F362331

General Info

Members Datasets Scaffolds Average Seq Length
251 160 250 223

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100161385|Ga0075429_1001613853
Length 242
Sequence MKITRRGFVGAAAAGLSVVRVGWAAESAPPAAPAKKKEGDLVTLFNGKSLDGWYIFLRDPDKNPRPKNADPEGIFKVHDGMIHVLGKEFGYIATEKEFDDFHLTVEFKWGEQKFAPRLDKKRDSGILYRFPADKEDKVWPHSIECQVQEGDCGDFWMIAGTTVKAGGATQDRFFQKTRDGERPTGEWNTVEVIADGGNLSHIVNGVVVAEATECSVAKGRIVLQSEGAEVFYRKAELRPLRT

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
133 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
152 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
153 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
156 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
157 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.33
Nodule 0
Rhizoplane 0.4
Rhizosphere 76.89
Stem 0
Stem Tuber 0
Unclassified 6.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002292 3300001989 Bacteria 7366
2 JGI24744J21845_10049849 3300002077 Bacteria 772
3 rootH1_10016010 3300003316 Bacteria 1907
4 rootH1_10016010 3300003323 Bacteria 8233
5 rootH1_10123648 3300003316 Bacteria 2328
6 rootH2_10249741 3300003320 Bacteria 1934
7 rootL2_10061131 3300003322 Bacteria 3728
8 rootH1_10119607 3300003323 Bacteria 13579
9 Ga0055526_1007255 3300003771 Bacteria 5810
10 Ga0055526_1013603 3300003771 Bacteria 3426
11 Ga0055528_1000180 3300003790 Bacteria 53597
12 Ga0055528_1000828 3300003790 Bacteria 21193
13 Ga0055530_10001406 3300003791 Bacteria 17709
14 Ga0055531_10034474 3300003794 Bacteria 1605
15 Ga0055543_1010536 3300004625 Bacteria 1933
16 Ga0065165_1000019 3300005262 Bacteria 271815
17 Ga0065704_10082549 3300005289 Bacteria 3586
18 Ga0065712_10131501 3300005290 Bacteria 1539
19 Ga0070676_10000984 3300005328 Bacteria 14163
20 Ga0070670_100027824 3300005331 Bacteria 4863
21 Ga0070670_100112127 3300005331 Bacteria 2350
22 Ga0068869_100010701 3300005334 Bacteria 5989
23 Ga0068869_100020528 3300005334 Unclassified 4531
24 Ga0068869_100465926 3300005334 Bacteria 1050
25 Ga0070666_10000728 3300005335 Bacteria 19966
26 Ga0070689_100022653 3300005340 Bacteria 4693
27 Ga0070669_100018071 3300005353 Bacteria 5036
28 Ga0070675_100117364 3300005354 Bacteria 2258
29 Ga0070671_100304328 3300005355 Bacteria 1357
30 Ga0070674_100187157 3300005356 Bacteria 1590
31 Ga0070673_100002543 3300005364 Bacteria 11136
32 Ga0070688_100171855 3300005365 Bacteria 1496
33 Ga0070667_100072964 3300005367 Unclassified 2926
34 Ga0070667_100167194 3300005367 Bacteria 1940
35 Ga0070662_100284309 3300005457 Bacteria 1339
36 Ga0068867_100259399 3300005459 Bacteria 1416
37 Ga0070685_10592663 3300005466 Bacteria 797
38 Ga0070698_100041549 3300005471 Bacteria 4720
39 Ga0070698_100192183 3300005471 Unclassified 1978
40 Ga0068853_100070045 3300005539 Bacteria 3052
41 Ga0068853_100157451 3300005539 Bacteria 2047
42 Ga0068853_100181624 3300005539 Bacteria 1908
43 Ga0068853_100550793 3300005539 Bacteria 1092
44 Ga0070672_100062233 3300005543 Bacteria 2944
45 Ga0070672_100152070 3300005543 Bacteria 1915
46 Ga0070672_100658841 3300005543 Bacteria 915
47 Ga0068855_100676056 3300005563 Bacteria 1107
48 Ga0068857_100037830 3300005577 Bacteria 4275
49 Ga0068857_100376985 3300005577 Bacteria 1317
50 Ga0068857_100448928 3300005577 Bacteria 1205
51 Ga0068856_100012730 3300005614 Bacteria 8144
52 Ga0068856_100669209 3300005614 Bacteria 1059
53 Ga0068852_100008342 3300005616 Bacteria 7629
54 Ga0068859_100000030 3300005617 Bacteria 175435
55 Ga0068859_100013550 3300005617 Bacteria 8176
56 Ga0068859_100133721 3300005617 Unclassified 2552
57 Ga0068859_100171532 3300005617 Bacteria 2250
58 Ga0068864_100008202 3300005618 Bacteria 8614
59 Ga0068864_100078569 3300005618 Bacteria 2888
60 Ga0068866_10016136 3300005718 Bacteria 3333
61 Ga0068861_100141104 3300005719 Bacteria 1966
62 Ga0068861_100272261 3300005719 Bacteria 1454
63 Ga0068863_100006377 3300005841 Bacteria 11569
64 Ga0068863_100027664 3300005841 Bacteria 5410
65 Ga0068858_100004418 3300005842 Bacteria 13798
66 Ga0068858_100614450 3300005842 Bacteria 1055
67 Ga0068860_100003675 3300005843 Bacteria 15789
68 Ga0068860_100024701 3300005843 Bacteria 5803
69 Ga0068860_100026961 3300005843 Bacteria 5537
70 Ga0068860_100346726 3300005843 Bacteria 1461
71 Ga0068862_100063328 3300005844 Bacteria 3182
72 Ga0075365_10242409 3300006038 Bacteria 1266
73 Ga0075368_10136933 3300006042 Unclassified 1019
74 Ga0075363_100124477 3300006048 Bacteria 1442
75 Ga0075364_10047566 3300006051 Bacteria 2794
76 Ga0075364_10206545 3300006051 Bacteria 1332
77 Ga0075367_10029312 3300006178 Bacteria 3147
78 Ga0075366_10405450 3300006195 Bacteria 839
79 Ga0097621_100003096 3300006237 Bacteria 11411
80 Ga0097621_100062425 3300006237 Bacteria 3059
81 Ga0097621_100101162 3300006237 Bacteria 2425
82 Ga0068871_100000088 3300006358 Bacteria 52878
83 Ga0068871_100005864 3300006358 Bacteria 8637
84 Ga0075428_100098049 3300006844 Bacteria 3195
85 Ga0075430_100030121 3300006846 Bacteria 4608
86 Ga0075431_100098015 3300006847 Bacteria 3027
87 Ga0075429_100002722 3300006880 Bacteria 14922
88 Ga0075429_100161385 3300006880 Bacteria 1963
89 Ga0075429_100262474 3300006880 Bacteria 1512
90 Ga0068865_100002647 3300006881 Bacteria 10637
91 Ga0068865_100246810 3300006881 Bacteria 1407
92 Ga0097620_100000030 3300006931 Bacteria 175435
93 Ga0097620_100013550 3300006931 Bacteria 8176
94 Ga0097620_100133721 3300006931 Unclassified 2552
95 Ga0097620_100171523 3300006931 Bacteria 2250
96 Ga0105240_10232433 3300009093 Bacteria 2142
97 Ga0111539_10030170 3300009094 Bacteria 6594
98 Ga0111539_10405533 3300009094 Bacteria 1588
99 Ga0105245_10986210 3300009098 Bacteria 886
100 Ga0114129_10014367 3300009147 Bacteria 11286
101 Ga0105241_10003450 3300009174 Bacteria 11759
102 Ga0105241_10003959 3300009174 Bacteria 10950
103 Ga0105241_10014837 3300009174 Bacteria 5704
104 Ga0105241_10119761 3300009174 Bacteria 2118
105 Ga0105237_10008035 3300009545 Bacteria 11477
106 Ga0105237_10027908 3300009545 Bacteria 5753
107 Ga0105237_10757175 3300009545 Bacteria 978
108 Ga0105238_10105228 3300009551 Bacteria 2803
109 Ga0105249_10007495 3300009553 Bacteria 9520
110 Ga0105249_10012824 3300009553 Bacteria 7394
111 Ga0105249_10012904 3300009553 Bacteria 7372
112 Ga0105249_10189836 3300009553 Unclassified 2005
113 Ga0105239_10000002 3300010375 Bacteria 610298
114 Ga0105239_10001289 3300010375 Bacteria 33816
115 Ga0105239_10269726 3300010375 Bacteria 1914
116 Ga0105246_10013962 3300011119 Bacteria 5043
117 Ga0105246_10411990 3300011119 Bacteria 1125
118 Ga0157373_10158227 3300013100 Bacteria 1594
119 Ga0157374_10002880 3300013296 Bacteria 14432
120 Ga0157374_10046121 3300013296 Bacteria 4035
121 Ga0157374_10886153 3300013296 Bacteria 910
122 Ga0157378_10014774 3300013297 Bacteria 6838
123 Ga0157378_10071076 3300013297 Unclassified 3125
124 Ga0157378_10158570 3300013297 Bacteria 2114
125 Ga0157378_10259290 3300013297 Bacteria 1667
126 Ga0157378_10263177 3300013297 Bacteria 1656
127 Ga0163162_10000348 3300013306 Bacteria 42027
128 Ga0157372_10617287 3300013307 Bacteria 1264
129 Ga0157372_11118974 3300013307 Unclassified 911
130 Ga0157375_10015027 3300013308 Bacteria 6925
131 Ga0157375_10017919 3300013308 Bacteria 6407
132 Ga0157375_10019406 3300013308 Bacteria 6183
133 Ga0157375_10039865 3300013308 Bacteria 4523
134 Ga0157375_10112862 3300013308 Bacteria 2818
135 Ga0163163_10126638 3300014325 Bacteria 2592
136 Ga0163163_10661334 3300014325 Bacteria 1108
137 Ga0157380_10011967 3300014326 Bacteria 6277
138 Ga0157380_10035545 3300014326 Bacteria 3849
139 Ga0157377_10083145 3300014745 Bacteria 1875
140 Ga0157379_10308618 3300014968 Bacteria 1443
141 Ga0157376_10013959 3300014969 Bacteria 6010
142 Ga0209673_1000042 3300025273 Bacteria 300704
143 Ga0209564_1001966 3300025295 Bacteria 18095
144 Ga0209564_1003438 3300025295 Bacteria 10834
145 Ga0209758_1009193 3300025297 Bacteria 6212
146 Ga0209050_1000308 3300025298 Bacteria 99516
147 Ga0207426_1002881 3300025302 Bacteria 10191
148 Ga0207426_1016074 3300025302 Bacteria 2697
149 Ga0209051_1033489 3300025303 Bacteria 1942
150 Ga0209257_1001319 3300025304 Bacteria 30187
151 Ga0207680_10000415 3300025903 Bacteria 20318
152 Ga0207647_10067475 3300025904 Bacteria 2168
153 Ga0207645_10000413 3300025907 Bacteria 35446
154 Ga0207643_10113602 3300025908 Bacteria 1597
155 Ga0207654_10041080 3300025911 Bacteria 2609
156 Ga0207654_10060562 3300025911 Bacteria 2212
157 Ga0207654_10224917 3300025911 Bacteria 1247
158 Ga0207695_10133826 3300025913 Bacteria 2434
159 Ga0207671_10007785 3300025914 Bacteria 9225
160 Ga0207671_10048310 3300025914 Bacteria 3150
161 Ga0207671_10093615 3300025914 Bacteria 2267
162 Ga0207681_10220049 3300025923 Bacteria 1468
163 Ga0207694_10022181 3300025924 Bacteria 4814
164 Ga0207650_10192792 3300025925 Unclassified 1629
165 Ga0207650_10340640 3300025925 Bacteria 1231
166 Ga0207659_10161172 3300025926 Bacteria 1761
167 Ga0207687_10173378 3300025927 Bacteria 1665
168 Ga0207644_10009732 3300025931 Bacteria 6321
169 Ga0207686_10023909 3300025934 Bacteria 3533
170 Ga0207670_10017026 3300025936 Bacteria 4385
171 Ga0207669_10484140 3300025937 Bacteria 987
172 Ga0207704_10001285 3300025938 Bacteria 11229
173 Ga0207691_10268040 3300025940 Bacteria 1471
174 Ga0207689_10002909 3300025942 Bacteria 15810
175 Ga0207651_10061539 3300025960 Bacteria 2612
176 Ga0207651_10095939 3300025960 Bacteria 2185
177 Ga0207712_10016073 3300025961 Bacteria 4839
178 Ga0207712_10016416 3300025961 Bacteria 4794
179 Ga0207712_10037669 3300025961 Bacteria 3301
180 Ga0207712_10046415 3300025961 Bacteria 3012
181 Ga0207668_10182440 3300025972 Bacteria 1657
182 Ga0207668_10300646 3300025972 Bacteria 1324
183 Ga0207658_10136061 3300025986 Bacteria 1981
184 Ga0207677_10004743 3300026023 Bacteria 7330
185 Ga0207677_10027317 3300026023 Bacteria 3593
186 Ga0207703_10016762 3300026035 Bacteria 5716
187 Ga0207703_10344888 3300026035 Bacteria 1370
188 Ga0207639_10178148 3300026041 Bacteria 1806
189 Ga0207639_10517254 3300026041 Bacteria 1092
190 Ga0207639_10547098 3300026041 Unclassified 1062
191 Ga0207708_10218975 3300026075 Bacteria 1525
192 Ga0207702_10510235 3300026078 Bacteria 1173
193 Ga0207641_10000530 3300026088 Bacteria 42749
194 Ga0207641_10030278 3300026088 Bacteria 4483
195 Ga0207648_10365742 3300026089 Bacteria 1302
196 Ga0207648_10520348 3300026089 Bacteria 1090
197 Ga0207676_10006514 3300026095 Bacteria 8255
198 Ga0207676_10467987 3300026095 Bacteria 1191
199 Ga0207674_10054160 3300026116 Bacteria 4085
200 Ga0207674_10154288 3300026116 Bacteria 2252
201 Ga0207683_10009842 3300026121 Bacteria 8155
202 Ga0207698_10584196 3300026142 Bacteria 1099
203 Ga0209813_10114880 3300027866 Unclassified 931
204 Ga0268265_10620285 3300028380 Bacteria 1036
205 Ga0268264_10002522 3300028381 Bacteria 16094
206 Ga0307515_10000001 3300028794 Bacteria 4259510
207 Ga0307515_10000071 3300028794 Bacteria 238152
208 Ga0307513_10417349 3300031456 Bacteria 1073
209 Ga0307509_10021821 3300031507 Bacteria 7233
210 Ga0307509_10033371 3300031507 Bacteria 5666
211 Ga0307509_10055511 3300031507 Bacteria 4209
212 Ga0307509_10277105 3300031507 Unclassified 1441
213 Ga0307508_10401483 3300031616 Bacteria 962
214 Ga0307414_10049306 3300032004 Bacteria 2911
215 Ga0373927_0026325 3300035695 Bacteria 3801
216 Ga0451789_0266321 3300041443 Unclassified 890
217 Ga0451849_0175157 3300041505 Bacteria 1178
218 Ga0451853_3400995 3300041512 Bacteria 2483
219 Ga0439462_0003563 3300042015 Bacteria 3745
220 Ga0451576_0000214 3300045051 Bacteria 144183
221 Ga0451576_0006914 3300045051 Bacteria 13735
222 Ga0495638_0132416 3300046460 Bacteria 1463
223 Ga0495651_0111294 3300046462 Bacteria 2024
224 Ga0495625_0219858 3300046660 Bacteria 1245
225 Ga0495604_0344400 3300047317 Bacteria 992
226 Ga0495687_002393 3300047443 Bacteria 15128
227 Ga0501043_0730913 3300049579 Unclassified 721
228 Ga0501047_0558604 3300049581 Bacteria 968
229 Ga0501044_0696864 3300049823 Bacteria 901
230 nmdc:mga03n38_250981_c1 3300050490 Unclassified 934
231 nmdc:mga00v17_126711_c1 3300050491 Bacteria 1629
232 nmdc:mga04h51_135020_c1 3300050495 Unclassified 931
233 nmdc:mga05p37_9970_c2 3300050507 Bacteria 6173
234 nmdc:mga09592_138967_c1 3300050508 Bacteria 2093
235 nmdc:mga09592_3731_c1 3300050508 Bacteria 12278
236 nmdc:mga08y16_454339_c1 3300050511 Bacteria 1306
237 nmdc:mga08y16_56899_c1 3300050511 Bacteria 4087
238 Ga0500646_0005459 3300053090 Bacteria 3216
239 Ga0500583_0000053 3300053092 Bacteria 74724
240 Ga0500583_0000638 3300053092 Bacteria 10423
241 Ga0500608_003342 3300053122 Bacteria 5998
242 Ga0500568_0000792 3300053139 Bacteria 22308
243 Ga0500573_0053989 3300053140 Bacteria 2308
244 Ga0500588_0014998 3300053146 Bacteria 1975
245 Ga0500589_120876 3300053147 Unclassified 1109
246 Ga0500616_0001927 3300053153 Bacteria 18513
247 Ga0500616_0137424 3300053153 Bacteria 1146
248 Ga0500619_046387 3300053154 Bacteria 1393
249 Ga0500622_0015401 3300053156 Bacteria 4094
250 Ga0500622_0083807 3300053156 Bacteria 1592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0344400 Ga0495604_0344400_23_625 196
2 3300026089 Ga0207648_10520348 Ga0207648_105203481 197
3 3300049579 Ga0501043_0730913 Ga0501043_0730913_111_704 197
4 3300005334 Ga0068869_100010701 Ga0068869_1000107013 200
5 3300005539 Ga0068853_100181624 Ga0068853_1001816242 200
6 3300005841 Ga0068863_100006377 Ga0068863_1000063775 200
7 3300005843 Ga0068860_100003675 Ga0068860_1000036758 200
8 3300006237 Ga0097621_100101162 Ga0097621_1001011622 200
9 3300011119 Ga0105246_10013962 Ga0105246_100139622 200
10 3300013306 Ga0163162_10000348 Ga0163162_1000034816 200
11 3300025914 Ga0207671_10007785 Ga0207671_100077855 201
12 3300025942 Ga0207689_10002909 Ga0207689_100029096 201
13 3300025961 Ga0207712_10046415 Ga0207712_100464153 201
14 3300026041 Ga0207639_10178148 Ga0207639_101781482 201
15 3300026088 Ga0207641_10000530 Ga0207641_1000053011 201
16 3300026095 Ga0207676_10006514 Ga0207676_100065143 201
17 3300005617 Ga0068859_100013550 Ga0068859_1000135505 207
18 3300006931 Ga0097620_100013550 Ga0097620_1000135505 207
19 3300009545 Ga0105237_10008035 Ga0105237_100080354 207
20 3300045051 Ga0451576_0000214 Ga0451576_0000214_82067_82774 209
21 3300045051 Ga0451576_0006914 Ga0451576_0006914_5747_6460 209
22 3300005335 Ga0070666_10000728 Ga0070666_1000072813 210
23 3300005367 Ga0070667_100072964 Ga0070667_1000729642 210
24 3300005618 Ga0068864_100008202 Ga0068864_1000082024 210
25 3300013296 Ga0157374_10886153 Ga0157374_108861531 210
26 3300014325 Ga0163163_10126638 Ga0163163_101266383 210
27 3300005718 Ga0068866_10016136 Ga0068866_100161362 211
28 3300005719 Ga0068861_100141104 Ga0068861_1001411042 211
29 3300006881 Ga0068865_100246810 Ga0068865_1002468102 211
30 3300025903 Ga0207680_10000415 Ga0207680_1000041513 211
31 3300025927 Ga0207687_10173378 Ga0207687_101733782 211
32 3300025934 Ga0207686_10023909 Ga0207686_100239092 211
33 3300025940 Ga0207691_10268040 Ga0207691_102680402 211
34 3300025960 Ga0207651_10061539 Ga0207651_100615392 211
35 3300025972 Ga0207668_10300646 Ga0207668_103006462 211
36 3300025297 Ga0209758_1009193 Ga0209758_10091932 212
37 3300025302 Ga0207426_1002881 Ga0207426_10028813 212
38 3300025303 Ga0209051_1033489 Ga0209051_10334892 212
39 3300028794 Ga0307515_10000001 Ga0307515_100000013005 214
40 iso_pu_bacteria 2738541278 2738724393 214
41 3300013297 Ga0157378_10263177 Ga0157378_102631772 215
42 iso_pu_bacteria 2896109856 2896111543 215
43 3300002077 JGI24744J21845_10049849 JGI24744J21845_100498491 216
44 3300003316 rootH1_10123648 rootH1_101236481 216
45 3300005290 Ga0065712_10131501 Ga0065712_101315012 216
46 3300005328 Ga0070676_10000984 Ga0070676_100009848 216
47 3300005331 Ga0070670_100027824 Ga0070670_1000278242 216
48 3300005334 Ga0068869_100020528 Ga0068869_1000205282 216
49 3300005340 Ga0070689_100022653 Ga0070689_1000226533 216
50 3300005353 Ga0070669_100018071 Ga0070669_1000180712 216
51 3300005354 Ga0070675_100117364 Ga0070675_1001173642 216
52 3300005355 Ga0070671_100304328 Ga0070671_1003043282 216
53 3300005364 Ga0070673_100002543 Ga0070673_1000025432 216
54 3300005457 Ga0070662_100284309 Ga0070662_1002843092 216
55 3300005459 Ga0068867_100259399 Ga0068867_1002593992 216
56 3300005466 Ga0070685_10592663 Ga0070685_105926631 216
57 3300005539 Ga0068853_100550793 Ga0068853_1005507932 216
58 3300005543 Ga0070672_100062233 Ga0070672_1000622332 216
59 3300005543 Ga0070672_100658841 Ga0070672_1006588412 216
60 3300005563 Ga0068855_100676056 Ga0068855_1006760562 216
61 3300005614 Ga0068856_100669209 Ga0068856_1006692092 216
62 3300005616 Ga0068852_100008342 Ga0068852_1000083422 216
63 3300005617 Ga0068859_100171532 Ga0068859_1001715322 216
64 3300005719 Ga0068861_100272261 Ga0068861_1002722612 216
65 3300005844 Ga0068862_100063328 Ga0068862_1000633282 216
66 3300006237 Ga0097621_100062425 Ga0097621_1000624252 216
67 3300006358 Ga0068871_100000088 Ga0068871_10000008833 216
68 3300006881 Ga0068865_100002647 Ga0068865_1000026472 216
69 3300006931 Ga0097620_100171523 Ga0097620_1001715232 216
70 3300009093 Ga0105240_10232433 Ga0105240_102324332 216
71 3300009094 Ga0111539_10030170 Ga0111539_100301704 216
72 3300009098 Ga0105245_10986210 Ga0105245_109862102 216
73 3300009174 Ga0105241_10003450 Ga0105241_100034502 216
74 3300009174 Ga0105241_10119761 Ga0105241_101197612 216
75 3300009545 Ga0105237_10027908 Ga0105237_100279082 216
76 3300009545 Ga0105237_10757175 Ga0105237_107571752 216
77 3300009551 Ga0105238_10105228 Ga0105238_101052282 216
78 3300009553 Ga0105249_10012904 Ga0105249_100129042 216
79 3300009553 Ga0105249_10189836 Ga0105249_101898363 216
80 3300010375 Ga0105239_10269726 Ga0105239_102697262 216
81 3300011119 Ga0105246_10411990 Ga0105246_104119902 216
82 3300013296 Ga0157374_10002880 Ga0157374_100028802 216
83 3300013297 Ga0157378_10014774 Ga0157378_100147742 216
84 3300013297 Ga0157378_10158570 Ga0157378_101585702 216
85 3300013307 Ga0157372_10617287 Ga0157372_106172871 216
86 3300013308 Ga0157375_10015027 Ga0157375_100150272 216
87 3300013308 Ga0157375_10017919 Ga0157375_100179192 216
88 3300013308 Ga0157375_10039865 Ga0157375_100398651 216
89 3300013308 Ga0157375_10112862 Ga0157375_101128623 216
90 3300014326 Ga0157380_10035545 Ga0157380_100355452 216
91 3300014745 Ga0157377_10083145 Ga0157377_100831452 216
92 3300025904 Ga0207647_10067475 Ga0207647_100674752 216
93 3300025907 Ga0207645_10000413 Ga0207645_100004132 216
94 3300025911 Ga0207654_10060562 Ga0207654_100605622 216
95 3300025914 Ga0207671_10048310 Ga0207671_100483102 216
96 3300025914 Ga0207671_10093615 Ga0207671_100936152 216
97 3300025923 Ga0207681_10220049 Ga0207681_102200492 216
98 3300025924 Ga0207694_10022181 Ga0207694_100221813 216
99 3300025925 Ga0207650_10340640 Ga0207650_103406402 216
100 3300025926 Ga0207659_10161172 Ga0207659_101611721 216
101 3300025931 Ga0207644_10009732 Ga0207644_100097322 216
102 3300025936 Ga0207670_10017026 Ga0207670_100170262 216
103 3300025938 Ga0207704_10001285 Ga0207704_100012852 216
104 3300025960 Ga0207651_10095939 Ga0207651_100959392 216
105 3300025961 Ga0207712_10016073 Ga0207712_100160732 216
106 3300025972 Ga0207668_10182440 Ga0207668_101824402 216
107 3300026023 Ga0207677_10004743 Ga0207677_100047432 216
108 3300026041 Ga0207639_10517254 Ga0207639_105172542 216
109 3300026075 Ga0207708_10218975 Ga0207708_102189752 216
110 3300026078 Ga0207702_10510235 Ga0207702_105102352 216
111 3300026089 Ga0207648_10365742 Ga0207648_103657422 216
112 3300026116 Ga0207674_10054160 Ga0207674_100541602 216
113 3300026121 Ga0207683_10009842 Ga0207683_100098422 216
114 3300026142 Ga0207698_10584196 Ga0207698_105841962 216
115 3300031507 Ga0307509_10021821 Ga0307509_100218215 216
116 3300031507 Ga0307509_10055511 Ga0307509_100555112 216
117 3300046462 Ga0495651_0111294 Ga0495651_0111294_517_1194 216
118 3300047443 Ga0495687_002393 Ga0495687_002393_10337_11014 216
119 3300050511 nmdc:mga08y16_56899_c1 nmdc:mga08y16_56899_c1_171_875 216
120 3300053122 Ga0500608_003342 Ga0500608_003342_188_865 216
121 3300003320 rootH2_10249741 rootH2_102497412 217
122 3300049581 Ga0501047_0558604 Ga0501047_0558604_119_841 217
123 3300049823 Ga0501044_0696864 Ga0501044_0696864_36_689 217
124 3300053139 Ga0500568_0000792 Ga0500568_0000792_1759_2421 217
125 3300003316 rootH1_10016010 rootH1_100160103 218
126 3300003323 rootH1_10119607 rootH1_101196072 218
127 3300005356 Ga0070674_100187157 Ga0070674_1001871572 218
128 3300005471 Ga0070698_100192183 Ga0070698_1001921832 218
129 3300005539 Ga0068853_100157451 Ga0068853_1001574512 218
130 3300005543 Ga0070672_100152070 Ga0070672_1001520702 218
131 3300005577 Ga0068857_100037830 Ga0068857_1000378303 218
132 3300005577 Ga0068857_100376985 Ga0068857_1003769852 218
133 3300005614 Ga0068856_100012730 Ga0068856_1000127302 218
134 3300005843 Ga0068860_100026961 Ga0068860_1000269613 218
135 3300005843 Ga0068860_100346726 Ga0068860_1003467262 218
136 3300006038 Ga0075365_10242409 Ga0075365_102424092 218
137 3300006042 Ga0075368_10136933 Ga0075368_101369331 218
138 3300006048 Ga0075363_100124477 Ga0075363_1001244772 218
139 3300006051 Ga0075364_10047566 Ga0075364_100475662 218
140 3300006051 Ga0075364_10206545 Ga0075364_102065451 218
141 3300006178 Ga0075367_10029312 Ga0075367_100293122 218
142 3300006195 Ga0075366_10405450 Ga0075366_104054502 218
143 3300006880 Ga0075429_100161385 Ga0075429_1001613853 218
144 3300006880 Ga0075429_100262474 Ga0075429_1002624742 218
145 3300009147 Ga0114129_10014367 Ga0114129_100143672 218
146 3300009174 Ga0105241_10003959 Ga0105241_100039595 218
147 3300010375 Ga0105239_10001289 Ga0105239_1000128912 218
148 3300013100 Ga0157373_10158227 Ga0157373_101582271 218
149 3300013296 Ga0157374_10046121 Ga0157374_100461213 218
150 3300013307 Ga0157372_11118974 Ga0157372_111189741 218
151 3300014325 Ga0163163_10661334 Ga0163163_106613342 218
152 3300014326 Ga0157380_10011967 Ga0157380_100119676 218
153 3300025908 Ga0207643_10113602 Ga0207643_101136022 218
154 3300025911 Ga0207654_10041080 Ga0207654_100410802 218
155 3300025913 Ga0207695_10133826 Ga0207695_101338262 218
156 3300025937 Ga0207669_10484140 Ga0207669_104841401 218
157 3300026041 Ga0207639_10547098 Ga0207639_105470981 218
158 3300026116 Ga0207674_10154288 Ga0207674_101542882 218
159 3300027866 Ga0209813_10114880 Ga0209813_101148801 218
160 3300031456 Ga0307513_10417349 Ga0307513_104173492 218
161 3300031507 Ga0307509_10033371 Ga0307509_100333713 218
162 3300032004 Ga0307414_10049306 Ga0307414_100493062 218
163 3300035695 Ga0373927_0026325 Ga0373927_0026325_1511_2167 218
164 3300041443 Ga0451789_0266321 Ga0451789_0266321_200_856 218
165 3300041505 Ga0451849_0175157 Ga0451849_0175157_448_1107 218
166 3300041512 Ga0451853_3400995 Ga0451853_3400995_1010_1666 218
167 3300042015 Ga0439462_0003563 Ga0439462_0003563_2012_2668 218
168 3300046460 Ga0495638_0132416 Ga0495638_0132416_548_1207 218
169 3300046660 Ga0495625_0219858 Ga0495625_0219858_492_1154 218
170 3300050490 nmdc:mga03n38_250981_c1 nmdc:mga03n38_250981_c1_38_733 218
171 3300050491 nmdc:mga00v17_126711_c1 nmdc:mga00v17_126711_c1_842_1552 218
172 3300050495 nmdc:mga04h51_135020_c1 nmdc:mga04h51_135020_c1_225_920 218
173 3300050507 nmdc:mga05p37_9970_c2 nmdc:mga05p37_9970_c2_5025_5753 218
174 3300050508 nmdc:mga09592_138967_c1 nmdc:mga09592_138967_c1_486_1193 218
175 3300050508 nmdc:mga09592_3731_c1 nmdc:mga09592_3731_c1_71_799 218
176 3300053090 Ga0500646_0005459 Ga0500646_0005459_268_927 218
177 3300053092 Ga0500583_0000053 Ga0500583_0000053_21083_21742 218
178 3300053092 Ga0500583_0000638 Ga0500583_0000638_2125_2784 218
179 3300053140 Ga0500573_0053989 Ga0500573_0053989_874_1530 218
180 3300053146 Ga0500588_0014998 Ga0500588_0014998_990_1661 218
181 3300053147 Ga0500589_120876 Ga0500589_120876_439_1098 218
182 3300053153 Ga0500616_0137424 Ga0500616_0137424_62_718 218
183 3300053154 Ga0500619_046387 Ga0500619_046387_571_1227 218
184 3300053156 Ga0500622_0015401 Ga0500622_0015401_619_1278 218
185 3300053156 Ga0500622_0083807 Ga0500622_0083807_910_1569 218
186 3300005289 Ga0065704_10082549 Ga0065704_100825492 219
187 3300005539 Ga0068853_100070045 Ga0068853_1000700452 220
188 3300031616 Ga0307508_10401483 Ga0307508_104014831 220
189 3300003322 rootL2_10061131 rootL2_100611312 221
190 3300001989 JGI24739J22299_10002292 JGI24739J22299_100022923 222
191 3300003771 Ga0055526_1007255 Ga0055526_10072553 222
192 3300003771 Ga0055526_1013603 Ga0055526_10136032 222
193 3300003790 Ga0055528_1000180 Ga0055528_10001808 222
194 3300003790 Ga0055528_1000828 Ga0055528_100082813 222
195 3300003791 Ga0055530_10001406 Ga0055530_100014064 222
196 3300003794 Ga0055531_10034474 Ga0055531_100344742 222
197 3300004625 Ga0055543_1010536 Ga0055543_10105362 222
198 3300005262 Ga0065165_1000019 Ga0065165_1000019157 222
199 3300005331 Ga0070670_100112127 Ga0070670_1001121272 222
200 3300005334 Ga0068869_100465926 Ga0068869_1004659261 222
201 3300005365 Ga0070688_100171855 Ga0070688_1001718553 222
202 3300005367 Ga0070667_100167194 Ga0070667_1001671942 222
203 3300005471 Ga0070698_100041549 Ga0070698_1000415492 222
204 3300005577 Ga0068857_100448928 Ga0068857_1004489282 222
205 3300005617 Ga0068859_100000030 Ga0068859_10000003034 222
206 3300005617 Ga0068859_100133721 Ga0068859_1001337212 222
207 3300005618 Ga0068864_100078569 Ga0068864_1000785693 222
208 3300005841 Ga0068863_100027664 Ga0068863_1000276642 222
209 3300005842 Ga0068858_100004418 Ga0068858_1000044182 222
210 3300005842 Ga0068858_100614450 Ga0068858_1006144502 222
211 3300005843 Ga0068860_100024701 Ga0068860_1000247012 222
212 3300006237 Ga0097621_100003096 Ga0097621_1000030966 222
213 3300006358 Ga0068871_100005864 Ga0068871_1000058642 222
214 3300006844 Ga0075428_100098049 Ga0075428_1000980492 222
215 3300006846 Ga0075430_100030121 Ga0075430_1000301214 222
216 3300006847 Ga0075431_100098015 Ga0075431_1000980152 222
217 3300006880 Ga0075429_100002722 Ga0075429_1000027222 222
218 3300006931 Ga0097620_100000030 Ga0097620_100000030111 222
219 3300006931 Ga0097620_100133721 Ga0097620_1001337212 222
220 3300009094 Ga0111539_10405533 Ga0111539_104055331 222
221 3300009174 Ga0105241_10014837 Ga0105241_100148374 222
222 3300009553 Ga0105249_10007495 Ga0105249_100074953 222
223 3300009553 Ga0105249_10012824 Ga0105249_100128243 222
224 3300010375 Ga0105239_10000002 Ga0105239_10000002487 222
225 3300013297 Ga0157378_10071076 Ga0157378_100710762 222
226 3300013297 Ga0157378_10259290 Ga0157378_102592903 222
227 3300013308 Ga0157375_10019406 Ga0157375_100194062 222
228 3300014968 Ga0157379_10308618 Ga0157379_103086182 222
229 3300014969 Ga0157376_10013959 Ga0157376_100139595 222
230 3300025273 Ga0209673_1000042 Ga0209673_100004270 222
231 3300025295 Ga0209564_1001966 Ga0209564_10019663 222
232 3300025295 Ga0209564_1003438 Ga0209564_10034386 222
233 3300025298 Ga0209050_1000308 Ga0209050_100030848 222
234 3300025302 Ga0207426_1016074 Ga0207426_10160743 222
235 3300025304 Ga0209257_1001319 Ga0209257_100131922 222
236 3300025911 Ga0207654_10224917 Ga0207654_102249172 222
237 3300025925 Ga0207650_10192792 Ga0207650_101927922 222
238 3300025961 Ga0207712_10016416 Ga0207712_100164162 222
239 3300025961 Ga0207712_10037669 Ga0207712_100376692 222
240 3300025986 Ga0207658_10136061 Ga0207658_101360613 222
241 3300026023 Ga0207677_10027317 Ga0207677_100273172 222
242 3300026035 Ga0207703_10016762 Ga0207703_100167624 222
243 3300026035 Ga0207703_10344888 Ga0207703_103448881 222
244 3300026088 Ga0207641_10030278 Ga0207641_100302783 222
245 3300026095 Ga0207676_10467987 Ga0207676_104679872 222
246 3300028380 Ga0268265_10620285 Ga0268265_106202852 222
247 3300028381 Ga0268264_10002522 Ga0268264_100025222 222
248 3300028794 Ga0307515_10000071 Ga0307515_1000007135 222
249 3300031507 Ga0307509_10277105 Ga0307509_102771051 222
250 3300050511 nmdc:mga08y16_454339_c1 nmdc:mga08y16_454339_c1_528_1196 222
251 3300053153 Ga0500616_0001927 Ga0500616_0001927_11998_12666 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

40

238

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.776 37 221
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.7407 37 221
6r3r-assembly1.cif.gz_A first crystal structure of endo-levanase bt1760 from bacteroides thetaiotaomicron 0.7311 61 221
4jqt-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bt3469) from bacteroides thetaiotaomicron vpi-5482 at 2.49 a resolution 0.7182 26 222
3h3l-assembly1.cif.gz_A-2 crystal structure of putative sugar hydrolase (yp_001304206.1) from parabacteroides distasonis atcc 8503 at 1.59 a resolution 0.7038 25 222
ID Description Score Start End Superfamily
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.776 37 221 2.60.120.560
4ffhA02 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7456 61 222 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7407 37 221 2.60.120.560
4jqtB01 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7331 24 220 2.60.120.560
4jqtB02 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7118 26 222 2.60.120.560
ID Description Score Start End GO Terms
AF-A0A3B7MZI6-F1-model_v4 DUF1080 domain-containing protein 0.9946 24 222 GO:0016787
AF-A0A2A5GW75-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9875 26 222 GO:0016787
AF-A0A537K7L1-F1-model_v4 DUF1080 domain-containing protein 0.9873 26 222 GO:0016787
AF-A0A223V1R1-F1-model_v4 Uncharacterized protein 0.981 26 222 GO:0016787
AF-A0A1Q3WLZ1-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9764 24 221 GO:0016787

Feature Viewer

pLDDT pTM Quality
93.06 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map