F362125
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 251 | 164 | 251 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10012957|Ga0065707_100129573 |
| Length | 218 |
| Sequence | VSKTETANSKAQNEALENSSAAVRVLKGGGVIVFPTETLYGLGADALNNAAVEKVFQLKGRDPRSPIPVLVADQEMLHTLVAQVPTTAQKLIDRYWPGPLTLVLPGQKNIPKPLCNPAGGVGVRISSQPIATLLVNELGRPLTATSANPSGKEPARTLQEAKTYFVGRVELFVDGGALTSKSGSTVVEVMEDSIKIIREGELSASELRQVLGEEKVVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 69 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 96 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 101 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 105 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 106 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 107 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 108 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 109 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 110 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 111 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 113 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 115 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 116 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 117 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 118 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 119 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 120 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 121 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 122 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 124 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 125 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 127 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 128 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 149 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.39 |
| Rhizosphere | 95.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10011008 | 3300005290 | Bacteria | 4015 |
| 2 | Ga0065715_10007123 | 3300005293 | Bacteria | 2725 |
| 3 | Ga0065707_10012957 | 3300005295 | Bacteria | 2644 |
| 4 | Ga0070676_10031172 | 3300005328 | Unclassified | 3045 |
| 5 | Ga0070670_100031128 | 3300005331 | Bacteria | 4595 |
| 6 | Ga0070680_100005456 | 3300005336 | Bacteria | 9624 |
| 7 | Ga0070682_100065770 | 3300005337 | Bacteria | 2305 |
| 8 | Ga0070660_100024624 | 3300005339 | Bacteria | 4465 |
| 9 | Ga0070689_100070399 | 3300005340 | Unclassified | 2731 |
| 10 | Ga0070691_10013304 | 3300005341 | Unclassified | 3769 |
| 11 | Ga0070661_100002336 | 3300005344 | Bacteria | 13002 |
| 12 | Ga0070668_100070099 | 3300005347 | Unclassified | 2728 |
| 13 | Ga0070669_100038852 | 3300005353 | Bacteria | 3456 |
| 14 | Ga0070669_100578852 | 3300005353 | Bacteria | 939 |
| 15 | Ga0070674_100010866 | 3300005356 | Bacteria | 5521 |
| 16 | Ga0070667_100044759 | 3300005367 | Bacteria | 3718 |
| 17 | Ga0070708_100076446 | 3300005445 | Bacteria | 3024 |
| 18 | Ga0070708_100322134 | 3300005445 | Bacteria | 1456 |
| 19 | Ga0070708_100527534 | 3300005445 | Bacteria | 1114 |
| 20 | Ga0070663_100003226 | 3300005455 | Bacteria | 9379 |
| 21 | Ga0070678_100023859 | 3300005456 | Bacteria | 4085 |
| 22 | Ga0070678_100561631 | 3300005456 | Bacteria | 1014 |
| 23 | Ga0070681_10089019 | 3300005458 | Bacteria | 3038 |
| 24 | Ga0068867_100364827 | 3300005459 | Bacteria | 1209 |
| 25 | Ga0070706_100035460 | 3300005467 | Bacteria | 4608 |
| 26 | Ga0070706_100121958 | 3300005467 | Bacteria | 2430 |
| 27 | Ga0070699_100236314 | 3300005518 | Bacteria | 1630 |
| 28 | Ga0070679_100100407 | 3300005530 | Unclassified | 2880 |
| 29 | Ga0070684_100108013 | 3300005535 | Bacteria | 2493 |
| 30 | Ga0070697_100019291 | 3300005536 | Bacteria | 5386 |
| 31 | Ga0070697_100190600 | 3300005536 | Unclassified | 1740 |
| 32 | Ga0070697_100231029 | 3300005536 | Bacteria | 1578 |
| 33 | Ga0070697_100439028 | 3300005536 | Unclassified | 1136 |
| 34 | Ga0070672_100105473 | 3300005543 | Unclassified | 2291 |
| 35 | Ga0070672_100775809 | 3300005543 | Unclassified | 842 |
| 36 | Ga0070695_100010371 | 3300005545 | Bacteria | 5562 |
| 37 | Ga0070696_100023315 | 3300005546 | Unclassified | 4206 |
| 38 | Ga0070696_100114186 | 3300005546 | Bacteria | 1948 |
| 39 | Ga0070693_100036350 | 3300005547 | Unclassified | 2738 |
| 40 | Ga0070704_100077742 | 3300005549 | Bacteria | 2432 |
| 41 | Ga0070704_100339358 | 3300005549 | Unclassified | 1265 |
| 42 | Ga0068855_100304814 | 3300005563 | Bacteria | 1763 |
| 43 | Ga0070664_100001170 | 3300005564 | Bacteria | 20836 |
| 44 | Ga0068857_100446962 | 3300005577 | Bacteria | 1208 |
| 45 | Ga0068854_100072140 | 3300005578 | Unclassified | 2528 |
| 46 | Ga0068854_101003617 | 3300005578 | Bacteria | 739 |
| 47 | Ga0068856_100082723 | 3300005614 | Unclassified | 3186 |
| 48 | Ga0070702_100591309 | 3300005615 | Bacteria | 830 |
| 49 | Ga0068852_100159314 | 3300005616 | Bacteria | 2106 |
| 50 | Ga0068859_100094012 | 3300005617 | Bacteria | 3049 |
| 51 | Ga0068864_100374490 | 3300005618 | Bacteria | 1348 |
| 52 | Ga0068861_100315224 | 3300005719 | Bacteria | 1360 |
| 53 | Ga0068870_10039766 | 3300005840 | Bacteria | 2435 |
| 54 | Ga0068860_100043363 | 3300005843 | Bacteria | 4292 |
| 55 | Ga0068860_100489343 | 3300005843 | Unclassified | 1227 |
| 56 | Ga0068862_100562938 | 3300005844 | Bacteria | 1090 |
| 57 | Ga0068862_101118899 | 3300005844 | Bacteria | 783 |
| 58 | Ga0081538_10024786 | 3300005981 | Bacteria | 4260 |
| 59 | Ga0081538_10048321 | 3300005981 | Unclassified | 2596 |
| 60 | Ga0075432_10034192 | 3300006058 | Bacteria | 1765 |
| 61 | Ga0097621_100293106 | 3300006237 | Bacteria | 1435 |
| 62 | Ga0075428_100032502 | 3300006844 | Bacteria | 5763 |
| 63 | Ga0075428_100096653 | 3300006844 | Bacteria | 3220 |
| 64 | Ga0075428_100321707 | 3300006844 | Bacteria | 1662 |
| 65 | Ga0075428_100688628 | 3300006844 | Unclassified | 1089 |
| 66 | Ga0075428_100994921 | 3300006844 | Bacteria | 888 |
| 67 | Ga0075430_100218943 | 3300006846 | Bacteria | 1580 |
| 68 | Ga0075430_100717950 | 3300006846 | Bacteria | 824 |
| 69 | Ga0075431_100032547 | 3300006847 | Bacteria | 5373 |
| 70 | Ga0075431_100112082 | 3300006847 | Bacteria | 2815 |
| 71 | Ga0075431_100328569 | 3300006847 | Bacteria | 1541 |
| 72 | Ga0075433_10015247 | 3300006852 | Bacteria | 6299 |
| 73 | Ga0075433_11072746 | 3300006852 | Bacteria | 701 |
| 74 | Ga0075429_100008876 | 3300006880 | Bacteria | 8738 |
| 75 | Ga0075429_100463225 | 3300006880 | Unclassified | 1111 |
| 76 | Ga0075429_100726402 | 3300006880 | Bacteria | 870 |
| 77 | Ga0075436_100197796 | 3300006914 | Unclassified | 1423 |
| 78 | Ga0097620_100094014 | 3300006931 | Bacteria | 3049 |
| 79 | Ga0075435_100067725 | 3300007076 | Unclassified | 2907 |
| 80 | Ga0075435_100549205 | 3300007076 | Unclassified | 1000 |
| 81 | Ga0105250_10174619 | 3300009092 | Bacteria | 900 |
| 82 | Ga0111539_10073994 | 3300009094 | Bacteria | 4015 |
| 83 | Ga0114129_10143129 | 3300009147 | Bacteria | 3276 |
| 84 | Ga0114129_10306818 | 3300009147 | Bacteria | 2114 |
| 85 | Ga0114129_10662537 | 3300009147 | Unclassified | 1346 |
| 86 | Ga0114129_10721912 | 3300009147 | Bacteria | 1279 |
| 87 | Ga0114129_10724502 | 3300009147 | Unclassified | 1276 |
| 88 | Ga0114129_10865962 | 3300009147 | Bacteria | 1147 |
| 89 | Ga0105241_10204883 | 3300009174 | Unclassified | 1650 |
| 90 | Ga0105241_10679666 | 3300009174 | Bacteria | 938 |
| 91 | Ga0105242_10090896 | 3300009176 | Unclassified | 2569 |
| 92 | Ga0105237_10098565 | 3300009545 | Bacteria | 2914 |
| 93 | Ga0105249_10169217 | 3300009553 | Unclassified | 2118 |
| 94 | Ga0105249_10975834 | 3300009553 | Unclassified | 916 |
| 95 | Ga0105239_10225964 | 3300010375 | Unclassified | 2100 |
| 96 | Ga0105246_10021934 | 3300011119 | Bacteria | 4116 |
| 97 | Ga0157374_10073704 | 3300013296 | Bacteria | 3222 |
| 98 | Ga0163162_10064228 | 3300013306 | Bacteria | 3716 |
| 99 | Ga0163162_10854134 | 3300013306 | Unclassified | 1025 |
| 100 | Ga0157375_10668978 | 3300013308 | Bacteria | 1193 |
| 101 | Ga0157376_10014464 | 3300014969 | Bacteria | 5926 |
| 102 | Ga0213875_10000151 | 3300021388 | Bacteria | 73817 |
| 103 | Ga0207682_10049826 | 3300025893 | Bacteria | 1730 |
| 104 | Ga0207688_10002118 | 3300025901 | Bacteria | 10663 |
| 105 | Ga0207680_10153076 | 3300025903 | Bacteria | 1539 |
| 106 | Ga0207645_10001096 | 3300025907 | Bacteria | 22349 |
| 107 | Ga0207643_10038422 | 3300025908 | Bacteria | 2688 |
| 108 | Ga0207684_10094453 | 3300025910 | Bacteria | 2551 |
| 109 | Ga0207684_10601031 | 3300025910 | Unclassified | 939 |
| 110 | Ga0207657_10005240 | 3300025919 | Bacteria | 13584 |
| 111 | Ga0207649_10318141 | 3300025920 | Bacteria | 1142 |
| 112 | Ga0207681_10403294 | 3300025923 | Unclassified | 1105 |
| 113 | Ga0207681_10781467 | 3300025923 | Bacteria | 797 |
| 114 | Ga0207650_10000676 | 3300025925 | Bacteria | 26793 |
| 115 | Ga0207690_10049132 | 3300025932 | Bacteria | 2810 |
| 116 | Ga0207706_10002373 | 3300025933 | Bacteria | 18381 |
| 117 | Ga0207706_10212585 | 3300025933 | Bacteria | 1695 |
| 118 | Ga0207706_10637219 | 3300025933 | Bacteria | 914 |
| 119 | Ga0207670_10194704 | 3300025936 | Bacteria | 1536 |
| 120 | Ga0207704_10254072 | 3300025938 | Bacteria | 1321 |
| 121 | Ga0207691_10003200 | 3300025940 | Bacteria | 15977 |
| 122 | Ga0207679_10006174 | 3300025945 | Bacteria | 7565 |
| 123 | Ga0207667_10118313 | 3300025949 | Bacteria | 2731 |
| 124 | Ga0207651_10080076 | 3300025960 | Bacteria | 2349 |
| 125 | Ga0207712_10549072 | 3300025961 | Unclassified | 993 |
| 126 | Ga0207668_10057804 | 3300025972 | Unclassified | 2708 |
| 127 | Ga0207668_10513364 | 3300025972 | Bacteria | 1033 |
| 128 | Ga0207640_10039466 | 3300025981 | Bacteria | 2988 |
| 129 | Ga0207678_10010984 | 3300026067 | Bacteria | 7954 |
| 130 | Ga0207708_10411505 | 3300026075 | Bacteria | 1120 |
| 131 | Ga0207641_10089690 | 3300026088 | Bacteria | 2688 |
| 132 | Ga0207648_10050974 | 3300026089 | Bacteria | 3618 |
| 133 | Ga0207683_10000467 | 3300026121 | Bacteria | 37592 |
| 134 | Ga0207428_10054641 | 3300027907 | Bacteria | 3180 |
| 135 | Ga0268265_10846125 | 3300028380 | Unclassified | 895 |
| 136 | Ga0268264_10184351 | 3300028381 | Unclassified | 1898 |
| 137 | Ga0268264_10315251 | 3300028381 | Unclassified | 1477 |
| 138 | Ga0265330_10025651 | 3300031235 | Archaea | 2671 |
| 139 | Ga0265332_10207189 | 3300031238 | Archaea | 814 |
| 140 | Ga0265340_10017468 | 3300031247 | Archaea | 3712 |
| 141 | Ga0265316_10002343 | 3300031344 | Archaea | 19745 |
| 142 | Ga0265316_10021226 | 3300031344 | Archaea | 5508 |
| 143 | Ga0265316_10086770 | 3300031344 | Bacteria | 2392 |
| 144 | Ga0307408_100202211 | 3300031548 | Unclassified | 1609 |
| 145 | Ga0307408_100537666 | 3300031548 | Unclassified | 1029 |
| 146 | Ga0265342_10000057 | 3300031712 | Archaea | 120509 |
| 147 | Ga0265342_10050728 | 3300031712 | Archaea | 2478 |
| 148 | Ga0316576_10000122 | 3300031727 | Bacteria | 29183 |
| 149 | Ga0316578_10025336 | 3300031728 | Bacteria | 3334 |
| 150 | Ga0307410_10837770 | 3300031852 | Unclassified | 784 |
| 151 | Ga0307416_100087463 | 3300032002 | Bacteria | 2660 |
| 152 | Ga0373949_0041098 | 3300035090 | Unclassified | 1137 |
| 153 | Ga0373956_0142590 | 3300035119 | Bacteria | 1125 |
| 154 | Ga0373960_0024322 | 3300035121 | Bacteria | 1637 |
| 155 | Ga0373942_0129117 | 3300035207 | Unclassified | 796 |
| 156 | Ga0373931_0030192 | 3300035691 | Bacteria | 2789 |
| 157 | Ga0373937_0835892 | 3300036401 | Bacteria | 869 |
| 158 | Ga0316582_0004037 | 3300036647 | Bacteria | 7333 |
| 159 | Ga0316582_0062900 | 3300036647 | Bacteria | 2384 |
| 160 | Ga0316581_0031373 | 3300037588 | Bacteria | 1602 |
| 161 | Ga0436364_0368246 | 3300037853 | Bacteria | 72699 |
| 162 | Ga0400483_117603 | 3300039062 | Bacteria | 2373 |
| 163 | Ga0400483_122756 | 3300039062 | Bacteria | 1992 |
| 164 | Ga0400483_175627 | 3300039062 | Bacteria | 1454 |
| 165 | Ga0451577_0136762 | 3300042876 | Archaea | 2200 |
| 166 | Ga0451577_0539052 | 3300042876 | Archaea | 1060 |
| 167 | Ga0453683_0000837 | 3300044673 | Bacteria | 29836 |
| 168 | Ga0453684_0000043 | 3300044712 | Archaea | 642274 |
| 169 | Ga0453684_0000060 | 3300044712 | Archaea | 492542 |
| 170 | Ga0453684_0005400 | 3300044712 | Archaea | 25363 |
| 171 | Ga0453684_0011942 | 3300044712 | Archaea | 14456 |
| 172 | Ga0453684_0056745 | 3300044712 | Archaea | 5077 |
| 173 | Ga0453684_0062012 | 3300044712 | Archaea | 4793 |
| 174 | Ga0453684_0089343 | 3300044712 | Archaea | 3811 |
| 175 | Ga0453684_0588946 | 3300044712 | Archaea | 1220 |
| 176 | Ga0451576_0284759 | 3300045051 | Unclassified | 1728 |
| 177 | Ga0451576_0291183 | 3300045051 | Unclassified | 1707 |
| 178 | Ga0495580_0422039 | 3300046472 | Bacteria | 897 |
| 179 | Ga0496102_0037211 | 3300048905 | Bacteria | 4389 |
| 180 | Ga0496102_0071263 | 3300048905 | Unclassified | 3191 |
| 181 | Ga0496106_0398400 | 3300048909 | Bacteria | 1106 |
| 182 | Ga0496108_0407238 | 3300048911 | Bacteria | 1188 |
| 183 | Ga0496111_0720687 | 3300048914 | Unclassified | 725 |
| 184 | Ga0496112_0038410 | 3300048915 | Bacteria | 4674 |
| 185 | Ga0501033_0156259 | 3300049570 | Bacteria | 1643 |
| 186 | Ga0501036_0075244 | 3300049572 | Unclassified | 2856 |
| 187 | Ga0501036_0378998 | 3300049572 | Bacteria | 1180 |
| 188 | Ga0501036_0816412 | 3300049572 | Unclassified | 767 |
| 189 | Ga0501037_0071141 | 3300049573 | Unclassified | 2531 |
| 190 | Ga0501037_0091142 | 3300049573 | Bacteria | 2204 |
| 191 | Ga0501038_0167943 | 3300049574 | Bacteria | 1778 |
| 192 | Ga0501039_0026352 | 3300049575 | Bacteria | 4467 |
| 193 | Ga0501040_0040319 | 3300049576 | Bacteria | 3177 |
| 194 | Ga0501040_0519917 | 3300049576 | Bacteria | 858 |
| 195 | Ga0501041_0162462 | 3300049577 | Bacteria | 1396 |
| 196 | Ga0501042_0083802 | 3300049578 | Bacteria | 2285 |
| 197 | Ga0501042_0508824 | 3300049578 | Bacteria | 874 |
| 198 | Ga0501043_0361738 | 3300049579 | Unclassified | 1101 |
| 199 | Ga0501046_0165700 | 3300049580 | Bacteria | 1660 |
| 200 | Ga0501048_0053174 | 3300049582 | Bacteria | 2881 |
| 201 | Ga0501048_0057319 | 3300049582 | Bacteria | 2762 |
| 202 | Ga0501068_0223045 | 3300049584 | Unclassified | 1198 |
| 203 | Ga0501070_0133752 | 3300049586 | Bacteria | 2048 |
| 204 | Ga0501071_0009158 | 3300049587 | Bacteria | 6580 |
| 205 | Ga0501071_0543090 | 3300049587 | Bacteria | 892 |
| 206 | Ga0501072_0000127 | 3300049588 | Bacteria | 56633 |
| 207 | Ga0501072_0314233 | 3300049588 | Bacteria | 1245 |
| 208 | Ga0501072_0633812 | 3300049588 | Unclassified | 842 |
| 209 | Ga0501073_0235633 | 3300049589 | Bacteria | 1264 |
| 210 | Ga0501074_0038873 | 3300049590 | Bacteria | 3446 |
| 211 | Ga0501075_0033633 | 3300049591 | Bacteria | 3814 |
| 212 | Ga0501075_0195404 | 3300049591 | Bacteria | 1543 |
| 213 | Ga0501075_0446274 | 3300049591 | Bacteria | 986 |
| 214 | Ga0501076_0225482 | 3300049592 | Bacteria | 1531 |
| 215 | Ga0501077_0022431 | 3300049593 | Bacteria | 3999 |
| 216 | Ga0501077_0045301 | 3300049593 | Unclassified | 2794 |
| 217 | Ga0501077_0059262 | 3300049593 | Bacteria | 2430 |
| 218 | Ga0501077_0146016 | 3300049593 | Bacteria | 1500 |
| 219 | Ga0501224_021819 | 3300049664 | Unclassified | 955 |
| 220 | Ga0501079_0210770 | 3300049741 | Bacteria | 1517 |
| 221 | Ga0501080_0068490 | 3300049742 | Bacteria | 3301 |
| 222 | Ga0501080_0096013 | 3300049742 | Bacteria | 2752 |
| 223 | Ga0501081_0296115 | 3300049743 | Bacteria | 1186 |
| 224 | Ga0501083_0096037 | 3300049744 | Unclassified | 1955 |
| 225 | Ga0501083_0337813 | 3300049744 | Unclassified | 979 |
| 226 | Ga0501045_0002346 | 3300049824 | Bacteria | 12855 |
| 227 | Ga0501045_0093063 | 3300049824 | Bacteria | 2229 |
| 228 | nmdc:mga05p37_127328_c1 | 3300050507 | Unclassified | 3127 |
| 229 | nmdc:mga05p37_20299_c1 | 3300050507 | Bacteria | 8040 |
| 230 | nmdc:mga05p37_26816_c1 | 3300050507 | Bacteria | 7009 |
| 231 | nmdc:mga05p37_48240_c1 | 3300050507 | Bacteria | 5239 |
| 232 | nmdc:mga05p37_7526_c1 | 3300050507 | Bacteria | 12840 |
| 233 | nmdc:mga09592_12012_c1 | 3300050508 | Bacteria | 7045 |
| 234 | nmdc:mga09592_249810_c1 | 3300050508 | Bacteria | 1537 |
| 235 | nmdc:mga09592_758601_c1 | 3300050508 | Bacteria | 823 |
| 236 | nmdc:mga09592_9831_c1 | 3300050508 | Bacteria | 7776 |
| 237 | nmdc:mga0qj67_442091_c1 | 3300050509 | Bacteria | 1048 |
| 238 | nmdc:mga06r32_21594_c1 | 3300050510 | Bacteria | 5944 |
| 239 | nmdc:mga06r32_335439_c1 | 3300050510 | Unclassified | 1497 |
| 240 | nmdc:mga06r32_77947_c1 | 3300050510 | Bacteria | 3220 |
| 241 | nmdc:mga08y16_15132_c1 | 3300050511 | Bacteria | 8110 |
| 242 | nmdc:mga0n895_15569_c1 | 3300050512 | Bacteria | 6941 |
| 243 | nmdc:mga0n895_23405_c1 | 3300050512 | Bacteria | 5806 |
| 244 | nmdc:mga0n895_862483_c1 | 3300050512 | Bacteria | 893 |
| 245 | nmdc:mga0rr50_15721_c1 | 3300050513 | Bacteria | 5002 |
| 246 | nmdc:mga0rr50_18023_c1 | 3300050513 | Bacteria | 4733 |
| 247 | nmdc:mga08x19_114559_c1 | 3300050514 | Unclassified | 1801 |
| 248 | nmdc:mga0a205_534316_c1 | 3300050515 | Unclassified | 1028 |
| 249 | Ga0501084_0022873 | 3300054114 | Bacteria | 5216 |
| 250 | Ga0501084_0115366 | 3300054114 | Bacteria | 2257 |
| 251 | Ga0530510_0494953 | 3300061734 | Unclassified | 926 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013308 | Ga0157375_10668978 | Ga0157375_106689782 | 155 |
| 2 | 3300005578 | Ga0068854_101003617 | Ga0068854_1010036172 | 176 |
| 3 | 3300005445 | Ga0070708_100076446 | Ga0070708_1000764462 | 181 |
| 4 | 3300005536 | Ga0070697_100231029 | Ga0070697_1002310292 | 181 |
| 5 | 3300006844 | Ga0075428_100994921 | Ga0075428_1009949211 | 181 |
| 6 | 3300006880 | Ga0075429_100726402 | Ga0075429_1007264021 | 181 |
| 7 | 3300009147 | Ga0114129_10724502 | Ga0114129_107245022 | 181 |
| 8 | 3300025933 | Ga0207706_10212585 | Ga0207706_102125852 | 181 |
| 9 | 3300025933 | Ga0207706_10637219 | Ga0207706_106372192 | 181 |
| 10 | 3300025972 | Ga0207668_10513364 | Ga0207668_105133642 | 181 |
| 11 | 3300031548 | Ga0307408_100202211 | Ga0307408_1002022113 | 186 |
| 12 | 3300031852 | Ga0307410_10837770 | Ga0307410_108377701 | 186 |
| 13 | 3300032002 | Ga0307416_100087463 | Ga0307416_1000874632 | 186 |
| 14 | 3300005336 | Ga0070680_100005456 | Ga0070680_1000054565 | 187 |
| 15 | 3300007076 | Ga0075435_100067725 | Ga0075435_1000677252 | 187 |
| 16 | 3300009147 | Ga0114129_10721912 | Ga0114129_107219122 | 187 |
| 17 | 3300025901 | Ga0207688_10002118 | Ga0207688_100021183 | 187 |
| 18 | 3300025907 | Ga0207645_10001096 | Ga0207645_1000109616 | 187 |
| 19 | 3300026067 | Ga0207678_10010984 | Ga0207678_100109844 | 187 |
| 20 | 3300035691 | Ga0373931_0030192 | Ga0373931_0030192_485_1051 | 187 |
| 21 | 3300048914 | Ga0496111_0720687 | Ga0496111_0720687_28_594 | 188 |
| 22 | 3300031235 | Ga0265330_10025651 | Ga0265330_100256513 | 190 |
| 23 | 3300031238 | Ga0265332_10207189 | Ga0265332_102071891 | 190 |
| 24 | 3300031247 | Ga0265340_10017468 | Ga0265340_100174683 | 190 |
| 25 | 3300031344 | Ga0265316_10002343 | Ga0265316_1000234322 | 190 |
| 26 | 3300031344 | Ga0265316_10021226 | Ga0265316_100212263 | 190 |
| 27 | 3300031712 | Ga0265342_10000057 | Ga0265342_10000057105 | 190 |
| 28 | 3300031712 | Ga0265342_10050728 | Ga0265342_100507282 | 190 |
| 29 | 3300042876 | Ga0451577_0136762 | Ga0451577_0136762_122_694 | 190 |
| 30 | 3300042876 | Ga0451577_0539052 | Ga0451577_0539052_223_795 | 190 |
| 31 | 3300044712 | Ga0453684_0000060 | Ga0453684_0000060_382971_383543 | 190 |
| 32 | 3300044712 | Ga0453684_0011942 | Ga0453684_0011942_9527_10099 | 190 |
| 33 | 3300044712 | Ga0453684_0056745 | Ga0453684_0056745_1261_1833 | 190 |
| 34 | 3300044712 | Ga0453684_0089343 | Ga0453684_0089343_2467_3039 | 190 |
| 35 | 3300044712 | Ga0453684_0588946 | Ga0453684_0588946_96_668 | 190 |
| 36 | 3300005353 | Ga0070669_100578852 | Ga0070669_1005788522 | 191 |
| 37 | 3300005840 | Ga0068870_10039766 | Ga0068870_100397662 | 191 |
| 38 | 3300005844 | Ga0068862_100562938 | Ga0068862_1005629382 | 191 |
| 39 | 3300006846 | Ga0075430_100717950 | Ga0075430_1007179502 | 191 |
| 40 | 3300009094 | Ga0111539_10073994 | Ga0111539_100739942 | 191 |
| 41 | 3300025908 | Ga0207643_10038422 | Ga0207643_100384223 | 191 |
| 42 | 3300025923 | Ga0207681_10403294 | Ga0207681_104032942 | 191 |
| 43 | 3300025923 | Ga0207681_10781467 | Ga0207681_107814672 | 191 |
| 44 | 3300026075 | Ga0207708_10411505 | Ga0207708_104115052 | 191 |
| 45 | 3300027907 | Ga0207428_10054641 | Ga0207428_100546412 | 191 |
| 46 | 3300044712 | Ga0453684_0005400 | Ga0453684_0005400_9634_10209 | 191 |
| 47 | 3300044712 | Ga0453684_0062012 | Ga0453684_0062012_3658_4233 | 191 |
| 48 | 3300050508 | nmdc:mga09592_758601_c1 | nmdc:mga09592_758601_c1_189_764 | 191 |
| 49 | 3300050511 | nmdc:mga08y16_15132_c1 | nmdc:mga08y16_15132_c1_6974_7549 | 191 |
| 50 | 3300044712 | Ga0453684_0000043 | Ga0453684_0000043_264575_265153 | 192 |
| 51 | 3300045051 | Ga0451576_0291183 | Ga0451576_0291183_971_1549 | 192 |
| 52 | 3300009174 | Ga0105241_10204883 | Ga0105241_102048832 | 193 |
| 53 | 3300031548 | Ga0307408_100537666 | Ga0307408_1005376662 | 193 |
| 54 | 3300049664 | Ga0501224_021819 | Ga0501224_021819_265_846 | 193 |
| 55 | 3300021388 | Ga0213875_10000151 | Ga0213875_1000015134 | 194 |
| 56 | 3300037853 | Ga0436364_0368246 | Ga0436364_0368246_31088_31699 | 194 |
| 57 | 3300009147 | Ga0114129_10306818 | Ga0114129_103068183 | 195 |
| 58 | 3300050507 | nmdc:mga05p37_7526_c1 | nmdc:mga05p37_7526_c1_5529_6119 | 195 |
| 59 | 3300050508 | nmdc:mga09592_12012_c1 | nmdc:mga09592_12012_c1_938_1528 | 195 |
| 60 | 3300050510 | nmdc:mga06r32_77947_c1 | nmdc:mga06r32_77947_c1_1493_2083 | 195 |
| 61 | 3300050512 | nmdc:mga0n895_862483_c1 | nmdc:mga0n895_862483_c1_38_628 | 195 |
| 62 | 3300006852 | Ga0075433_11072746 | Ga0075433_110727461 | 196 |
| 63 | 3300025938 | Ga0207704_10254072 | Ga0207704_102540722 | 196 |
| 64 | 3300031727 | Ga0316576_10000122 | Ga0316576_1000012210 | 196 |
| 65 | 3300031728 | Ga0316578_10025336 | Ga0316578_100253363 | 196 |
| 66 | 3300031344 | Ga0265316_10086770 | Ga0265316_100867702 | 197 |
| 67 | 3300036647 | Ga0316582_0004037 | Ga0316582_0004037_2927_3547 | 197 |
| 68 | 3300037588 | Ga0316581_0031373 | Ga0316581_0031373_847_1467 | 197 |
| 69 | 3300028381 | Ga0268264_10315251 | Ga0268264_103152511 | 198 |
| 70 | 3300049570 | Ga0501033_0156259 | Ga0501033_0156259_807_1406 | 198 |
| 71 | 3300049572 | Ga0501036_0378998 | Ga0501036_0378998_522_1121 | 198 |
| 72 | 3300049573 | Ga0501037_0091142 | Ga0501037_0091142_131_730 | 198 |
| 73 | 3300049574 | Ga0501038_0167943 | Ga0501038_0167943_942_1541 | 198 |
| 74 | 3300049577 | Ga0501041_0162462 | Ga0501041_0162462_560_1159 | 198 |
| 75 | 3300049578 | Ga0501042_0508824 | Ga0501042_0508824_38_637 | 198 |
| 76 | 3300049587 | Ga0501071_0543090 | Ga0501071_0543090_62_661 | 198 |
| 77 | 3300049591 | Ga0501075_0446274 | Ga0501075_0446274_150_749 | 198 |
| 78 | 3300049743 | Ga0501081_0296115 | Ga0501081_0296115_360_959 | 198 |
| 79 | 3300054114 | Ga0501084_0115366 | Ga0501084_0115366_922_1521 | 198 |
| 80 | 3300005843 | Ga0068860_100043363 | Ga0068860_1000433634 | 200 |
| 81 | 3300028381 | Ga0268264_10184351 | Ga0268264_101843512 | 200 |
| 82 | 3300036647 | Ga0316582_0062900 | Ga0316582_0062900_1280_1909 | 200 |
| 83 | 3300005549 | Ga0070704_100339358 | Ga0070704_1003393583 | 201 |
| 84 | 3300050515 | nmdc:mga0a205_534316_c1 | nmdc:mga0a205_534316_c1_18_623 | 201 |
| 85 | 3300005467 | Ga0070706_100035460 | Ga0070706_1000354603 | 202 |
| 86 | 3300005536 | Ga0070697_100019291 | Ga0070697_1000192912 | 202 |
| 87 | 3300005543 | Ga0070672_100775809 | Ga0070672_1007758091 | 202 |
| 88 | 3300005615 | Ga0070702_100591309 | Ga0070702_1005913091 | 202 |
| 89 | 3300009553 | Ga0105249_10975834 | Ga0105249_109758341 | 202 |
| 90 | 3300013306 | Ga0163162_10854134 | Ga0163162_108541342 | 202 |
| 91 | 3300025910 | Ga0207684_10601031 | Ga0207684_106010312 | 202 |
| 92 | 3300025961 | Ga0207712_10549072 | Ga0207712_105490722 | 202 |
| 93 | 3300035207 | Ga0373942_0129117 | Ga0373942_0129117_57_668 | 202 |
| 94 | 3300048905 | Ga0496102_0037211 | Ga0496102_0037211_2523_3134 | 202 |
| 95 | 3300005844 | Ga0068862_101118899 | Ga0068862_1011188991 | 203 |
| 96 | 3300006847 | Ga0075431_100328569 | Ga0075431_1003285692 | 203 |
| 97 | 3300009147 | Ga0114129_10865962 | Ga0114129_108659622 | 203 |
| 98 | 3300028380 | Ga0268265_10846125 | Ga0268265_108461251 | 203 |
| 99 | 3300039062 | Ga0400483_117603 | Ga0400483_117603_1272_1925 | 203 |
| 100 | 3300039062 | Ga0400483_122756 | Ga0400483_122756_290_943 | 203 |
| 101 | 3300039062 | Ga0400483_175627 | Ga0400483_175627_659_1312 | 203 |
| 102 | 3300050510 | nmdc:mga06r32_335439_c1 | nmdc:mga06r32_335439_c1_809_1423 | 203 |
| 103 | 3300005445 | Ga0070708_100322134 | Ga0070708_1003221342 | 205 |
| 104 | 3300005536 | Ga0070697_100190600 | Ga0070697_1001906001 | 205 |
| 105 | 3300006844 | Ga0075428_100321707 | Ga0075428_1003217072 | 205 |
| 106 | 3300006880 | Ga0075429_100463225 | Ga0075429_1004632252 | 205 |
| 107 | 3300009147 | Ga0114129_10143129 | Ga0114129_101431293 | 205 |
| 108 | 3300050507 | nmdc:mga05p37_127328_c1 | nmdc:mga05p37_127328_c1_806_1426 | 205 |
| 109 | 3300050507 | nmdc:mga05p37_48240_c1 | nmdc:mga05p37_48240_c1_3727_4347 | 205 |
| 110 | 3300050508 | nmdc:mga09592_249810_c1 | nmdc:mga09592_249810_c1_633_1253 | 205 |
| 111 | 3300005290 | Ga0065712_10011008 | Ga0065712_100110084 | 206 |
| 112 | 3300005293 | Ga0065715_10007123 | Ga0065715_100071234 | 206 |
| 113 | 3300005295 | Ga0065707_10012957 | Ga0065707_100129573 | 206 |
| 114 | 3300005328 | Ga0070676_10031172 | Ga0070676_100311724 | 206 |
| 115 | 3300005331 | Ga0070670_100031128 | Ga0070670_1000311284 | 206 |
| 116 | 3300005337 | Ga0070682_100065770 | Ga0070682_1000657704 | 206 |
| 117 | 3300005339 | Ga0070660_100024624 | Ga0070660_1000246244 | 206 |
| 118 | 3300005340 | Ga0070689_100070399 | Ga0070689_1000703994 | 206 |
| 119 | 3300005341 | Ga0070691_10013304 | Ga0070691_100133045 | 206 |
| 120 | 3300005344 | Ga0070661_100002336 | Ga0070661_1000023365 | 206 |
| 121 | 3300005347 | Ga0070668_100070099 | Ga0070668_1000700994 | 206 |
| 122 | 3300005353 | Ga0070669_100038852 | Ga0070669_1000388523 | 206 |
| 123 | 3300005356 | Ga0070674_100010866 | Ga0070674_1000108663 | 206 |
| 124 | 3300005367 | Ga0070667_100044759 | Ga0070667_1000447592 | 206 |
| 125 | 3300005445 | Ga0070708_100527534 | Ga0070708_1005275341 | 206 |
| 126 | 3300005455 | Ga0070663_100003226 | Ga0070663_1000032268 | 206 |
| 127 | 3300005456 | Ga0070678_100023859 | Ga0070678_1000238592 | 206 |
| 128 | 3300005456 | Ga0070678_100561631 | Ga0070678_1005616311 | 206 |
| 129 | 3300005458 | Ga0070681_10089019 | Ga0070681_100890193 | 206 |
| 130 | 3300005459 | Ga0068867_100364827 | Ga0068867_1003648272 | 206 |
| 131 | 3300005467 | Ga0070706_100121958 | Ga0070706_1001219583 | 206 |
| 132 | 3300005518 | Ga0070699_100236314 | Ga0070699_1002363142 | 206 |
| 133 | 3300005530 | Ga0070679_100100407 | Ga0070679_1001004074 | 206 |
| 134 | 3300005535 | Ga0070684_100108013 | Ga0070684_1001080132 | 206 |
| 135 | 3300005536 | Ga0070697_100439028 | Ga0070697_1004390281 | 206 |
| 136 | 3300005543 | Ga0070672_100105473 | Ga0070672_1001054734 | 206 |
| 137 | 3300005545 | Ga0070695_100010371 | Ga0070695_1000103716 | 206 |
| 138 | 3300005546 | Ga0070696_100023315 | Ga0070696_1000233155 | 206 |
| 139 | 3300005546 | Ga0070696_100114186 | Ga0070696_1001141862 | 206 |
| 140 | 3300005547 | Ga0070693_100036350 | Ga0070693_1000363502 | 206 |
| 141 | 3300005549 | Ga0070704_100077742 | Ga0070704_1000777423 | 206 |
| 142 | 3300005563 | Ga0068855_100304814 | Ga0068855_1003048143 | 206 |
| 143 | 3300005564 | Ga0070664_100001170 | Ga0070664_10000117011 | 206 |
| 144 | 3300005577 | Ga0068857_100446962 | Ga0068857_1004469622 | 206 |
| 145 | 3300005578 | Ga0068854_100072140 | Ga0068854_1000721404 | 206 |
| 146 | 3300005614 | Ga0068856_100082723 | Ga0068856_1000827234 | 206 |
| 147 | 3300005616 | Ga0068852_100159314 | Ga0068852_1001593143 | 206 |
| 148 | 3300005617 | Ga0068859_100094012 | Ga0068859_1000940122 | 206 |
| 149 | 3300005618 | Ga0068864_100374490 | Ga0068864_1003744902 | 206 |
| 150 | 3300005719 | Ga0068861_100315224 | Ga0068861_1003152242 | 206 |
| 151 | 3300005843 | Ga0068860_100489343 | Ga0068860_1004893431 | 206 |
| 152 | 3300005981 | Ga0081538_10024786 | Ga0081538_100247862 | 206 |
| 153 | 3300005981 | Ga0081538_10048321 | Ga0081538_100483212 | 206 |
| 154 | 3300006058 | Ga0075432_10034192 | Ga0075432_100341922 | 206 |
| 155 | 3300006237 | Ga0097621_100293106 | Ga0097621_1002931062 | 206 |
| 156 | 3300006844 | Ga0075428_100032502 | Ga0075428_1000325024 | 206 |
| 157 | 3300006844 | Ga0075428_100096653 | Ga0075428_1000966531 | 206 |
| 158 | 3300006844 | Ga0075428_100688628 | Ga0075428_1006886282 | 206 |
| 159 | 3300006846 | Ga0075430_100218943 | Ga0075430_1002189432 | 206 |
| 160 | 3300006847 | Ga0075431_100032547 | Ga0075431_1000325474 | 206 |
| 161 | 3300006847 | Ga0075431_100112082 | Ga0075431_1001120823 | 206 |
| 162 | 3300006852 | Ga0075433_10015247 | Ga0075433_100152473 | 206 |
| 163 | 3300006880 | Ga0075429_100008876 | Ga0075429_1000088764 | 206 |
| 164 | 3300006914 | Ga0075436_100197796 | Ga0075436_1001977962 | 206 |
| 165 | 3300006931 | Ga0097620_100094014 | Ga0097620_1000940142 | 206 |
| 166 | 3300007076 | Ga0075435_100549205 | Ga0075435_1005492052 | 206 |
| 167 | 3300009092 | Ga0105250_10174619 | Ga0105250_101746192 | 206 |
| 168 | 3300009147 | Ga0114129_10662537 | Ga0114129_106625372 | 206 |
| 169 | 3300009174 | Ga0105241_10679666 | Ga0105241_106796662 | 206 |
| 170 | 3300009176 | Ga0105242_10090896 | Ga0105242_100908962 | 206 |
| 171 | 3300009545 | Ga0105237_10098565 | Ga0105237_100985654 | 206 |
| 172 | 3300009553 | Ga0105249_10169217 | Ga0105249_101692172 | 206 |
| 173 | 3300010375 | Ga0105239_10225964 | Ga0105239_102259643 | 206 |
| 174 | 3300011119 | Ga0105246_10021934 | Ga0105246_100219344 | 206 |
| 175 | 3300013296 | Ga0157374_10073704 | Ga0157374_100737043 | 206 |
| 176 | 3300013306 | Ga0163162_10064228 | Ga0163162_100642285 | 206 |
| 177 | 3300014969 | Ga0157376_10014464 | Ga0157376_100144646 | 206 |
| 178 | 3300025893 | Ga0207682_10049826 | Ga0207682_100498262 | 206 |
| 179 | 3300025903 | Ga0207680_10153076 | Ga0207680_101530762 | 206 |
| 180 | 3300025910 | Ga0207684_10094453 | Ga0207684_100944532 | 206 |
| 181 | 3300025919 | Ga0207657_10005240 | Ga0207657_1000524011 | 206 |
| 182 | 3300025920 | Ga0207649_10318141 | Ga0207649_103181412 | 206 |
| 183 | 3300025925 | Ga0207650_10000676 | Ga0207650_1000067614 | 206 |
| 184 | 3300025932 | Ga0207690_10049132 | Ga0207690_100491323 | 206 |
| 185 | 3300025933 | Ga0207706_10002373 | Ga0207706_1000237321 | 206 |
| 186 | 3300025936 | Ga0207670_10194704 | Ga0207670_101947042 | 206 |
| 187 | 3300025940 | Ga0207691_10003200 | Ga0207691_1000320019 | 206 |
| 188 | 3300025945 | Ga0207679_10006174 | Ga0207679_100061742 | 206 |
| 189 | 3300025949 | Ga0207667_10118313 | Ga0207667_101183134 | 206 |
| 190 | 3300025960 | Ga0207651_10080076 | Ga0207651_100800763 | 206 |
| 191 | 3300025972 | Ga0207668_10057804 | Ga0207668_100578044 | 206 |
| 192 | 3300025981 | Ga0207640_10039466 | Ga0207640_100394664 | 206 |
| 193 | 3300026088 | Ga0207641_10089690 | Ga0207641_100896901 | 206 |
| 194 | 3300026089 | Ga0207648_10050974 | Ga0207648_100509743 | 206 |
| 195 | 3300026121 | Ga0207683_10000467 | Ga0207683_1000046719 | 206 |
| 196 | 3300035090 | Ga0373949_0041098 | Ga0373949_0041098_361_1017 | 206 |
| 197 | 3300035119 | Ga0373956_0142590 | Ga0373956_0142590_23_649 | 206 |
| 198 | 3300035121 | Ga0373960_0024322 | Ga0373960_0024322_751_1407 | 206 |
| 199 | 3300036401 | Ga0373937_0835892 | Ga0373937_0835892_97_723 | 206 |
| 200 | 3300044673 | Ga0453683_0000837 | Ga0453683_0000837_6436_7089 | 206 |
| 201 | 3300045051 | Ga0451576_0284759 | Ga0451576_0284759_309_929 | 206 |
| 202 | 3300046472 | Ga0495580_0422039 | Ga0495580_0422039_136_759 | 206 |
| 203 | 3300048905 | Ga0496102_0071263 | Ga0496102_0071263_393_1013 | 206 |
| 204 | 3300048909 | Ga0496106_0398400 | Ga0496106_0398400_10_630 | 206 |
| 205 | 3300048911 | Ga0496108_0407238 | Ga0496108_0407238_258_878 | 206 |
| 206 | 3300048915 | Ga0496112_0038410 | Ga0496112_0038410_640_1260 | 206 |
| 207 | 3300049572 | Ga0501036_0075244 | Ga0501036_0075244_1594_2250 | 206 |
| 208 | 3300049572 | Ga0501036_0816412 | Ga0501036_0816412_68_721 | 206 |
| 209 | 3300049573 | Ga0501037_0071141 | Ga0501037_0071141_1387_2043 | 206 |
| 210 | 3300049575 | Ga0501039_0026352 | Ga0501039_0026352_3196_3852 | 206 |
| 211 | 3300049576 | Ga0501040_0040319 | Ga0501040_0040319_940_1596 | 206 |
| 212 | 3300049576 | Ga0501040_0519917 | Ga0501040_0519917_192_827 | 206 |
| 213 | 3300049578 | Ga0501042_0083802 | Ga0501042_0083802_1422_2078 | 206 |
| 214 | 3300049579 | Ga0501043_0361738 | Ga0501043_0361738_95_751 | 206 |
| 215 | 3300049580 | Ga0501046_0165700 | Ga0501046_0165700_890_1546 | 206 |
| 216 | 3300049582 | Ga0501048_0053174 | Ga0501048_0053174_954_1610 | 206 |
| 217 | 3300049582 | Ga0501048_0057319 | Ga0501048_0057319_1014_1667 | 206 |
| 218 | 3300049584 | Ga0501068_0223045 | Ga0501068_0223045_531_1187 | 206 |
| 219 | 3300049586 | Ga0501070_0133752 | Ga0501070_0133752_1294_1950 | 206 |
| 220 | 3300049587 | Ga0501071_0009158 | Ga0501071_0009158_5432_6088 | 206 |
| 221 | 3300049588 | Ga0501072_0000127 | Ga0501072_0000127_46222_46878 | 206 |
| 222 | 3300049588 | Ga0501072_0314233 | Ga0501072_0314233_341_976 | 206 |
| 223 | 3300049588 | Ga0501072_0633812 | Ga0501072_0633812_64_720 | 206 |
| 224 | 3300049589 | Ga0501073_0235633 | Ga0501073_0235633_464_1120 | 206 |
| 225 | 3300049590 | Ga0501074_0038873 | Ga0501074_0038873_916_1569 | 206 |
| 226 | 3300049591 | Ga0501075_0033633 | Ga0501075_0033633_913_1569 | 206 |
| 227 | 3300049591 | Ga0501075_0195404 | Ga0501075_0195404_504_1139 | 206 |
| 228 | 3300049592 | Ga0501076_0225482 | Ga0501076_0225482_830_1483 | 206 |
| 229 | 3300049593 | Ga0501077_0022431 | Ga0501077_0022431_778_1434 | 206 |
| 230 | 3300049593 | Ga0501077_0045301 | Ga0501077_0045301_504_1160 | 206 |
| 231 | 3300049593 | Ga0501077_0059262 | Ga0501077_0059262_859_1515 | 206 |
| 232 | 3300049593 | Ga0501077_0146016 | Ga0501077_0146016_499_1152 | 206 |
| 233 | 3300049741 | Ga0501079_0210770 | Ga0501079_0210770_699_1352 | 206 |
| 234 | 3300049742 | Ga0501080_0068490 | Ga0501080_0068490_1928_2581 | 206 |
| 235 | 3300049742 | Ga0501080_0096013 | Ga0501080_0096013_1577_2233 | 206 |
| 236 | 3300049744 | Ga0501083_0096037 | Ga0501083_0096037_1286_1939 | 206 |
| 237 | 3300049744 | Ga0501083_0337813 | Ga0501083_0337813_187_843 | 206 |
| 238 | 3300049824 | Ga0501045_0002346 | Ga0501045_0002346_15_671 | 206 |
| 239 | 3300049824 | Ga0501045_0093063 | Ga0501045_0093063_571_1224 | 206 |
| 240 | 3300050507 | nmdc:mga05p37_20299_c1 | nmdc:mga05p37_20299_c1_3712_4365 | 206 |
| 241 | 3300050507 | nmdc:mga05p37_26816_c1 | nmdc:mga05p37_26816_c1_1585_2241 | 206 |
| 242 | 3300050508 | nmdc:mga09592_9831_c1 | nmdc:mga09592_9831_c1_1584_2240 | 206 |
| 243 | 3300050509 | nmdc:mga0qj67_442091_c1 | nmdc:mga0qj67_442091_c1_329_985 | 206 |
| 244 | 3300050510 | nmdc:mga06r32_21594_c1 | nmdc:mga06r32_21594_c1_2749_3405 | 206 |
| 245 | 3300050512 | nmdc:mga0n895_15569_c1 | nmdc:mga0n895_15569_c1_264_920 | 206 |
| 246 | 3300050512 | nmdc:mga0n895_23405_c1 | nmdc:mga0n895_23405_c1_5159_5779 | 206 |
| 247 | 3300050513 | nmdc:mga0rr50_15721_c1 | nmdc:mga0rr50_15721_c1_4006_4626 | 206 |
| 248 | 3300050513 | nmdc:mga0rr50_18023_c1 | nmdc:mga0rr50_18023_c1_3632_4288 | 206 |
| 249 | 3300050514 | nmdc:mga08x19_114559_c1 | nmdc:mga08x19_114559_c1_1072_1725 | 206 |
| 250 | 3300054114 | Ga0501084_0022873 | Ga0501084_0022873_705_1361 | 206 |
| 251 | 3300061734 | Ga0530510_0494953 | Ga0530510_0494953_17_670 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6f89-assembly1.cif.gz_A | structure of h234a/y235a p.abyssi sua5 | 0.9444 | 8 | 205 |
| 6f89-assembly2.cif.gz_B | structure of h234a/y235a p.abyssi sua5 | 0.944 | 8 | 205 |
| 6f87-assembly3.cif.gz_C | crystal structure of p. abyssi sua5 complexed with l-threonine and ppi | 0.9414 | 8 | 205 |
| 3aje-assembly1.cif.gz_A | crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp | 0.935 | 8 | 205 |
| 2eqa-assembly1.cif.gz_A | crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii | 0.9324 | 8 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWE2_20_236_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9337 | 6 | 205 | 3.90.870.10 |
| 4e1bA01 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9319 | 8 | 205 | 3.90.870.10 |
| af_Q8I610_4_210_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9315 | 8 | 179 | 3.90.870.10 |
| af_P9WGC9_2_211_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9313 | 2 | 199 | 3.90.870.10 |
| af_A0A1D8PQL4_32_243_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9284 | 1 | 201 | 3.90.870.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3JM78-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9877 | 10 | 205 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A6I1QZF0-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9841 | 8 | 199 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A1F9K8N4-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.982 | 9 | 199 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A535B0N7-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9747 | 2 | 205 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
| AF-A0A7J5VSD6-F1-model_v4 | L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) | 0.9744 | 6 | 201 |
GO:0000049
GO:0003725 GO:0005737 GO:0006450 GO:0008033 GO:0016779 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar