F362125

General Info

Members Datasets Scaffolds Average Seq Length
251 164 251 205

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10012957|Ga0065707_100129573
Length 218
Sequence VSKTETANSKAQNEALENSSAAVRVLKGGGVIVFPTETLYGLGADALNNAAVEKVFQLKGRDPRSPIPVLVADQEMLHTLVAQVPTTAQKLIDRYWPGPLTLVLPGQKNIPKPLCNPAGGVGVRISSQPIATLLVNELGRPLTATSANPSGKEPARTLQEAKTYFVGRVELFVDGGALTSKSGSTVVEVMEDSIKIIREGELSASELRQVLGEEKVVD

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
111 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
115 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.39
Rhizosphere 95.62
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10011008 3300005290 Bacteria 4015
2 Ga0065715_10007123 3300005293 Bacteria 2725
3 Ga0065707_10012957 3300005295 Bacteria 2644
4 Ga0070676_10031172 3300005328 Unclassified 3045
5 Ga0070670_100031128 3300005331 Bacteria 4595
6 Ga0070680_100005456 3300005336 Bacteria 9624
7 Ga0070682_100065770 3300005337 Bacteria 2305
8 Ga0070660_100024624 3300005339 Bacteria 4465
9 Ga0070689_100070399 3300005340 Unclassified 2731
10 Ga0070691_10013304 3300005341 Unclassified 3769
11 Ga0070661_100002336 3300005344 Bacteria 13002
12 Ga0070668_100070099 3300005347 Unclassified 2728
13 Ga0070669_100038852 3300005353 Bacteria 3456
14 Ga0070669_100578852 3300005353 Bacteria 939
15 Ga0070674_100010866 3300005356 Bacteria 5521
16 Ga0070667_100044759 3300005367 Bacteria 3718
17 Ga0070708_100076446 3300005445 Bacteria 3024
18 Ga0070708_100322134 3300005445 Bacteria 1456
19 Ga0070708_100527534 3300005445 Bacteria 1114
20 Ga0070663_100003226 3300005455 Bacteria 9379
21 Ga0070678_100023859 3300005456 Bacteria 4085
22 Ga0070678_100561631 3300005456 Bacteria 1014
23 Ga0070681_10089019 3300005458 Bacteria 3038
24 Ga0068867_100364827 3300005459 Bacteria 1209
25 Ga0070706_100035460 3300005467 Bacteria 4608
26 Ga0070706_100121958 3300005467 Bacteria 2430
27 Ga0070699_100236314 3300005518 Bacteria 1630
28 Ga0070679_100100407 3300005530 Unclassified 2880
29 Ga0070684_100108013 3300005535 Bacteria 2493
30 Ga0070697_100019291 3300005536 Bacteria 5386
31 Ga0070697_100190600 3300005536 Unclassified 1740
32 Ga0070697_100231029 3300005536 Bacteria 1578
33 Ga0070697_100439028 3300005536 Unclassified 1136
34 Ga0070672_100105473 3300005543 Unclassified 2291
35 Ga0070672_100775809 3300005543 Unclassified 842
36 Ga0070695_100010371 3300005545 Bacteria 5562
37 Ga0070696_100023315 3300005546 Unclassified 4206
38 Ga0070696_100114186 3300005546 Bacteria 1948
39 Ga0070693_100036350 3300005547 Unclassified 2738
40 Ga0070704_100077742 3300005549 Bacteria 2432
41 Ga0070704_100339358 3300005549 Unclassified 1265
42 Ga0068855_100304814 3300005563 Bacteria 1763
43 Ga0070664_100001170 3300005564 Bacteria 20836
44 Ga0068857_100446962 3300005577 Bacteria 1208
45 Ga0068854_100072140 3300005578 Unclassified 2528
46 Ga0068854_101003617 3300005578 Bacteria 739
47 Ga0068856_100082723 3300005614 Unclassified 3186
48 Ga0070702_100591309 3300005615 Bacteria 830
49 Ga0068852_100159314 3300005616 Bacteria 2106
50 Ga0068859_100094012 3300005617 Bacteria 3049
51 Ga0068864_100374490 3300005618 Bacteria 1348
52 Ga0068861_100315224 3300005719 Bacteria 1360
53 Ga0068870_10039766 3300005840 Bacteria 2435
54 Ga0068860_100043363 3300005843 Bacteria 4292
55 Ga0068860_100489343 3300005843 Unclassified 1227
56 Ga0068862_100562938 3300005844 Bacteria 1090
57 Ga0068862_101118899 3300005844 Bacteria 783
58 Ga0081538_10024786 3300005981 Bacteria 4260
59 Ga0081538_10048321 3300005981 Unclassified 2596
60 Ga0075432_10034192 3300006058 Bacteria 1765
61 Ga0097621_100293106 3300006237 Bacteria 1435
62 Ga0075428_100032502 3300006844 Bacteria 5763
63 Ga0075428_100096653 3300006844 Bacteria 3220
64 Ga0075428_100321707 3300006844 Bacteria 1662
65 Ga0075428_100688628 3300006844 Unclassified 1089
66 Ga0075428_100994921 3300006844 Bacteria 888
67 Ga0075430_100218943 3300006846 Bacteria 1580
68 Ga0075430_100717950 3300006846 Bacteria 824
69 Ga0075431_100032547 3300006847 Bacteria 5373
70 Ga0075431_100112082 3300006847 Bacteria 2815
71 Ga0075431_100328569 3300006847 Bacteria 1541
72 Ga0075433_10015247 3300006852 Bacteria 6299
73 Ga0075433_11072746 3300006852 Bacteria 701
74 Ga0075429_100008876 3300006880 Bacteria 8738
75 Ga0075429_100463225 3300006880 Unclassified 1111
76 Ga0075429_100726402 3300006880 Bacteria 870
77 Ga0075436_100197796 3300006914 Unclassified 1423
78 Ga0097620_100094014 3300006931 Bacteria 3049
79 Ga0075435_100067725 3300007076 Unclassified 2907
80 Ga0075435_100549205 3300007076 Unclassified 1000
81 Ga0105250_10174619 3300009092 Bacteria 900
82 Ga0111539_10073994 3300009094 Bacteria 4015
83 Ga0114129_10143129 3300009147 Bacteria 3276
84 Ga0114129_10306818 3300009147 Bacteria 2114
85 Ga0114129_10662537 3300009147 Unclassified 1346
86 Ga0114129_10721912 3300009147 Bacteria 1279
87 Ga0114129_10724502 3300009147 Unclassified 1276
88 Ga0114129_10865962 3300009147 Bacteria 1147
89 Ga0105241_10204883 3300009174 Unclassified 1650
90 Ga0105241_10679666 3300009174 Bacteria 938
91 Ga0105242_10090896 3300009176 Unclassified 2569
92 Ga0105237_10098565 3300009545 Bacteria 2914
93 Ga0105249_10169217 3300009553 Unclassified 2118
94 Ga0105249_10975834 3300009553 Unclassified 916
95 Ga0105239_10225964 3300010375 Unclassified 2100
96 Ga0105246_10021934 3300011119 Bacteria 4116
97 Ga0157374_10073704 3300013296 Bacteria 3222
98 Ga0163162_10064228 3300013306 Bacteria 3716
99 Ga0163162_10854134 3300013306 Unclassified 1025
100 Ga0157375_10668978 3300013308 Bacteria 1193
101 Ga0157376_10014464 3300014969 Bacteria 5926
102 Ga0213875_10000151 3300021388 Bacteria 73817
103 Ga0207682_10049826 3300025893 Bacteria 1730
104 Ga0207688_10002118 3300025901 Bacteria 10663
105 Ga0207680_10153076 3300025903 Bacteria 1539
106 Ga0207645_10001096 3300025907 Bacteria 22349
107 Ga0207643_10038422 3300025908 Bacteria 2688
108 Ga0207684_10094453 3300025910 Bacteria 2551
109 Ga0207684_10601031 3300025910 Unclassified 939
110 Ga0207657_10005240 3300025919 Bacteria 13584
111 Ga0207649_10318141 3300025920 Bacteria 1142
112 Ga0207681_10403294 3300025923 Unclassified 1105
113 Ga0207681_10781467 3300025923 Bacteria 797
114 Ga0207650_10000676 3300025925 Bacteria 26793
115 Ga0207690_10049132 3300025932 Bacteria 2810
116 Ga0207706_10002373 3300025933 Bacteria 18381
117 Ga0207706_10212585 3300025933 Bacteria 1695
118 Ga0207706_10637219 3300025933 Bacteria 914
119 Ga0207670_10194704 3300025936 Bacteria 1536
120 Ga0207704_10254072 3300025938 Bacteria 1321
121 Ga0207691_10003200 3300025940 Bacteria 15977
122 Ga0207679_10006174 3300025945 Bacteria 7565
123 Ga0207667_10118313 3300025949 Bacteria 2731
124 Ga0207651_10080076 3300025960 Bacteria 2349
125 Ga0207712_10549072 3300025961 Unclassified 993
126 Ga0207668_10057804 3300025972 Unclassified 2708
127 Ga0207668_10513364 3300025972 Bacteria 1033
128 Ga0207640_10039466 3300025981 Bacteria 2988
129 Ga0207678_10010984 3300026067 Bacteria 7954
130 Ga0207708_10411505 3300026075 Bacteria 1120
131 Ga0207641_10089690 3300026088 Bacteria 2688
132 Ga0207648_10050974 3300026089 Bacteria 3618
133 Ga0207683_10000467 3300026121 Bacteria 37592
134 Ga0207428_10054641 3300027907 Bacteria 3180
135 Ga0268265_10846125 3300028380 Unclassified 895
136 Ga0268264_10184351 3300028381 Unclassified 1898
137 Ga0268264_10315251 3300028381 Unclassified 1477
138 Ga0265330_10025651 3300031235 Archaea 2671
139 Ga0265332_10207189 3300031238 Archaea 814
140 Ga0265340_10017468 3300031247 Archaea 3712
141 Ga0265316_10002343 3300031344 Archaea 19745
142 Ga0265316_10021226 3300031344 Archaea 5508
143 Ga0265316_10086770 3300031344 Bacteria 2392
144 Ga0307408_100202211 3300031548 Unclassified 1609
145 Ga0307408_100537666 3300031548 Unclassified 1029
146 Ga0265342_10000057 3300031712 Archaea 120509
147 Ga0265342_10050728 3300031712 Archaea 2478
148 Ga0316576_10000122 3300031727 Bacteria 29183
149 Ga0316578_10025336 3300031728 Bacteria 3334
150 Ga0307410_10837770 3300031852 Unclassified 784
151 Ga0307416_100087463 3300032002 Bacteria 2660
152 Ga0373949_0041098 3300035090 Unclassified 1137
153 Ga0373956_0142590 3300035119 Bacteria 1125
154 Ga0373960_0024322 3300035121 Bacteria 1637
155 Ga0373942_0129117 3300035207 Unclassified 796
156 Ga0373931_0030192 3300035691 Bacteria 2789
157 Ga0373937_0835892 3300036401 Bacteria 869
158 Ga0316582_0004037 3300036647 Bacteria 7333
159 Ga0316582_0062900 3300036647 Bacteria 2384
160 Ga0316581_0031373 3300037588 Bacteria 1602
161 Ga0436364_0368246 3300037853 Bacteria 72699
162 Ga0400483_117603 3300039062 Bacteria 2373
163 Ga0400483_122756 3300039062 Bacteria 1992
164 Ga0400483_175627 3300039062 Bacteria 1454
165 Ga0451577_0136762 3300042876 Archaea 2200
166 Ga0451577_0539052 3300042876 Archaea 1060
167 Ga0453683_0000837 3300044673 Bacteria 29836
168 Ga0453684_0000043 3300044712 Archaea 642274
169 Ga0453684_0000060 3300044712 Archaea 492542
170 Ga0453684_0005400 3300044712 Archaea 25363
171 Ga0453684_0011942 3300044712 Archaea 14456
172 Ga0453684_0056745 3300044712 Archaea 5077
173 Ga0453684_0062012 3300044712 Archaea 4793
174 Ga0453684_0089343 3300044712 Archaea 3811
175 Ga0453684_0588946 3300044712 Archaea 1220
176 Ga0451576_0284759 3300045051 Unclassified 1728
177 Ga0451576_0291183 3300045051 Unclassified 1707
178 Ga0495580_0422039 3300046472 Bacteria 897
179 Ga0496102_0037211 3300048905 Bacteria 4389
180 Ga0496102_0071263 3300048905 Unclassified 3191
181 Ga0496106_0398400 3300048909 Bacteria 1106
182 Ga0496108_0407238 3300048911 Bacteria 1188
183 Ga0496111_0720687 3300048914 Unclassified 725
184 Ga0496112_0038410 3300048915 Bacteria 4674
185 Ga0501033_0156259 3300049570 Bacteria 1643
186 Ga0501036_0075244 3300049572 Unclassified 2856
187 Ga0501036_0378998 3300049572 Bacteria 1180
188 Ga0501036_0816412 3300049572 Unclassified 767
189 Ga0501037_0071141 3300049573 Unclassified 2531
190 Ga0501037_0091142 3300049573 Bacteria 2204
191 Ga0501038_0167943 3300049574 Bacteria 1778
192 Ga0501039_0026352 3300049575 Bacteria 4467
193 Ga0501040_0040319 3300049576 Bacteria 3177
194 Ga0501040_0519917 3300049576 Bacteria 858
195 Ga0501041_0162462 3300049577 Bacteria 1396
196 Ga0501042_0083802 3300049578 Bacteria 2285
197 Ga0501042_0508824 3300049578 Bacteria 874
198 Ga0501043_0361738 3300049579 Unclassified 1101
199 Ga0501046_0165700 3300049580 Bacteria 1660
200 Ga0501048_0053174 3300049582 Bacteria 2881
201 Ga0501048_0057319 3300049582 Bacteria 2762
202 Ga0501068_0223045 3300049584 Unclassified 1198
203 Ga0501070_0133752 3300049586 Bacteria 2048
204 Ga0501071_0009158 3300049587 Bacteria 6580
205 Ga0501071_0543090 3300049587 Bacteria 892
206 Ga0501072_0000127 3300049588 Bacteria 56633
207 Ga0501072_0314233 3300049588 Bacteria 1245
208 Ga0501072_0633812 3300049588 Unclassified 842
209 Ga0501073_0235633 3300049589 Bacteria 1264
210 Ga0501074_0038873 3300049590 Bacteria 3446
211 Ga0501075_0033633 3300049591 Bacteria 3814
212 Ga0501075_0195404 3300049591 Bacteria 1543
213 Ga0501075_0446274 3300049591 Bacteria 986
214 Ga0501076_0225482 3300049592 Bacteria 1531
215 Ga0501077_0022431 3300049593 Bacteria 3999
216 Ga0501077_0045301 3300049593 Unclassified 2794
217 Ga0501077_0059262 3300049593 Bacteria 2430
218 Ga0501077_0146016 3300049593 Bacteria 1500
219 Ga0501224_021819 3300049664 Unclassified 955
220 Ga0501079_0210770 3300049741 Bacteria 1517
221 Ga0501080_0068490 3300049742 Bacteria 3301
222 Ga0501080_0096013 3300049742 Bacteria 2752
223 Ga0501081_0296115 3300049743 Bacteria 1186
224 Ga0501083_0096037 3300049744 Unclassified 1955
225 Ga0501083_0337813 3300049744 Unclassified 979
226 Ga0501045_0002346 3300049824 Bacteria 12855
227 Ga0501045_0093063 3300049824 Bacteria 2229
228 nmdc:mga05p37_127328_c1 3300050507 Unclassified 3127
229 nmdc:mga05p37_20299_c1 3300050507 Bacteria 8040
230 nmdc:mga05p37_26816_c1 3300050507 Bacteria 7009
231 nmdc:mga05p37_48240_c1 3300050507 Bacteria 5239
232 nmdc:mga05p37_7526_c1 3300050507 Bacteria 12840
233 nmdc:mga09592_12012_c1 3300050508 Bacteria 7045
234 nmdc:mga09592_249810_c1 3300050508 Bacteria 1537
235 nmdc:mga09592_758601_c1 3300050508 Bacteria 823
236 nmdc:mga09592_9831_c1 3300050508 Bacteria 7776
237 nmdc:mga0qj67_442091_c1 3300050509 Bacteria 1048
238 nmdc:mga06r32_21594_c1 3300050510 Bacteria 5944
239 nmdc:mga06r32_335439_c1 3300050510 Unclassified 1497
240 nmdc:mga06r32_77947_c1 3300050510 Bacteria 3220
241 nmdc:mga08y16_15132_c1 3300050511 Bacteria 8110
242 nmdc:mga0n895_15569_c1 3300050512 Bacteria 6941
243 nmdc:mga0n895_23405_c1 3300050512 Bacteria 5806
244 nmdc:mga0n895_862483_c1 3300050512 Bacteria 893
245 nmdc:mga0rr50_15721_c1 3300050513 Bacteria 5002
246 nmdc:mga0rr50_18023_c1 3300050513 Bacteria 4733
247 nmdc:mga08x19_114559_c1 3300050514 Unclassified 1801
248 nmdc:mga0a205_534316_c1 3300050515 Unclassified 1028
249 Ga0501084_0022873 3300054114 Bacteria 5216
250 Ga0501084_0115366 3300054114 Bacteria 2257
251 Ga0530510_0494953 3300061734 Unclassified 926

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10668978 Ga0157375_106689782 155
2 3300005578 Ga0068854_101003617 Ga0068854_1010036172 176
3 3300005445 Ga0070708_100076446 Ga0070708_1000764462 181
4 3300005536 Ga0070697_100231029 Ga0070697_1002310292 181
5 3300006844 Ga0075428_100994921 Ga0075428_1009949211 181
6 3300006880 Ga0075429_100726402 Ga0075429_1007264021 181
7 3300009147 Ga0114129_10724502 Ga0114129_107245022 181
8 3300025933 Ga0207706_10212585 Ga0207706_102125852 181
9 3300025933 Ga0207706_10637219 Ga0207706_106372192 181
10 3300025972 Ga0207668_10513364 Ga0207668_105133642 181
11 3300031548 Ga0307408_100202211 Ga0307408_1002022113 186
12 3300031852 Ga0307410_10837770 Ga0307410_108377701 186
13 3300032002 Ga0307416_100087463 Ga0307416_1000874632 186
14 3300005336 Ga0070680_100005456 Ga0070680_1000054565 187
15 3300007076 Ga0075435_100067725 Ga0075435_1000677252 187
16 3300009147 Ga0114129_10721912 Ga0114129_107219122 187
17 3300025901 Ga0207688_10002118 Ga0207688_100021183 187
18 3300025907 Ga0207645_10001096 Ga0207645_1000109616 187
19 3300026067 Ga0207678_10010984 Ga0207678_100109844 187
20 3300035691 Ga0373931_0030192 Ga0373931_0030192_485_1051 187
21 3300048914 Ga0496111_0720687 Ga0496111_0720687_28_594 188
22 3300031235 Ga0265330_10025651 Ga0265330_100256513 190
23 3300031238 Ga0265332_10207189 Ga0265332_102071891 190
24 3300031247 Ga0265340_10017468 Ga0265340_100174683 190
25 3300031344 Ga0265316_10002343 Ga0265316_1000234322 190
26 3300031344 Ga0265316_10021226 Ga0265316_100212263 190
27 3300031712 Ga0265342_10000057 Ga0265342_10000057105 190
28 3300031712 Ga0265342_10050728 Ga0265342_100507282 190
29 3300042876 Ga0451577_0136762 Ga0451577_0136762_122_694 190
30 3300042876 Ga0451577_0539052 Ga0451577_0539052_223_795 190
31 3300044712 Ga0453684_0000060 Ga0453684_0000060_382971_383543 190
32 3300044712 Ga0453684_0011942 Ga0453684_0011942_9527_10099 190
33 3300044712 Ga0453684_0056745 Ga0453684_0056745_1261_1833 190
34 3300044712 Ga0453684_0089343 Ga0453684_0089343_2467_3039 190
35 3300044712 Ga0453684_0588946 Ga0453684_0588946_96_668 190
36 3300005353 Ga0070669_100578852 Ga0070669_1005788522 191
37 3300005840 Ga0068870_10039766 Ga0068870_100397662 191
38 3300005844 Ga0068862_100562938 Ga0068862_1005629382 191
39 3300006846 Ga0075430_100717950 Ga0075430_1007179502 191
40 3300009094 Ga0111539_10073994 Ga0111539_100739942 191
41 3300025908 Ga0207643_10038422 Ga0207643_100384223 191
42 3300025923 Ga0207681_10403294 Ga0207681_104032942 191
43 3300025923 Ga0207681_10781467 Ga0207681_107814672 191
44 3300026075 Ga0207708_10411505 Ga0207708_104115052 191
45 3300027907 Ga0207428_10054641 Ga0207428_100546412 191
46 3300044712 Ga0453684_0005400 Ga0453684_0005400_9634_10209 191
47 3300044712 Ga0453684_0062012 Ga0453684_0062012_3658_4233 191
48 3300050508 nmdc:mga09592_758601_c1 nmdc:mga09592_758601_c1_189_764 191
49 3300050511 nmdc:mga08y16_15132_c1 nmdc:mga08y16_15132_c1_6974_7549 191
50 3300044712 Ga0453684_0000043 Ga0453684_0000043_264575_265153 192
51 3300045051 Ga0451576_0291183 Ga0451576_0291183_971_1549 192
52 3300009174 Ga0105241_10204883 Ga0105241_102048832 193
53 3300031548 Ga0307408_100537666 Ga0307408_1005376662 193
54 3300049664 Ga0501224_021819 Ga0501224_021819_265_846 193
55 3300021388 Ga0213875_10000151 Ga0213875_1000015134 194
56 3300037853 Ga0436364_0368246 Ga0436364_0368246_31088_31699 194
57 3300009147 Ga0114129_10306818 Ga0114129_103068183 195
58 3300050507 nmdc:mga05p37_7526_c1 nmdc:mga05p37_7526_c1_5529_6119 195
59 3300050508 nmdc:mga09592_12012_c1 nmdc:mga09592_12012_c1_938_1528 195
60 3300050510 nmdc:mga06r32_77947_c1 nmdc:mga06r32_77947_c1_1493_2083 195
61 3300050512 nmdc:mga0n895_862483_c1 nmdc:mga0n895_862483_c1_38_628 195
62 3300006852 Ga0075433_11072746 Ga0075433_110727461 196
63 3300025938 Ga0207704_10254072 Ga0207704_102540722 196
64 3300031727 Ga0316576_10000122 Ga0316576_1000012210 196
65 3300031728 Ga0316578_10025336 Ga0316578_100253363 196
66 3300031344 Ga0265316_10086770 Ga0265316_100867702 197
67 3300036647 Ga0316582_0004037 Ga0316582_0004037_2927_3547 197
68 3300037588 Ga0316581_0031373 Ga0316581_0031373_847_1467 197
69 3300028381 Ga0268264_10315251 Ga0268264_103152511 198
70 3300049570 Ga0501033_0156259 Ga0501033_0156259_807_1406 198
71 3300049572 Ga0501036_0378998 Ga0501036_0378998_522_1121 198
72 3300049573 Ga0501037_0091142 Ga0501037_0091142_131_730 198
73 3300049574 Ga0501038_0167943 Ga0501038_0167943_942_1541 198
74 3300049577 Ga0501041_0162462 Ga0501041_0162462_560_1159 198
75 3300049578 Ga0501042_0508824 Ga0501042_0508824_38_637 198
76 3300049587 Ga0501071_0543090 Ga0501071_0543090_62_661 198
77 3300049591 Ga0501075_0446274 Ga0501075_0446274_150_749 198
78 3300049743 Ga0501081_0296115 Ga0501081_0296115_360_959 198
79 3300054114 Ga0501084_0115366 Ga0501084_0115366_922_1521 198
80 3300005843 Ga0068860_100043363 Ga0068860_1000433634 200
81 3300028381 Ga0268264_10184351 Ga0268264_101843512 200
82 3300036647 Ga0316582_0062900 Ga0316582_0062900_1280_1909 200
83 3300005549 Ga0070704_100339358 Ga0070704_1003393583 201
84 3300050515 nmdc:mga0a205_534316_c1 nmdc:mga0a205_534316_c1_18_623 201
85 3300005467 Ga0070706_100035460 Ga0070706_1000354603 202
86 3300005536 Ga0070697_100019291 Ga0070697_1000192912 202
87 3300005543 Ga0070672_100775809 Ga0070672_1007758091 202
88 3300005615 Ga0070702_100591309 Ga0070702_1005913091 202
89 3300009553 Ga0105249_10975834 Ga0105249_109758341 202
90 3300013306 Ga0163162_10854134 Ga0163162_108541342 202
91 3300025910 Ga0207684_10601031 Ga0207684_106010312 202
92 3300025961 Ga0207712_10549072 Ga0207712_105490722 202
93 3300035207 Ga0373942_0129117 Ga0373942_0129117_57_668 202
94 3300048905 Ga0496102_0037211 Ga0496102_0037211_2523_3134 202
95 3300005844 Ga0068862_101118899 Ga0068862_1011188991 203
96 3300006847 Ga0075431_100328569 Ga0075431_1003285692 203
97 3300009147 Ga0114129_10865962 Ga0114129_108659622 203
98 3300028380 Ga0268265_10846125 Ga0268265_108461251 203
99 3300039062 Ga0400483_117603 Ga0400483_117603_1272_1925 203
100 3300039062 Ga0400483_122756 Ga0400483_122756_290_943 203
101 3300039062 Ga0400483_175627 Ga0400483_175627_659_1312 203
102 3300050510 nmdc:mga06r32_335439_c1 nmdc:mga06r32_335439_c1_809_1423 203
103 3300005445 Ga0070708_100322134 Ga0070708_1003221342 205
104 3300005536 Ga0070697_100190600 Ga0070697_1001906001 205
105 3300006844 Ga0075428_100321707 Ga0075428_1003217072 205
106 3300006880 Ga0075429_100463225 Ga0075429_1004632252 205
107 3300009147 Ga0114129_10143129 Ga0114129_101431293 205
108 3300050507 nmdc:mga05p37_127328_c1 nmdc:mga05p37_127328_c1_806_1426 205
109 3300050507 nmdc:mga05p37_48240_c1 nmdc:mga05p37_48240_c1_3727_4347 205
110 3300050508 nmdc:mga09592_249810_c1 nmdc:mga09592_249810_c1_633_1253 205
111 3300005290 Ga0065712_10011008 Ga0065712_100110084 206
112 3300005293 Ga0065715_10007123 Ga0065715_100071234 206
113 3300005295 Ga0065707_10012957 Ga0065707_100129573 206
114 3300005328 Ga0070676_10031172 Ga0070676_100311724 206
115 3300005331 Ga0070670_100031128 Ga0070670_1000311284 206
116 3300005337 Ga0070682_100065770 Ga0070682_1000657704 206
117 3300005339 Ga0070660_100024624 Ga0070660_1000246244 206
118 3300005340 Ga0070689_100070399 Ga0070689_1000703994 206
119 3300005341 Ga0070691_10013304 Ga0070691_100133045 206
120 3300005344 Ga0070661_100002336 Ga0070661_1000023365 206
121 3300005347 Ga0070668_100070099 Ga0070668_1000700994 206
122 3300005353 Ga0070669_100038852 Ga0070669_1000388523 206
123 3300005356 Ga0070674_100010866 Ga0070674_1000108663 206
124 3300005367 Ga0070667_100044759 Ga0070667_1000447592 206
125 3300005445 Ga0070708_100527534 Ga0070708_1005275341 206
126 3300005455 Ga0070663_100003226 Ga0070663_1000032268 206
127 3300005456 Ga0070678_100023859 Ga0070678_1000238592 206
128 3300005456 Ga0070678_100561631 Ga0070678_1005616311 206
129 3300005458 Ga0070681_10089019 Ga0070681_100890193 206
130 3300005459 Ga0068867_100364827 Ga0068867_1003648272 206
131 3300005467 Ga0070706_100121958 Ga0070706_1001219583 206
132 3300005518 Ga0070699_100236314 Ga0070699_1002363142 206
133 3300005530 Ga0070679_100100407 Ga0070679_1001004074 206
134 3300005535 Ga0070684_100108013 Ga0070684_1001080132 206
135 3300005536 Ga0070697_100439028 Ga0070697_1004390281 206
136 3300005543 Ga0070672_100105473 Ga0070672_1001054734 206
137 3300005545 Ga0070695_100010371 Ga0070695_1000103716 206
138 3300005546 Ga0070696_100023315 Ga0070696_1000233155 206
139 3300005546 Ga0070696_100114186 Ga0070696_1001141862 206
140 3300005547 Ga0070693_100036350 Ga0070693_1000363502 206
141 3300005549 Ga0070704_100077742 Ga0070704_1000777423 206
142 3300005563 Ga0068855_100304814 Ga0068855_1003048143 206
143 3300005564 Ga0070664_100001170 Ga0070664_10000117011 206
144 3300005577 Ga0068857_100446962 Ga0068857_1004469622 206
145 3300005578 Ga0068854_100072140 Ga0068854_1000721404 206
146 3300005614 Ga0068856_100082723 Ga0068856_1000827234 206
147 3300005616 Ga0068852_100159314 Ga0068852_1001593143 206
148 3300005617 Ga0068859_100094012 Ga0068859_1000940122 206
149 3300005618 Ga0068864_100374490 Ga0068864_1003744902 206
150 3300005719 Ga0068861_100315224 Ga0068861_1003152242 206
151 3300005843 Ga0068860_100489343 Ga0068860_1004893431 206
152 3300005981 Ga0081538_10024786 Ga0081538_100247862 206
153 3300005981 Ga0081538_10048321 Ga0081538_100483212 206
154 3300006058 Ga0075432_10034192 Ga0075432_100341922 206
155 3300006237 Ga0097621_100293106 Ga0097621_1002931062 206
156 3300006844 Ga0075428_100032502 Ga0075428_1000325024 206
157 3300006844 Ga0075428_100096653 Ga0075428_1000966531 206
158 3300006844 Ga0075428_100688628 Ga0075428_1006886282 206
159 3300006846 Ga0075430_100218943 Ga0075430_1002189432 206
160 3300006847 Ga0075431_100032547 Ga0075431_1000325474 206
161 3300006847 Ga0075431_100112082 Ga0075431_1001120823 206
162 3300006852 Ga0075433_10015247 Ga0075433_100152473 206
163 3300006880 Ga0075429_100008876 Ga0075429_1000088764 206
164 3300006914 Ga0075436_100197796 Ga0075436_1001977962 206
165 3300006931 Ga0097620_100094014 Ga0097620_1000940142 206
166 3300007076 Ga0075435_100549205 Ga0075435_1005492052 206
167 3300009092 Ga0105250_10174619 Ga0105250_101746192 206
168 3300009147 Ga0114129_10662537 Ga0114129_106625372 206
169 3300009174 Ga0105241_10679666 Ga0105241_106796662 206
170 3300009176 Ga0105242_10090896 Ga0105242_100908962 206
171 3300009545 Ga0105237_10098565 Ga0105237_100985654 206
172 3300009553 Ga0105249_10169217 Ga0105249_101692172 206
173 3300010375 Ga0105239_10225964 Ga0105239_102259643 206
174 3300011119 Ga0105246_10021934 Ga0105246_100219344 206
175 3300013296 Ga0157374_10073704 Ga0157374_100737043 206
176 3300013306 Ga0163162_10064228 Ga0163162_100642285 206
177 3300014969 Ga0157376_10014464 Ga0157376_100144646 206
178 3300025893 Ga0207682_10049826 Ga0207682_100498262 206
179 3300025903 Ga0207680_10153076 Ga0207680_101530762 206
180 3300025910 Ga0207684_10094453 Ga0207684_100944532 206
181 3300025919 Ga0207657_10005240 Ga0207657_1000524011 206
182 3300025920 Ga0207649_10318141 Ga0207649_103181412 206
183 3300025925 Ga0207650_10000676 Ga0207650_1000067614 206
184 3300025932 Ga0207690_10049132 Ga0207690_100491323 206
185 3300025933 Ga0207706_10002373 Ga0207706_1000237321 206
186 3300025936 Ga0207670_10194704 Ga0207670_101947042 206
187 3300025940 Ga0207691_10003200 Ga0207691_1000320019 206
188 3300025945 Ga0207679_10006174 Ga0207679_100061742 206
189 3300025949 Ga0207667_10118313 Ga0207667_101183134 206
190 3300025960 Ga0207651_10080076 Ga0207651_100800763 206
191 3300025972 Ga0207668_10057804 Ga0207668_100578044 206
192 3300025981 Ga0207640_10039466 Ga0207640_100394664 206
193 3300026088 Ga0207641_10089690 Ga0207641_100896901 206
194 3300026089 Ga0207648_10050974 Ga0207648_100509743 206
195 3300026121 Ga0207683_10000467 Ga0207683_1000046719 206
196 3300035090 Ga0373949_0041098 Ga0373949_0041098_361_1017 206
197 3300035119 Ga0373956_0142590 Ga0373956_0142590_23_649 206
198 3300035121 Ga0373960_0024322 Ga0373960_0024322_751_1407 206
199 3300036401 Ga0373937_0835892 Ga0373937_0835892_97_723 206
200 3300044673 Ga0453683_0000837 Ga0453683_0000837_6436_7089 206
201 3300045051 Ga0451576_0284759 Ga0451576_0284759_309_929 206
202 3300046472 Ga0495580_0422039 Ga0495580_0422039_136_759 206
203 3300048905 Ga0496102_0071263 Ga0496102_0071263_393_1013 206
204 3300048909 Ga0496106_0398400 Ga0496106_0398400_10_630 206
205 3300048911 Ga0496108_0407238 Ga0496108_0407238_258_878 206
206 3300048915 Ga0496112_0038410 Ga0496112_0038410_640_1260 206
207 3300049572 Ga0501036_0075244 Ga0501036_0075244_1594_2250 206
208 3300049572 Ga0501036_0816412 Ga0501036_0816412_68_721 206
209 3300049573 Ga0501037_0071141 Ga0501037_0071141_1387_2043 206
210 3300049575 Ga0501039_0026352 Ga0501039_0026352_3196_3852 206
211 3300049576 Ga0501040_0040319 Ga0501040_0040319_940_1596 206
212 3300049576 Ga0501040_0519917 Ga0501040_0519917_192_827 206
213 3300049578 Ga0501042_0083802 Ga0501042_0083802_1422_2078 206
214 3300049579 Ga0501043_0361738 Ga0501043_0361738_95_751 206
215 3300049580 Ga0501046_0165700 Ga0501046_0165700_890_1546 206
216 3300049582 Ga0501048_0053174 Ga0501048_0053174_954_1610 206
217 3300049582 Ga0501048_0057319 Ga0501048_0057319_1014_1667 206
218 3300049584 Ga0501068_0223045 Ga0501068_0223045_531_1187 206
219 3300049586 Ga0501070_0133752 Ga0501070_0133752_1294_1950 206
220 3300049587 Ga0501071_0009158 Ga0501071_0009158_5432_6088 206
221 3300049588 Ga0501072_0000127 Ga0501072_0000127_46222_46878 206
222 3300049588 Ga0501072_0314233 Ga0501072_0314233_341_976 206
223 3300049588 Ga0501072_0633812 Ga0501072_0633812_64_720 206
224 3300049589 Ga0501073_0235633 Ga0501073_0235633_464_1120 206
225 3300049590 Ga0501074_0038873 Ga0501074_0038873_916_1569 206
226 3300049591 Ga0501075_0033633 Ga0501075_0033633_913_1569 206
227 3300049591 Ga0501075_0195404 Ga0501075_0195404_504_1139 206
228 3300049592 Ga0501076_0225482 Ga0501076_0225482_830_1483 206
229 3300049593 Ga0501077_0022431 Ga0501077_0022431_778_1434 206
230 3300049593 Ga0501077_0045301 Ga0501077_0045301_504_1160 206
231 3300049593 Ga0501077_0059262 Ga0501077_0059262_859_1515 206
232 3300049593 Ga0501077_0146016 Ga0501077_0146016_499_1152 206
233 3300049741 Ga0501079_0210770 Ga0501079_0210770_699_1352 206
234 3300049742 Ga0501080_0068490 Ga0501080_0068490_1928_2581 206
235 3300049742 Ga0501080_0096013 Ga0501080_0096013_1577_2233 206
236 3300049744 Ga0501083_0096037 Ga0501083_0096037_1286_1939 206
237 3300049744 Ga0501083_0337813 Ga0501083_0337813_187_843 206
238 3300049824 Ga0501045_0002346 Ga0501045_0002346_15_671 206
239 3300049824 Ga0501045_0093063 Ga0501045_0093063_571_1224 206
240 3300050507 nmdc:mga05p37_20299_c1 nmdc:mga05p37_20299_c1_3712_4365 206
241 3300050507 nmdc:mga05p37_26816_c1 nmdc:mga05p37_26816_c1_1585_2241 206
242 3300050508 nmdc:mga09592_9831_c1 nmdc:mga09592_9831_c1_1584_2240 206
243 3300050509 nmdc:mga0qj67_442091_c1 nmdc:mga0qj67_442091_c1_329_985 206
244 3300050510 nmdc:mga06r32_21594_c1 nmdc:mga06r32_21594_c1_2749_3405 206
245 3300050512 nmdc:mga0n895_15569_c1 nmdc:mga0n895_15569_c1_264_920 206
246 3300050512 nmdc:mga0n895_23405_c1 nmdc:mga0n895_23405_c1_5159_5779 206
247 3300050513 nmdc:mga0rr50_15721_c1 nmdc:mga0rr50_15721_c1_4006_4626 206
248 3300050513 nmdc:mga0rr50_18023_c1 nmdc:mga0rr50_18023_c1_3632_4288 206
249 3300050514 nmdc:mga08x19_114559_c1 nmdc:mga08x19_114559_c1_1072_1725 206
250 3300054114 Ga0501084_0022873 Ga0501084_0022873_705_1361 206
251 3300061734 Ga0530510_0494953 Ga0530510_0494953_17_670 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

24

200

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f89-assembly1.cif.gz_A structure of h234a/y235a p.abyssi sua5 0.9444 8 205
6f89-assembly2.cif.gz_B structure of h234a/y235a p.abyssi sua5 0.944 8 205
6f87-assembly3.cif.gz_C crystal structure of p. abyssi sua5 complexed with l-threonine and ppi 0.9414 8 205
3aje-assembly1.cif.gz_A crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp 0.935 8 205
2eqa-assembly1.cif.gz_A crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii 0.9324 8 205
ID Description Score Start End Superfamily
af_Q2FWE2_20_236_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9337 6 205 3.90.870.10
4e1bA01 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9319 8 205 3.90.870.10
af_Q8I610_4_210_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9315 8 179 3.90.870.10
af_P9WGC9_2_211_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9313 2 199 3.90.870.10
af_A0A1D8PQL4_32_243_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9284 1 201 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A7C3JM78-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9877 10 205 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A6I1QZF0-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9841 8 199 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A1F9K8N4-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.982 9 199 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A535B0N7-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9747 2 205 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A7J5VSD6-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9744 6 201 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779

Feature Viewer

pLDDT pTM Quality
94.37 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map