F362267

General Info

Members Datasets Scaffolds Average Seq Length
251 122 502 82

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100479173|Ga0070665_1004791732
Length 84
Sequence MGPAYFVIAIMGCADGSQACTRVATMPTQYASEQACAASVQSALAANTDLDFPTLVAECKPVSTRPSATREQKPAIIPASARKG

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
110 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
111 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
122 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 1.59
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.59
Rhizosphere 98.41
Stem 0
Stem Tuber 0
Unclassified 3.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100479173 3300005548 Bacteria 1255
2 JGI24735J21928_10148840 3300002067 Bacteria 676
3 Ga0070658_10105560 3300005327 Bacteria 2330
4 Ga0070658_10172137 3300005327 Bacteria 1819
5 Ga0070658_10222656 3300005327 Bacteria 1596
6 Ga0070658_10399817 3300005327 Bacteria 1180
7 Ga0070658_10897708 3300005327 Bacteria 770
8 Ga0070658_11096237 3300005327 Bacteria 692
9 Ga0070658_11173145 3300005327 Bacteria 668
10 Ga0070658_11236887 3300005327 Bacteria 649
11 Ga0070658_11621567 3300005327 Unclassified 560
12 Ga0070676_10170425 3300005328 Bacteria 1408
13 Ga0070683_100037825 3300005329 Bacteria 4419
14 Ga0070670_100398165 3300005331 Bacteria 1215
15 Ga0070670_100676012 3300005331 Bacteria 927
16 Ga0070680_100002851 3300005336 Bacteria 12840
17 Ga0070682_100559600 3300005337 Unclassified 896
18 Ga0070660_100213378 3300005339 Bacteria 1567
19 Ga0070660_100229148 3300005339 Bacteria 1511
20 Ga0070661_100740991 3300005344 Bacteria 803
21 Ga0070692_10015394 3300005345 Bacteria 3618
22 Ga0070692_10051493 3300005345 Bacteria 2142
23 Ga0070668_100100999 3300005347 Bacteria 2285
24 Ga0070669_100234007 3300005353 Bacteria 1457
25 Ga0070669_100508384 3300005353 Bacteria 1000
26 Ga0070675_100665344 3300005354 Bacteria 947
27 Ga0070671_100427310 3300005355 Bacteria 1135
28 Ga0070674_100063677 3300005356 Bacteria 2582
29 Ga0070659_100651600 3300005366 Bacteria 908
30 Ga0070714_101376062 3300005435 Bacteria 689
31 Ga0070663_100044305 3300005455 Bacteria 3135
32 Ga0070663_100146111 3300005455 Bacteria 1809
33 Ga0070663_100374817 3300005455 Bacteria 1158
34 Ga0070662_100263296 3300005457 Bacteria 1390
35 Ga0070662_100389708 3300005457 Bacteria 1148
36 Ga0070662_100441742 3300005457 Bacteria 1079
37 Ga0068867_100174727 3300005459 Bacteria 1704
38 Ga0070679_100754491 3300005530 Bacteria 916
39 Ga0070679_100836723 3300005530 Bacteria 863
40 Ga0070672_101586031 3300005543 Bacteria 587
41 Ga0068855_100103238 3300005563 Bacteria 3280
42 Ga0070664_100493346 3300005564 Bacteria 1128
43 Ga0070664_100651242 3300005564 Bacteria 979
44 Ga0068854_100030658 3300005578 Bacteria 3731
45 Ga0068856_100486175 3300005614 Bacteria 1255
46 Ga0068852_100018737 3300005616 Bacteria 5459
47 Ga0068852_100162930 3300005616 Bacteria 2084
48 Ga0068852_100194974 3300005616 Bacteria 1914
49 Ga0068864_100134741 3300005618 Bacteria 2223
50 Ga0068861_100494324 3300005719 Bacteria 1105
51 Ga0068861_102165156 3300005719 Bacteria 557
52 Ga0068870_10157156 3300005840 Bacteria 1345
53 Ga0068862_100100784 3300005844 Bacteria 2526
54 Ga0068862_100339587 3300005844 Bacteria 1391
55 Ga0068862_100913577 3300005844 Bacteria 864
56 Ga0081539_10010505 3300005985 Bacteria 7508
57 Ga0075428_100155687 3300006844 Bacteria 2483
58 Ga0068865_100099605 3300006881 Bacteria 2125
59 Ga0105240_10037200 3300009093 Bacteria 6256
60 Ga0105243_10019932 3300009148 Bacteria 5085
61 Ga0105249_11368916 3300009553 Bacteria 779
62 Ga0157373_10046854 3300013100 Bacteria 3084
63 Ga0157373_10100850 3300013100 Bacteria 2031
64 Ga0157373_10694040 3300013100 Unclassified 745
65 Ga0157371_10068052 3300013102 Bacteria 2520
66 Ga0157371_10113008 3300013102 Bacteria 1928
67 Ga0157371_10737808 3300013102 Unclassified 739
68 Ga0157370_10091778 3300013104 Bacteria 2851
69 Ga0157370_10133744 3300013104 Bacteria 2313
70 Ga0157369_10171630 3300013105 Bacteria 2285
71 Ga0157369_11688643 3300013105 Bacteria 644
72 Ga0157372_11108498 3300013307 Bacteria 916
73 Ga0157380_10023442 3300014326 Bacteria 4655
74 Ga0157380_11406207 3300014326 Bacteria 748
75 Ga0163161_10802242 3300017792 Bacteria 791
76 Ga0197907_11293057 3300020069 Bacteria 1949
77 Ga0206354_10329145 3300020081 Bacteria 1228
78 Ga0206353_10471967 3300020082 Bacteria 3134
79 Ga0206353_10907071 3300020082 Bacteria 1143
80 Ga0207642_10065739 3300025899 Bacteria 1705
81 Ga0207647_10456129 3300025904 Unclassified 716
82 Ga0207645_10173182 3300025907 Bacteria 1415
83 Ga0207643_10160488 3300025908 Bacteria 1352
84 Ga0207705_10008920 3300025909 Bacteria 7300
85 Ga0207705_10010300 3300025909 Bacteria 6799
86 Ga0207705_10173845 3300025909 Bacteria 1623
87 Ga0207705_10279761 3300025909 Bacteria 1277
88 Ga0207705_10379234 3300025909 Bacteria 1092
89 Ga0207705_11299526 3300025909 Unclassified 556
90 Ga0207707_10083703 3300025912 Bacteria 2786
91 Ga0207707_10298328 3300025912 Bacteria 1394
92 Ga0207695_10161961 3300025913 Bacteria 2168
93 Ga0207660_10001876 3300025917 Bacteria 14007
94 Ga0207657_10000705 3300025919 Bacteria 35489
95 Ga0207657_10004093 3300025919 Bacteria 15482
96 Ga0207657_10193717 3300025919 Bacteria 1638
97 Ga0207657_10975175 3300025919 Bacteria 651
98 Ga0207649_10050753 3300025920 Bacteria 2567
99 Ga0207649_10452790 3300025920 Bacteria 969
100 Ga0207652_10227985 3300025921 Bacteria 1679
101 Ga0207652_11146906 3300025921 Bacteria 678
102 Ga0207681_10101278 3300025923 Bacteria 2078
103 Ga0207681_10228782 3300025923 Bacteria 1442
104 Ga0207650_10642526 3300025925 Bacteria 894
105 Ga0207664_10258321 3300025929 Bacteria 1523
106 Ga0207664_10631958 3300025929 Bacteria 962
107 Ga0207664_11080225 3300025929 Bacteria 718
108 Ga0207644_10287685 3300025931 Bacteria 1321
109 Ga0207690_11028391 3300025932 Unclassified 686
110 Ga0207706_10129300 3300025933 Bacteria 2221
111 Ga0207706_10452949 3300025933 Bacteria 1110
112 Ga0207709_10099418 3300025935 Bacteria 1920
113 Ga0207669_10054543 3300025937 Bacteria 2415
114 Ga0207691_10228095 3300025940 Bacteria 1613
115 Ga0207691_10960177 3300025940 Bacteria 714
116 Ga0207661_10098418 3300025944 Bacteria 2451
117 Ga0207679_10444985 3300025945 Bacteria 1148
118 Ga0207667_10195660 3300025949 Bacteria 2074
119 Ga0207712_10988180 3300025961 Bacteria 746
120 Ga0207668_10232839 3300025972 Bacteria 1486
121 Ga0207668_10447658 3300025972 Bacteria 1101
122 Ga0207640_10020973 3300025981 Bacteria 3886
123 Ga0207678_10002500 3300026067 Bacteria 16720
124 Ga0207678_10024018 3300026067 Bacteria 5328
125 Ga0207678_10262550 3300026067 Bacteria 1480
126 Ga0207702_10236556 3300026078 Bacteria 1709
127 Ga0207648_10729250 3300026089 Bacteria 920
128 Ga0207648_10776235 3300026089 Unclassified 891
129 Ga0207676_10462856 3300026095 Bacteria 1198
130 Ga0207675_100017488 3300026118 Bacteria 6692
131 Ga0207675_101690360 3300026118 Bacteria 653
132 Ga0207698_10008094 3300026142 Bacteria 6625
133 Ga0207698_10737023 3300026142 Bacteria 983
134 Ga0207698_10796468 3300026142 Bacteria 947
135 Ga0268266_10541069 3300028379 Bacteria 1115
136 Ga0268265_10343537 3300028380 Bacteria 1360
137 Ga0268265_12516074 3300028380 Bacteria 521
138 Ga0307408_100094675 3300031548 Bacteria 2262
139 Ga0307408_100439973 3300031548 Bacteria 1128
140 Ga0307408_100507665 3300031548 Bacteria 1057
141 Ga0307408_100621494 3300031548 Bacteria 962
142 Ga0307408_102526471 3300031548 Bacteria 500
143 Ga0307405_10075626 3300031731 Bacteria 2182
144 Ga0307405_10316937 3300031731 Bacteria 1189
145 Ga0307405_10799751 3300031731 Bacteria 790
146 Ga0307405_11316155 3300031731 Bacteria 629
147 Ga0307405_11964477 3300031731 Bacteria 523
148 Ga0307413_10221122 3300031824 Bacteria 1383
149 Ga0307413_10389185 3300031824 Bacteria 1089
150 Ga0307413_10500490 3300031824 Bacteria 975
151 Ga0307413_11501629 3300031824 Bacteria 596
152 Ga0307410_10266208 3300031852 Bacteria 1339
153 Ga0307410_10312735 3300031852 Bacteria 1243
154 Ga0307410_10391963 3300031852 Bacteria 1120
155 Ga0307410_10438732 3300031852 Bacteria 1063
156 Ga0307410_10438835 3300031852 Bacteria 1063
157 Ga0307410_10520941 3300031852 Bacteria 981
158 Ga0307410_10662753 3300031852 Bacteria 876
159 Ga0307410_11460405 3300031852 Bacteria 601
160 Ga0307406_10058578 3300031901 Bacteria 2476
161 Ga0307406_10144297 3300031901 Bacteria 1689
162 Ga0307406_10171350 3300031901 Bacteria 1571
163 Ga0307406_11302045 3300031901 Bacteria 634
164 Ga0307406_11509679 3300031901 Bacteria 591
165 Ga0307407_10152460 3300031903 Bacteria 1503
166 Ga0307407_10271592 3300031903 Bacteria 1170
167 Ga0307407_10396855 3300031903 Bacteria 988
168 Ga0307407_10807892 3300031903 Bacteria 714
169 Ga0307412_10138757 3300031911 Bacteria 1777
170 Ga0307412_10546473 3300031911 Bacteria 972
171 Ga0307409_100098641 3300031995 Bacteria 2416
172 Ga0307409_100284948 3300031995 Bacteria 1529
173 Ga0307409_100290712 3300031995 Bacteria 1515
174 Ga0307409_100851437 3300031995 Bacteria 922
175 Ga0307409_101262059 3300031995 Bacteria 763
176 Ga0307409_102211031 3300031995 Bacteria 579
177 Ga0307409_102350318 3300031995 Bacteria 562
178 Ga0307416_100208316 3300032002 Bacteria 1862
179 Ga0307416_100574927 3300032002 Bacteria 1203
180 Ga0307416_101111851 3300032002 Bacteria 895
181 Ga0307416_101964329 3300032002 Bacteria 688
182 Ga0307416_103324619 3300032002 Bacteria 538
183 Ga0307414_10010576 3300032004 Bacteria 5364
184 Ga0307414_10030570 3300032004 Bacteria 3520
185 Ga0307414_10088560 3300032004 Bacteria 2291
186 Ga0307414_10363229 3300032004 Bacteria 1246
187 Ga0307414_10783718 3300032004 Bacteria 868
188 Ga0307414_10918600 3300032004 Bacteria 803
189 Ga0307414_11828742 3300032004 Bacteria 567
190 Ga0307411_10003566 3300032005 Bacteria 7249
191 Ga0307411_10018157 3300032005 Bacteria 4029
192 Ga0307411_10063998 3300032005 Bacteria 2460
193 Ga0307411_10139157 3300032005 Bacteria 1787
194 Ga0307411_10175711 3300032005 Bacteria 1620
195 Ga0307411_10242660 3300032005 Bacteria 1411
196 Ga0307411_10244599 3300032005 Bacteria 1407
197 Ga0307411_11749999 3300032005 Bacteria 576
198 Ga0307415_100092183 3300032126 Bacteria 2196
199 Ga0307415_100343325 3300032126 Bacteria 1254
200 Ga0307415_101136593 3300032126 Bacteria 733
201 Ga0307415_101172698 3300032126 Bacteria 722
202 Ga0395899_0000340 3300037312 Bacteria 58575
203 Ga0395899_0001168 3300037312 Bacteria 23178
204 Ga0395899_0042813 3300037312 Bacteria 3378
205 Ga0395900_0000731 3300037418 Bacteria 43691
206 Ga0395900_0000794 3300037418 Bacteria 41709
207 Ga0395900_0015436 3300037418 Bacteria 7786
208 Ga0395900_0494566 3300037418 Bacteria 1174
209 Ga0395898_0016637 3300037466 Bacteria 7517
210 Ga0395898_0017852 3300037466 Bacteria 7239
211 Ga0395898_0028988 3300037466 Bacteria 5547
212 Ga0395905_0000383 3300037471 Bacteria 63049
213 Ga0395905_0004331 3300037471 Bacteria 14787
214 Ga0395905_0108093 3300037471 Bacteria 2611
215 Ga0395905_0114692 3300037471 Bacteria 2531
216 Ga0395905_0136947 3300037471 Bacteria 2304
217 Ga0395905_0400401 3300037471 Bacteria 1268
218 Ga0395905_1912881 3300037471 Unclassified 500
219 Ga0395901_0000031 3300038443 Bacteria 241733
220 Ga0395901_0000677 3300038443 Bacteria 39201
221 Ga0395901_0014525 3300038443 Bacteria 8007
222 Ga0395901_0086799 3300038443 Bacteria 3271
223 Ga0395901_0302346 3300038443 Bacteria 1659
224 Ga0466963_0001030 3300044694 Bacteria 14471
225 Ga0466964_0010402 3300044706 Bacteria 3509
226 Ga0466971_0072444 3300044719 Bacteria 1565
227 Ga0466957_0001225 3300044842 Bacteria 13386
228 Ga0466958_0001702 3300045836 Bacteria 10607
229 Ga0466967_0000746 3300045976 Bacteria 16725
230 Ga0466967_0009306 3300045976 Bacteria 7279
231 Ga0466967_0285944 3300045976 Bacteria 1583
232 Ga0466967_0627352 3300045976 Bacteria 1062
233 Ga0466967_2228998 3300045976 Unclassified 544
234 Ga0495585_0044773 3300046492 Bacteria 2472
235 Ga0495631_0173292 3300046518 Bacteria 925
236 Ga0495644_0139675 3300046523 Bacteria 925
237 Ga0495663_0008932 3300046525 Bacteria 2778
238 Ga0495598_0013182 3300046537 Bacteria 2044
239 Ga0495621_0000202 3300046539 Bacteria 13834
240 Ga0495633_0001057 3300046558 Bacteria 22397
241 Ga0495656_0159001 3300046615 Bacteria 1097
242 Ga0495661_0160595 3300046665 Bacteria 1207
243 Ga0495669_0006309 3300046684 Bacteria 4951
244 Ga0495672_0274885 3300047320 Bacteria 807
245 Ga0495677_0005988 3300047445 Bacteria 4603
246 Ga0496109_0404169 3300048912 Bacteria 1290
247 Ga0496109_0637454 3300048912 Bacteria 1002
248 Ga0496112_0004584 3300048915 Bacteria 11750
249 Ga0496113_0078301 3300048916 Bacteria 2529
250 Ga0466962_0089336 3300061719 Bacteria 1476
251 2896431742 2896429255 Bacteria 2557483
252 Ga0070665_100479173
253 JGI24735J21928_10148840
254 Ga0070658_10105560
255 Ga0070658_10172137
256 Ga0070658_10222656
257 Ga0070658_10399817
258 Ga0070658_10897708
259 Ga0070658_11096237
260 Ga0070658_11173145
261 Ga0070658_11236887
262 Ga0070658_11621567
263 Ga0070676_10170425
264 Ga0070683_100037825
265 Ga0070670_100398165
266 Ga0070670_100676012
267 Ga0070680_100002851
268 Ga0070682_100559600
269 Ga0070660_100213378
270 Ga0070660_100229148
271 Ga0070661_100740991
272 Ga0070692_10015394
273 Ga0070692_10051493
274 Ga0070668_100100999
275 Ga0070669_100234007
276 Ga0070669_100508384
277 Ga0070675_100665344
278 Ga0070671_100427310
279 Ga0070674_100063677
280 Ga0070659_100651600
281 Ga0070714_101376062
282 Ga0070663_100044305
283 Ga0070663_100146111
284 Ga0070663_100374817
285 Ga0070662_100263296
286 Ga0070662_100389708
287 Ga0070662_100441742
288 Ga0068867_100174727
289 Ga0070679_100754491
290 Ga0070679_100836723
291 Ga0070672_101586031
292 Ga0068855_100103238
293 Ga0070664_100493346
294 Ga0070664_100651242
295 Ga0068854_100030658
296 Ga0068856_100486175
297 Ga0068852_100018737
298 Ga0068852_100162930
299 Ga0068852_100194974
300 Ga0068864_100134741
301 Ga0068861_100494324
302 Ga0068861_102165156
303 Ga0068870_10157156
304 Ga0068862_100100784
305 Ga0068862_100339587
306 Ga0068862_100913577
307 Ga0081539_10010505
308 Ga0075428_100155687
309 Ga0068865_100099605
310 Ga0105240_10037200
311 Ga0105243_10019932
312 Ga0105249_11368916
313 Ga0157373_10046854
314 Ga0157373_10100850
315 Ga0157373_10694040
316 Ga0157371_10068052
317 Ga0157371_10113008
318 Ga0157371_10737808
319 Ga0157370_10091778
320 Ga0157370_10133744
321 Ga0157369_10171630
322 Ga0157369_11688643
323 Ga0157372_11108498
324 Ga0157380_10023442
325 Ga0157380_11406207
326 Ga0163161_10802242
327 Ga0197907_11293057
328 Ga0206354_10329145
329 Ga0206353_10471967
330 Ga0206353_10907071
331 Ga0207642_10065739
332 Ga0207647_10456129
333 Ga0207645_10173182
334 Ga0207643_10160488
335 Ga0207705_10008920
336 Ga0207705_10010300
337 Ga0207705_10173845
338 Ga0207705_10279761
339 Ga0207705_10379234
340 Ga0207705_11299526
341 Ga0207707_10083703
342 Ga0207707_10298328
343 Ga0207695_10161961
344 Ga0207660_10001876
345 Ga0207657_10000705
346 Ga0207657_10004093
347 Ga0207657_10193717
348 Ga0207657_10975175
349 Ga0207649_10050753
350 Ga0207649_10452790
351 Ga0207652_10227985
352 Ga0207652_11146906
353 Ga0207681_10101278
354 Ga0207681_10228782
355 Ga0207650_10642526
356 Ga0207664_10258321
357 Ga0207664_10631958
358 Ga0207664_11080225
359 Ga0207644_10287685
360 Ga0207690_11028391
361 Ga0207706_10129300
362 Ga0207706_10452949
363 Ga0207709_10099418
364 Ga0207669_10054543
365 Ga0207691_10228095
366 Ga0207691_10960177
367 Ga0207661_10098418
368 Ga0207679_10444985
369 Ga0207667_10195660
370 Ga0207712_10988180
371 Ga0207668_10232839
372 Ga0207668_10447658
373 Ga0207640_10020973
374 Ga0207678_10002500
375 Ga0207678_10024018
376 Ga0207678_10262550
377 Ga0207702_10236556
378 Ga0207648_10729250
379 Ga0207648_10776235
380 Ga0207676_10462856
381 Ga0207675_100017488
382 Ga0207675_101690360
383 Ga0207698_10008094
384 Ga0207698_10737023
385 Ga0207698_10796468
386 Ga0268266_10541069
387 Ga0268265_10343537
388 Ga0268265_12516074
389 Ga0307408_100094675
390 Ga0307408_100439973
391 Ga0307408_100507665
392 Ga0307408_100621494
393 Ga0307408_102526471
394 Ga0307405_10075626
395 Ga0307405_10316937
396 Ga0307405_10799751
397 Ga0307405_11316155
398 Ga0307405_11964477
399 Ga0307413_10221122
400 Ga0307413_10389185
401 Ga0307413_10500490
402 Ga0307413_11501629
403 Ga0307410_10266208
404 Ga0307410_10312735
405 Ga0307410_10391963
406 Ga0307410_10438732
407 Ga0307410_10438835
408 Ga0307410_10520941
409 Ga0307410_10662753
410 Ga0307410_11460405
411 Ga0307406_10058578
412 Ga0307406_10144297
413 Ga0307406_10171350
414 Ga0307406_11302045
415 Ga0307406_11509679
416 Ga0307407_10152460
417 Ga0307407_10271592
418 Ga0307407_10396855
419 Ga0307407_10807892
420 Ga0307412_10138757
421 Ga0307412_10546473
422 Ga0307409_100098641
423 Ga0307409_100284948
424 Ga0307409_100290712
425 Ga0307409_100851437
426 Ga0307409_101262059
427 Ga0307409_102211031
428 Ga0307409_102350318
429 Ga0307416_100208316
430 Ga0307416_100574927
431 Ga0307416_101111851
432 Ga0307416_101964329
433 Ga0307416_103324619
434 Ga0307414_10010576
435 Ga0307414_10030570
436 Ga0307414_10088560
437 Ga0307414_10363229
438 Ga0307414_10783718
439 Ga0307414_10918600
440 Ga0307414_11828742
441 Ga0307411_10003566
442 Ga0307411_10018157
443 Ga0307411_10063998
444 Ga0307411_10139157
445 Ga0307411_10175711
446 Ga0307411_10242660
447 Ga0307411_10244599
448 Ga0307411_11749999
449 Ga0307415_100092183
450 Ga0307415_100343325
451 Ga0307415_101136593
452 Ga0307415_101172698
453 Ga0395899_0000340
454 Ga0395899_0001168
455 Ga0395899_0042813
456 Ga0395900_0000731
457 Ga0395900_0000794
458 Ga0395900_0015436
459 Ga0395900_0494566
460 Ga0395898_0016637
461 Ga0395898_0017852
462 Ga0395898_0028988
463 Ga0395905_0000383
464 Ga0395905_0004331
465 Ga0395905_0108093
466 Ga0395905_0114692
467 Ga0395905_0136947
468 Ga0395905_0400401
469 Ga0395905_1912881
470 Ga0395901_0000031
471 Ga0395901_0000677
472 Ga0395901_0014525
473 Ga0395901_0086799
474 Ga0395901_0302346
475 Ga0466963_0001030
476 Ga0466964_0010402
477 Ga0466971_0072444
478 Ga0466957_0001225
479 Ga0466958_0001702
480 Ga0466967_0000746
481 Ga0466967_0009306
482 Ga0466967_0285944
483 Ga0466967_0627352
484 Ga0466967_2228998
485 Ga0495585_0044773
486 Ga0495631_0173292
487 Ga0495644_0139675
488 Ga0495663_0008932
489 Ga0495598_0013182
490 Ga0495621_0000202
491 Ga0495633_0001057
492 Ga0495656_0159001
493 Ga0495661_0160595
494 Ga0495669_0006309
495 Ga0495672_0274885
496 Ga0495677_0005988
497 Ga0496109_0404169
498 Ga0496109_0637454
499 Ga0496112_0004584
500 Ga0496113_0078301
501 Ga0466962_0089336
502 2896431742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b5h-assembly1.cif.gz_AD cryo-em structure of the contractile injection system base plate from anabaena pcc7120 0.6563 3 45
6z0e-assembly1.cif.gz_A htra1 inactive protease domain s328a with carasil mutation r274q 0.5821 1 25
3num-assembly1.cif.gz_A substrate induced remodeling of the active site regulates htra1 activity 0.5648 3 25
3tjn-assembly2.cif.gz_B htra1 catalytic domain, apo form 0.5632 1 25
3nzi-assembly1.cif.gz_A substrate induced remodeling of the active site regulates htra1 activity 0.5504 1 25
ID Description Score Start End Superfamily
af_Q9VFW3_37_182_2.70.220.10 Mainly Beta;Distorted Sandwich;Ganglioside M2 Activator Protein; Chain: A,;Ganglioside GM2 activator 0.6448 5 26 2.70.220.10
2qcsB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6201 2 26 2.60.120.10
af_F4K518_954_1068_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.5998 4 32 2.60.40.150
af_B8A617_115_328_2.40.10.120 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.5866 3 25 2.40.10.120
af_Q8BYG9_338_449_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.546 1 24 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A1L6J766-F1-model_v4 Uncharacterized protein 0.9531 1 62
AF-M2U564-F1-model_v4 Uncharacterized protein 0.9151 1 61
AF-A0A3D9FH98-F1-model_v4 Uncharacterized protein 0.8946 1 63
AF-A0A842HV93-F1-model_v4 Uncharacterized protein 0.8903 1 63
AF-A0A7Z2NU60-F1-model_v4 Uncharacterized protein 0.8892 1 69

Map