F362081

General Info

Members Datasets Scaffolds Average Seq Length
251 195 500 119

Family's Representative Sequence

Representative Sequence 3300002459|JGI24751J29686_10008866|JGI24751J29686_100088662
Length 125
Sequence MAVVSMTTDHLSETFAALADPTRRAILARLLTSECSVTELAEPFDMSMPAVSKHLRVLERAGLIARRREAQFRHCRIEPGPLKDVAEWMERYREVWEGRLDRLDAYLRQMNSTKKEDRHDRPRRK

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
54 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
140 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
158 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
195 2643221591 Devosia sp. Root685 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 7.97
Rhizosphere 85.66
Stem 0
Stem Tuber 0
Unclassified 9.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10008866 3300002459 Bacteria 2063
2 SwRhRL2b_contig_1758216 2162886007 Bacteria 61617
3 Ga0055530_10010293 3300003791 Bacteria 3477
4 Ga0065704_10070148 3300005289 Bacteria 264542
5 Ga0070676_11347013 3300005328 Bacteria 546
6 Ga0070683_100208736 3300005329 Bacteria 1855
7 Ga0070670_100015511 3300005331 Bacteria 6543
8 Ga0070670_100129943 3300005331 Bacteria 2175
9 Ga0070680_100114006 3300005336 Bacteria 2252
10 Ga0068868_100036811 3300005338 Bacteria 3791
11 Ga0070660_100021100 3300005339 Bacteria 4798
12 Ga0070660_100422379 3300005339 Bacteria 1104
13 Ga0070660_101374143 3300005339 Bacteria 600
14 Ga0070689_100009981 3300005340 Bacteria 6755
15 Ga0070687_100002884 3300005343 Bacteria 6575
16 Ga0070661_100001808 3300005344 Bacteria 14836
17 Ga0070692_10025516 3300005345 Bacteria 2913
18 Ga0070668_100004750 3300005347 Bacteria 10079
19 Ga0070688_100536334 3300005365 Bacteria 888
20 Ga0070659_100057214 3300005366 Bacteria 3074
21 Ga0070659_100596285 3300005366 Bacteria 949
22 Ga0070667_100462920 3300005367 Bacteria 1159
23 Ga0070667_100829428 3300005367 Bacteria 859
24 Ga0070709_10332336 3300005434 Bacteria 1118
25 Ga0070713_100004331 3300005436 Bacteria 9520
26 Ga0070710_10071390 3300005437 Bacteria 2002
27 Ga0070711_100274779 3300005439 Bacteria 1331
28 Ga0070705_100142361 3300005440 Bacteria 1580
29 Ga0070694_100061124 3300005444 Bacteria 2571
30 Ga0070663_100055975 3300005455 Bacteria 2825
31 Ga0070662_100012798 3300005457 Bacteria 5570
32 Ga0070681_10001803 3300005458 Bacteria 19262
33 Ga0070681_11701753 3300005458 Bacteria 557
34 Ga0070679_100004187 3300005530 Bacteria 13301
35 Ga0070684_100135046 3300005535 Bacteria 2228
36 Ga0070686_100767766 3300005544 Bacteria 774
37 Ga0068855_100139943 3300005563 Bacteria 2760
38 Ga0068855_100317860 3300005563 Bacteria 1722
39 Ga0070664_100007806 3300005564 Bacteria 8642
40 Ga0070664_101257381 3300005564 Unclassified 699
41 Ga0068857_100005357 3300005577 Bacteria 10935
42 Ga0070702_100023269 3300005615 Bacteria 3290
43 Ga0070702_100752223 3300005615 Unclassified 749
44 Ga0068852_100017010 3300005616 Bacteria 5693
45 Ga0068852_100396288 3300005616 Bacteria 1357
46 Ga0068859_100170761 3300005617 Bacteria 2255
47 Ga0068866_10655172 3300005718 Bacteria 715
48 Ga0068866_11204962 3300005718 Bacteria 547
49 Ga0068851_10007830 3300005834 Bacteria 4920
50 Ga0068851_10008879 3300005834 Bacteria 4661
51 Ga0081455_10360520 3300005937 Bacteria 1022
52 Ga0070717_10068720 3300006028 Bacteria 2949
53 Ga0070716_101208925 3300006173 Unclassified 607
54 Ga0070712_101378427 3300006175 Bacteria 615
55 Ga0075428_100116903 3300006844 Bacteria 2904
56 Ga0075431_100231197 3300006847 Bacteria 1884
57 Ga0075431_100296870 3300006847 Unclassified 1633
58 Ga0075434_100039871 3300006871 Bacteria 4651
59 Ga0097620_100170765 3300006931 Bacteria 2255
60 Ga0075435_100336571 3300007076 Bacteria 1293
61 Ga0075435_100459857 3300007076 Bacteria 1098
62 Ga0105240_10353040 3300009093 Bacteria 1668
63 Ga0111539_10042235 3300009094 Bacteria 5478
64 Ga0111539_10098751 3300009094 Bacteria 3429
65 Ga0114129_10135373 3300009147 Bacteria 3381
66 Ga0105249_10113961 3300009553 Bacteria 2559
67 Ga0105239_10055176 3300010375 Bacteria 4358
68 Ga0105239_10056132 3300010375 Bacteria 4319
69 Ga0157323_1008570 3300012495 Bacteria 765
70 Ga0157326_1000290 3300012513 Bacteria 5859
71 Ga0157373_10605103 3300013100 Bacteria 798
72 Ga0157373_10617197 3300013100 Bacteria 790
73 Ga0157371_10016387 3300013102 Bacteria 5532
74 Ga0157371_10592752 3300013102 Bacteria 824
75 Ga0157370_10542438 3300013104 Bacteria 1066
76 Ga0157370_11791722 3300013104 Unclassified 551
77 Ga0157369_10409294 3300013105 Bacteria 1407
78 Ga0157374_10121956 3300013296 Bacteria 2516
79 Ga0157378_10161714 3300013297 Unclassified 2094
80 Ga0163162_10520091 3300013306 Bacteria 1319
81 Ga0163163_10621616 3300014325 Bacteria 1144
82 Ga0157379_10044277 3300014968 Bacteria 3973
83 Ga0163161_10088537 3300017792 Bacteria 2288
84 Ga0213872_10207992 3300021361 Unclassified 836
85 Ga0213871_10024386 3300021441 Bacteria 1531
86 Ga0209050_1000820 3300025298 Bacteria 43328
87 Ga0207697_10013293 3300025315 Bacteria 3435
88 Ga0207656_10032174 3300025321 Bacteria 2177
89 Ga0207656_10077277 3300025321 Bacteria 1490
90 Ga0207642_10142990 3300025899 Bacteria 1264
91 Ga0207688_10018587 3300025901 Bacteria 3781
92 Ga0207680_10092398 3300025903 Bacteria 1927
93 Ga0207647_10098973 3300025904 Bacteria 1732
94 Ga0207685_10341533 3300025905 Bacteria 752
95 Ga0207699_10165626 3300025906 Bacteria 1475
96 Ga0207645_10963972 3300025907 Bacteria 578
97 Ga0207707_10035678 3300025912 Bacteria 4348
98 Ga0207693_10137073 3300025915 Bacteria 1924
99 Ga0207663_10434953 3300025916 Bacteria 1009
100 Ga0207660_10263232 3300025917 Bacteria 1364
101 Ga0207662_10002728 3300025918 Bacteria 8910
102 Ga0207657_10150993 3300025919 Bacteria 1892
103 Ga0207657_11047056 3300025919 Bacteria 625
104 Ga0207649_10025150 3300025920 Bacteria 3469
105 Ga0207652_10061513 3300025921 Bacteria 3242
106 Ga0207650_10256978 3300025925 Bacteria 1416
107 Ga0207650_10267087 3300025925 Bacteria 1389
108 Ga0207650_10305528 3300025925 Unclassified 1300
109 Ga0207700_10038822 3300025928 Bacteria 3460
110 Ga0207690_10115398 3300025932 Bacteria 1941
111 Ga0207690_11219033 3300025932 Bacteria 628
112 Ga0207669_10294305 3300025937 Bacteria 1231
113 Ga0207691_10002006 3300025940 Bacteria 19922
114 Ga0207661_10348098 3300025944 Bacteria 1336
115 Ga0207667_10059289 3300025949 Unclassified 4009
116 Ga0207667_11433493 3300025949 Bacteria 663
117 Ga0207667_11521588 3300025949 Bacteria 640
118 Ga0207651_10225794 3300025960 Bacteria 1517
119 Ga0207712_10454628 3300025961 Unclassified 1087
120 Ga0207668_10316279 3300025972 Bacteria 1294
121 Ga0207658_10793799 3300025986 Bacteria 859
122 Ga0207658_11059512 3300025986 Bacteria 740
123 Ga0207677_10273938 3300026023 Bacteria 1382
124 Ga0207639_10026838 3300026041 Bacteria 4188
125 Ga0207678_10466001 3300026067 Bacteria 1099
126 Ga0207708_10110062 3300026075 Bacteria 2137
127 Ga0207702_11537115 3300026078 Bacteria 659
128 Ga0207641_10414480 3300026088 Unclassified 1296
129 Ga0207641_10562483 3300026088 Bacteria 1113
130 Ga0207674_10004450 3300026116 Bacteria 16842
131 Ga0207674_10806385 3300026116 Bacteria 906
132 Ga0207675_100004080 3300026118 Bacteria 14138
133 Ga0207698_11084436 3300026142 Bacteria 813
134 Ga0207428_10093550 3300027907 Bacteria 2331
135 Ga0268264_10710087 3300028381 Bacteria 999
136 Ga0265318_10054583 3300028577 Bacteria 1497
137 Ga0307511_10043713 3300030521 Bacteria 3736
138 Ga0307513_11043444 3300031456 Bacteria 528
139 Ga0307408_100019425 3300031548 Bacteria 4576
140 Ga0307413_11484373 3300031824 Bacteria 599
141 Ga0307406_10123747 3300031901 Bacteria 1803
142 Ga0307406_10224535 3300031901 Bacteria 1398
143 Ga0373959_0189305 3300034820 Bacteria 539
144 Ga0373931_0358982 3300035691 Bacteria 914
145 Ga0395899_0372078 3300037312 Unclassified 951
146 Ga0395900_0368785 3300037418 Bacteria 1406
147 Ga0395898_0650656 3300037466 Unclassified 996
148 Ga0395905_0001283 3300037471 Bacteria 31000
149 Ga0395905_0129805 3300037471 Bacteria 2370
150 Ga0395905_0447557 3300037471 Bacteria 1189
151 Ga0436364_0285845 3300037853 Bacteria 4021
152 Ga0395901_0091989 3300038443 Bacteria 3175
153 Ga0436360_0157843 3300039438 Unclassified 2753
154 Ga0436360_0226462 3300039438 Unclassified 3767
155 Ga0436361_0290575 3300039447 Unclassified 1266
156 Ga0436361_0574152 3300039447 Unclassified 1183
157 Ga0436362_0506263 3300039453 Bacteria 1310
158 Ga0436362_1241347 3300039453 Bacteria 781
159 Ga0451793_0961576 3300041452 Bacteria 510
160 Ga0451807_2227586 3300041486 Bacteria 545
161 Ga0451839_0083000 3300041496 Bacteria 539
162 Ga0451576_0101628 3300045051 Bacteria 2990
163 Ga0495638_0001765 3300046460 Bacteria 18944
164 Ga0495650_0000254 3300046471 Bacteria 103512
165 Ga0495605_0001219 3300046474 Bacteria 17121
166 Ga0495584_0000824 3300046491 Bacteria 20361
167 Ga0495584_0022546 3300046491 Bacteria 3194
168 Ga0495584_0036122 3300046491 Bacteria 2496
169 Ga0495585_0108397 3300046492 Bacteria 1479
170 Ga0495607_0004166 3300046501 Bacteria 10750
171 Ga0495607_0152288 3300046501 Bacteria 1182
172 Ga0495583_0000016 3300046506 Bacteria 312691
173 Ga0495583_0028414 3300046506 Bacteria 2750
174 Ga0495606_0046218 3300046507 Bacteria 2879
175 Ga0495616_0001162 3300046513 Bacteria 18624
176 Ga0495616_0003163 3300046513 Bacteria 10628
177 Ga0495644_0000339 3300046523 Bacteria 21282
178 Ga0495648_0000384 3300046524 Bacteria 48550
179 Ga0495648_0430450 3300046524 Bacteria 582
180 Ga0495663_0018164 3300046525 Bacteria 2001
181 Ga0495598_0086532 3300046537 Bacteria 1015
182 Ga0495609_0000431 3300046538 Bacteria 34849
183 Ga0495597_0285572 3300046542 Bacteria 642
184 Ga0495633_0005455 3300046558 Bacteria 7765
185 Ga0495668_0000035 3300046616 Bacteria 240241
186 Ga0495611_0001508 3300046648 Bacteria 11493
187 Ga0495625_0006409 3300046660 Bacteria 10489
188 Ga0495659_0000461 3300046664 Bacteria 15185
189 Ga0495661_0025189 3300046665 Bacteria 3845
190 Ga0495658_0099481 3300046683 Bacteria 1734
191 Ga0495670_0005361 3300046691 Bacteria 6306
192 Ga0495671_0001937 3300046692 Bacteria 13276
193 Ga0495589_0107909 3300046794 Bacteria 1345
194 Ga0495636_0000252 3300047318 Bacteria 21169
195 Ga0495636_0085996 3300047318 Bacteria 1359
196 Ga0495672_0011095 3300047320 Bacteria 6377
197 Ga0495683_0009179 3300047323 Bacteria 5270
198 Ga0495687_000281 3300047443 Bacteria 66974
199 Ga0495677_0000230 3300047445 Bacteria 25473
200 Ga0495685_000057 3300047447 Bacteria 41679
201 Ga0495685_184987 3300047447 Unclassified 670
202 Ga0495673_0005591 3300047469 Bacteria 7568
203 Ga0495673_0126610 3300047469 Bacteria 1007
204 Ga0495686_0002165 3300047472 Bacteria 19136
205 Ga0496102_0000478 3300048905 Bacteria 44372
206 Ga0496102_1678637 3300048905 Unclassified 553
207 Ga0496103_0068472 3300048906 Bacteria 2218
208 Ga0496104_0133707 3300048907 Bacteria 2382
209 Ga0496104_0179273 3300048907 Bacteria 2029
210 Ga0496106_0709592 3300048909 Unclassified 801
211 Ga0496108_0613769 3300048911 Bacteria 947
212 Ga0496109_0003895 3300048912 Bacteria 12468
213 Ga0496110_0004317 3300048913 Bacteria 10996
214 Ga0496110_0039023 3300048913 Bacteria 4134
215 Ga0496110_0429629 3300048913 Bacteria 1204
216 Ga0496110_1123448 3300048913 Unclassified 694
217 Ga0496111_0053282 3300048914 Bacteria 2923
218 Ga0496111_0229834 3300048914 Unclassified 1378
219 Ga0496111_0750656 3300048914 Bacteria 708
220 Ga0496112_0734254 3300048915 Bacteria 914
221 Ga0496113_0064797 3300048916 Bacteria 2764
222 Ga0496115_0002481 3300048918 Bacteria 13262
223 Ga0496121_0392897 3300048924 Bacteria 911
224 Ga0496124_0043381 3300048927 Bacteria 3867
225 Ga0496124_0156756 3300048927 Bacteria 1780
226 Ga0496124_0451912 3300048927 Bacteria 876
227 Ga0496125_0000217 3300048928 Bacteria 117498
228 Ga0496126_0056651 3300048929 Bacteria 3542
229 Ga0495678_000905 3300049459 Bacteria 26145
230 Ga0495682_0000408 3300049460 Bacteria 30679
231 Ga0501300_079172 3300049523 Bacteria 539
232 Ga0501034_1419618 3300049571 Unclassified 569
233 Ga0501041_0961171 3300049577 Bacteria 549
234 Ga0501047_1133204 3300049581 Bacteria 596
235 Ga0501080_0872108 3300049742 Bacteria 786
236 nmdc:mga0k408_572186_c1 3300050493 Bacteria 667
237 nmdc:mga06z11_1015768_c1 3300050494 Unclassified 505
238 nmdc:mga06r32_116587_c1 3300050510 Unclassified 2631
239 nmdc:mga06r32_212819_c1 3300050510 Bacteria 1921
240 nmdc:mga08y16_108912_c1 3300050511 Bacteria 2884
241 nmdc:mga08y16_1156600_c1 3300050511 Bacteria 746
242 nmdc:mga0n895_152067_c1 3300050512 Bacteria 2345
243 nmdc:mga0rr50_88848_c1 3300050513 Bacteria 2401
244 nmdc:mga0a205_1388604_c1 3300050515 Bacteria 550
245 Ga0495619_0289684 3300053085 Bacteria 1134
246 Ga0500568_0002127 3300053139 Bacteria 11957
247 Ga0501084_0729377 3300054114 Bacteria 835
248 Ga0501082_0289342 3300060353 Bacteria 1427
249 Ga0530510_0248669 3300061734 Bacteria 1325
250 2643963243 2643221591 Bacteria 4397626
251 JGI24751J29686_10008866
252 SwRhRL2b_contig_1758216
253 Ga0055530_10010293
254 Ga0065704_10070148
255 Ga0070676_11347013
256 Ga0070683_100208736
257 Ga0070670_100015511
258 Ga0070670_100129943
259 Ga0070680_100114006
260 Ga0068868_100036811
261 Ga0070660_100021100
262 Ga0070660_100422379
263 Ga0070660_101374143
264 Ga0070689_100009981
265 Ga0070687_100002884
266 Ga0070661_100001808
267 Ga0070692_10025516
268 Ga0070668_100004750
269 Ga0070688_100536334
270 Ga0070659_100057214
271 Ga0070659_100596285
272 Ga0070667_100462920
273 Ga0070667_100829428
274 Ga0070709_10332336
275 Ga0070713_100004331
276 Ga0070710_10071390
277 Ga0070711_100274779
278 Ga0070705_100142361
279 Ga0070694_100061124
280 Ga0070663_100055975
281 Ga0070662_100012798
282 Ga0070681_10001803
283 Ga0070681_11701753
284 Ga0070679_100004187
285 Ga0070684_100135046
286 Ga0070686_100767766
287 Ga0068855_100139943
288 Ga0068855_100317860
289 Ga0070664_100007806
290 Ga0070664_101257381
291 Ga0068857_100005357
292 Ga0070702_100023269
293 Ga0070702_100752223
294 Ga0068852_100017010
295 Ga0068852_100396288
296 Ga0068859_100170761
297 Ga0068866_10655172
298 Ga0068866_11204962
299 Ga0068851_10007830
300 Ga0068851_10008879
301 Ga0081455_10360520
302 Ga0070717_10068720
303 Ga0070716_101208925
304 Ga0070712_101378427
305 Ga0075428_100116903
306 Ga0075431_100231197
307 Ga0075431_100296870
308 Ga0075434_100039871
309 Ga0097620_100170765
310 Ga0075435_100336571
311 Ga0075435_100459857
312 Ga0105240_10353040
313 Ga0111539_10042235
314 Ga0111539_10098751
315 Ga0114129_10135373
316 Ga0105249_10113961
317 Ga0105239_10055176
318 Ga0105239_10056132
319 Ga0157323_1008570
320 Ga0157326_1000290
321 Ga0157373_10605103
322 Ga0157373_10617197
323 Ga0157371_10016387
324 Ga0157371_10592752
325 Ga0157370_10542438
326 Ga0157370_11791722
327 Ga0157369_10409294
328 Ga0157374_10121956
329 Ga0157378_10161714
330 Ga0163162_10520091
331 Ga0163163_10621616
332 Ga0157379_10044277
333 Ga0163161_10088537
334 Ga0213872_10207992
335 Ga0213871_10024386
336 Ga0209050_1000820
337 Ga0207697_10013293
338 Ga0207656_10032174
339 Ga0207656_10077277
340 Ga0207642_10142990
341 Ga0207688_10018587
342 Ga0207680_10092398
343 Ga0207647_10098973
344 Ga0207685_10341533
345 Ga0207699_10165626
346 Ga0207645_10963972
347 Ga0207707_10035678
348 Ga0207693_10137073
349 Ga0207663_10434953
350 Ga0207660_10263232
351 Ga0207662_10002728
352 Ga0207657_10150993
353 Ga0207657_11047056
354 Ga0207649_10025150
355 Ga0207652_10061513
356 Ga0207650_10256978
357 Ga0207650_10267087
358 Ga0207650_10305528
359 Ga0207700_10038822
360 Ga0207690_10115398
361 Ga0207690_11219033
362 Ga0207669_10294305
363 Ga0207691_10002006
364 Ga0207661_10348098
365 Ga0207667_10059289
366 Ga0207667_11433493
367 Ga0207667_11521588
368 Ga0207651_10225794
369 Ga0207712_10454628
370 Ga0207668_10316279
371 Ga0207658_10793799
372 Ga0207658_11059512
373 Ga0207677_10273938
374 Ga0207639_10026838
375 Ga0207678_10466001
376 Ga0207708_10110062
377 Ga0207702_11537115
378 Ga0207641_10414480
379 Ga0207641_10562483
380 Ga0207674_10004450
381 Ga0207674_10806385
382 Ga0207675_100004080
383 Ga0207698_11084436
384 Ga0207428_10093550
385 Ga0268264_10710087
386 Ga0265318_10054583
387 Ga0307511_10043713
388 Ga0307513_11043444
389 Ga0307408_100019425
390 Ga0307413_11484373
391 Ga0307406_10123747
392 Ga0307406_10224535
393 Ga0373959_0189305
394 Ga0373931_0358982
395 Ga0395899_0372078
396 Ga0395900_0368785
397 Ga0395898_0650656
398 Ga0395905_0001283
399 Ga0395905_0129805
400 Ga0395905_0447557
401 Ga0436364_0285845
402 Ga0395901_0091989
403 Ga0436360_0157843
404 Ga0436360_0226462
405 Ga0436361_0290575
406 Ga0436361_0574152
407 Ga0436362_0506263
408 Ga0436362_1241347
409 Ga0451793_0961576
410 Ga0451807_2227586
411 Ga0451839_0083000
412 Ga0451576_0101628
413 Ga0495638_0001765
414 Ga0495650_0000254
415 Ga0495605_0001219
416 Ga0495584_0000824
417 Ga0495584_0022546
418 Ga0495584_0036122
419 Ga0495585_0108397
420 Ga0495607_0004166
421 Ga0495607_0152288
422 Ga0495583_0000016
423 Ga0495583_0028414
424 Ga0495606_0046218
425 Ga0495616_0001162
426 Ga0495616_0003163
427 Ga0495644_0000339
428 Ga0495648_0000384
429 Ga0495648_0430450
430 Ga0495663_0018164
431 Ga0495598_0086532
432 Ga0495609_0000431
433 Ga0495597_0285572
434 Ga0495633_0005455
435 Ga0495668_0000035
436 Ga0495611_0001508
437 Ga0495625_0006409
438 Ga0495659_0000461
439 Ga0495661_0025189
440 Ga0495658_0099481
441 Ga0495670_0005361
442 Ga0495671_0001937
443 Ga0495589_0107909
444 Ga0495636_0000252
445 Ga0495636_0085996
446 Ga0495672_0011095
447 Ga0495683_0009179
448 Ga0495687_000281
449 Ga0495677_0000230
450 Ga0495685_000057
451 Ga0495685_184987
452 Ga0495673_0005591
453 Ga0495673_0126610
454 Ga0495686_0002165
455 Ga0496102_0000478
456 Ga0496102_1678637
457 Ga0496103_0068472
458 Ga0496104_0133707
459 Ga0496104_0179273
460 Ga0496106_0709592
461 Ga0496108_0613769
462 Ga0496109_0003895
463 Ga0496110_0004317
464 Ga0496110_0039023
465 Ga0496110_0429629
466 Ga0496110_1123448
467 Ga0496111_0053282
468 Ga0496111_0229834
469 Ga0496111_0750656
470 Ga0496112_0734254
471 Ga0496113_0064797
472 Ga0496115_0002481
473 Ga0496121_0392897
474 Ga0496124_0043381
475 Ga0496124_0156756
476 Ga0496124_0451912
477 Ga0496125_0000217
478 Ga0496126_0056651
479 Ga0495678_000905
480 Ga0495682_0000408
481 Ga0501300_079172
482 Ga0501034_1419618
483 Ga0501041_0961171
484 Ga0501047_1133204
485 Ga0501080_0872108
486 nmdc:mga0k408_572186_c1
487 nmdc:mga06z11_1015768_c1
488 nmdc:mga06r32_116587_c1
489 nmdc:mga06r32_212819_c1
490 nmdc:mga08y16_108912_c1
491 nmdc:mga08y16_1156600_c1
492 nmdc:mga0n895_152067_c1
493 nmdc:mga0rr50_88848_c1
494 nmdc:mga0a205_1388604_c1
495 Ga0495619_0289684
496 Ga0500568_0002127
497 Ga0501084_0729377
498 Ga0501082_0289342
499 Ga0530510_0248669
500 2643963243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

20

66

0.98

PF12840

HTH_20

Helix-turn-helix domain

18

67

0.96

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

20

65

0.96

PF12802

MarR_2

MarR family

20

71

0.91

PF01047

MarR

MarR family

21

71

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9412 3 78
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9253 3 90
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9174 3 93
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9086 1 93
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.8892 3 93
ID Description Score Start End Superfamily
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9174 3 93 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8928 1 86 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8892 3 93 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8786 4 83 1.10.10.10
2oqgA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8662 4 104 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W0YP81-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9785 4 90 GO:0003700
AF-A0A4R4QW63-F1-model_v4 ArsR family transcriptional regulator 0.9675 2 95 GO:0003700
AF-A0A350UIW9-F1-model_v4 Transcriptional regulator 0.9569 1 89 GO:0003700
AF-A0A5B9G7K3-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9483 5 94 GO:0003700
AF-A0A0J1D1P5-F1-model_v4 ArsR family transcriptional regulator 0.9439 3 93 GO:0003700

Map