449 Ga0496109_0129428
450 Ga0496109_0212542
451 Ga0496110_0014724
452 Ga0496110_0016843
453 Ga0496110_0844190
454 Ga0496111_0052814
455 Ga0496111_0073481
456 Ga0496111_0299787
457 Ga0496112_0199886
458 Ga0496112_0492807
459 Ga0496112_0665978
460 Ga0496113_0265566
461 Ga0496114_0011314
462 Ga0496114_0568100
463 Ga0501036_0373407
464 Ga0501039_0035743
465 Ga0501040_0005713
466 Ga0501041_0015006
467 Ga0501042_0450811
468 Ga0501043_0215101
469 Ga0501043_0438020
470 Ga0501046_0114326
471 Ga0501048_0071725
472 Ga0501068_0085194
473 Ga0501068_0425665
474 Ga0501069_0094017
475 Ga0501069_0417825
476 Ga0501071_0012522
477 Ga0501071_0375978
478 Ga0501072_0011113
479 Ga0501074_0132981
480 Ga0501075_0095000
481 Ga0501076_0029837
482 Ga0501076_0047893
483 Ga0501076_0103200
484 Ga0501079_0270819
485 Ga0501080_0672604
486 Ga0501081_0175810
487 Ga0501083_0040132
488 Ga0501035_0295549
489 Ga0501045_0108510
490 Ga0501045_0305890
491 Ga0501045_0757390
492 nmdc:mga05p37_86035_c1
493 nmdc:mga08y16_292394_c1
494 nmdc:mga0n895_32720_c1
495 nmdc:mga0rr50_171424_c1
496 Ga0495601_0018424
497 Ga0495595_0010255
498 Ga0495595_0118221
499 Ga0495619_0093895
500 Ga0501084_0093495
501 Ga0501084_0143062
502 Ga0501082_0022430

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

87

195

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h06-assembly1.cif.gz_A crystal structure of human phosphoribosyl pyrophosphate synthetase 1 0.7304 88 145
3lpn-assembly1.cif.gz_B crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp). 0.7019 58 145
2aee-assembly1.cif.gz_B crystal structure of orotate phosphoribosyltransferase from streptococcus pyogenes 0.6998 51 145
4f8e-assembly1.cif.gz_B crystal structure of human prs1 d52h mutant 0.6972 88 145
1vdm-assembly1.cif.gz_E crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 0.6947 63 147
ID Description Score Start End Superfamily
af_Q54QU9_156_292_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7541 88 143 3.40.50.2020
af_P87171_178_299_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7167 79 145 3.40.50.2020
af_A0A0G2JSV3_147_290_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7113 63 145 3.40.50.2020
3lpnA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7045 59 150 3.40.50.2020
af_Q4DXW9_37_140_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6804 88 143 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A1D2QYQ7-F1-model_v4 ribose-phosphate diphosphokinase (EC 2.7.6.1) 0.7833 88 145 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301
AF-A0A0F8YP20-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.7572 44 152
AF-A0A1V5R032-F1-model_v4 ribose-phosphate diphosphokinase (EC 2.7.6.1) 0.7572 63 150 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301
AF-A0A7W0FV69-F1-model_v4 ribose-phosphate diphosphokinase (EC 2.7.6.1) 0.7431 63 145 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301
AF-A0A497H4H9-F1-model_v4 ribose-phosphate diphosphokinase (EC 2.7.6.1) 0.7388 59 151 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301

Map