F362059

General Info

Members Datasets Scaffolds Average Seq Length
250 164 500 253

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8054472261|8054472372
Length 304
Sequence HHPALRFLGHSTTRLELGGRVVLTDPVLTPRVSLLRRVVPPPRPEDWADADLVLISHLHGDHLHLPSLRLLRPDTRVVVPRGAAEWVRKRGVRRVEEIDVGQEIREGGLRVTAVPAAHSGHRWGPRSTRGPLSPALGHVLEADGLRIYAAGDTDLFPGMGDIAAGGPLDLALLPVWGWGPNLGPGHLDPERAAEAVDVLRPRLAVPVHWGTLAVAGLTRAPAGHGARMRALLHDPPHRFAAAVLGRGSTGTVTIARPGQDVPLDGTAPDPAPDPDPAPDPASVPDRTNGPSLRGTDCPGPGHRE

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
58 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
59 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
64 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
65 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
66 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
84 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
85 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
113 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
114 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
115 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
116 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
156 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
160 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
161 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
162 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
163 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
164 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 0
Isolates 2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.6
Nodule 0
Rhizoplane 11.2
Rhizosphere 77.2
Stem 0
Stem Tuber 0.4
Unclassified 12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001006 3300003203 Bacteria 13214
2 Ga0070690_100117283 3300005330 Bacteria 1783
3 Ga0070671_100004505 3300005355 Bacteria 11031
4 Ga0070674_100077004 3300005356 Bacteria 2373
5 Ga0070688_100196049 3300005365 Bacteria 1410
6 Ga0070667_100000591 3300005367 Bacteria 35606
7 Ga0070667_100219038 3300005367 Bacteria 1694
8 Ga0070711_100018198 3300005439 Bacteria 4481
9 Ga0070678_100115063 3300005456 Bacteria 2111
10 Ga0070699_100403007 3300005518 Unclassified 1237
11 Ga0070697_100216608 3300005536 Bacteria 1631
12 Ga0070696_100331274 3300005546 Bacteria 1174
13 Ga0070665_100017416 3300005548 Bacteria 7213
14 Ga0070665_100044211 3300005548 Bacteria 4473
15 Ga0070704_100062901 3300005549 Bacteria 2662
16 Ga0068859_100709559 3300005617 Bacteria 1096
17 Ga0068863_100006883 3300005841 Bacteria 11142
18 Ga0068863_100048858 3300005841 Bacteria 4011
19 Ga0068860_100024810 3300005843 Bacteria 5791
20 Ga0068862_100001325 3300005844 Bacteria 23004
21 Ga0081455_10017593 3300005937 Bacteria 6843
22 Ga0081455_10023289 3300005937 Bacteria 5765
23 Ga0081455_10042199 3300005937 Bacteria 4004
24 Ga0081455_10043284 3300005937 Bacteria 3941
25 Ga0081455_10201712 3300005937 Viruses 1489
26 Ga0081538_10001744 3300005981 Bacteria 22108
27 Ga0081538_10019317 3300005981 Bacteria 5070
28 Ga0081538_10040514 3300005981 Bacteria 2970
29 Ga0081540_1046834 3300005983 Bacteria 2179
30 Ga0081539_10000195 3300005985 Bacteria 141188
31 Ga0075365_10006507 3300006038 Bacteria 6431
32 Ga0075365_10007767 3300006038 Bacteria 6040
33 Ga0075365_10061765 3300006038 Bacteria 2503
34 Ga0075365_10177363 3300006038 Bacteria 1489
35 Ga0075363_100047623 3300006048 Bacteria 2277
36 Ga0075364_10165729 3300006051 Bacteria 1493
37 Ga0070712_100080997 3300006175 Bacteria 2351
38 Ga0070712_100090881 3300006175 Bacteria 2236
39 Ga0070712_100215688 3300006175 Unclassified 1516
40 Ga0075370_10167936 3300006353 Unclassified 1289
41 Ga0075428_100724478 3300006844 Bacteria 1059
42 Ga0097620_100709577 3300006931 Bacteria 1096
43 Ga0111539_10495702 3300009094 Unclassified 1423
44 Ga0111539_10821072 3300009094 Unclassified 1082
45 Ga0105245_10009000 3300009098 Bacteria 8708
46 Ga0105245_10790431 3300009098 Unclassified 987
47 Ga0114129_10123242 3300009147 Bacteria 3565
48 Ga0114129_10454514 3300009147 Bacteria 1679
49 Ga0114129_10785079 3300009147 Bacteria 1216
50 Ga0105237_10687507 3300009545 Bacteria 1030
51 Ga0105239_10183967 3300010375 Bacteria 2338
52 Ga0157379_10162913 3300014968 Bacteria 2013
53 Ga0157379_10257582 3300014968 Bacteria 1585
54 Ga0207680_10124258 3300025903 Bacteria 1692
55 Ga0207693_10005337 3300025915 Bacteria 10738
56 Ga0207687_10113960 3300025927 Bacteria 2012
57 Ga0207644_10029132 3300025931 Bacteria 3827
58 Ga0207704_10066843 3300025938 Bacteria 2258
59 Ga0207661_10634082 3300025944 Unclassified 982
60 Ga0207712_10098765 3300025961 Bacteria 2166
61 Ga0207668_10043003 3300025972 Bacteria 3062
62 Ga0207658_10003191 3300025986 Bacteria 11676
63 Ga0207658_10022798 3300025986 Bacteria 4361
64 Ga0207703_10083718 3300026035 Bacteria 2666
65 Ga0207641_10006505 3300026088 Bacteria 9837
66 Ga0268266_10000775 3300028379 Bacteria 42696
67 Ga0268266_10034161 3300028379 Bacteria 4324
68 Ga0268265_10004341 3300028380 Bacteria 9864
69 Ga0268264_10055240 3300028381 Bacteria 3318
70 Ga0307512_10009231 3300030522 Bacteria 9530
71 Ga0265327_10005556 3300031251 Bacteria 10470
72 Ga0316579_10011922 3300031691 Bacteria 3709
73 Ga0316576_10025689 3300031727 Bacteria 4126
74 Ga0316577_10006057 3300031733 Bacteria 6374
75 Ga0307409_100223405 3300031995 Unclassified 1702
76 Ga0307416_100387678 3300032002 Bacteria 1430
77 Ga0307416_100488561 3300032002 Bacteria 1293
78 Ga0307415_100175440 3300032126 Bacteria 1676
79 Ga0307415_100499176 3300032126 Bacteria 1063
80 Ga0373943_0143362 3300035170 Bacteria 1289
81 Ga0373943_0176548 3300035170 Unclassified 1172
82 Ga0373955_0357626 3300035172 Bacteria 885
83 Ga0373947_0299390 3300035725 Unclassified 1072
84 Ga0373937_0624106 3300036401 Bacteria 1023
85 Ga0316582_0073028 3300036647 Bacteria 2226
86 Ga0316584_0015102 3300036712 Bacteria 5518
87 Ga0316584_0346409 3300036712 Unclassified 1067
88 Ga0316581_0034551 3300037588 Unclassified 1530
89 Ga0439463_010259 3300042016 Bacteria 2303
90 Ga0466965_0173276 3300044683 Bacteria 1136
91 Ga0466961_0087645 3300044693 Bacteria 1967
92 Ga0466963_0360826 3300044694 Bacteria 1023
93 Ga0466971_0019085 3300044719 Bacteria 3043
94 Ga0466970_0026636 3300044765 Bacteria 3030
95 Ga0466959_0047607 3300045049 Bacteria 3153
96 Ga0466959_0201541 3300045049 Bacteria 1385
97 Ga0466958_0057963 3300045836 Bacteria 2354
98 Ga0466967_0020061 3300045976 Bacteria 5391
99 Ga0495592_0029477 3300046454 Bacteria 4156
100 Ga0495651_0034041 3300046462 Bacteria 3972
101 Ga0495653_0091123 3300046463 Bacteria 2229
102 Ga0495664_0030182 3300046477 Bacteria 3175
103 Ga0495594_0300847 3300046499 Bacteria 914
104 Ga0495608_0066791 3300046511 Bacteria 2354
105 Ga0495608_0145530 3300046511 Unclassified 1511
106 Ga0495608_0233441 3300046511 Bacteria 1151
107 Ga0495618_0093161 3300046514 Bacteria 1926
108 Ga0495628_0308859 3300046516 Unclassified 1169
109 Ga0495630_0083248 3300046517 Unclassified 2415
110 Ga0495630_0129651 3300046517 Bacteria 1915
111 Ga0495652_0098675 3300046529 Unclassified 2374
112 Ga0495587_0017026 3300046536 Bacteria 4519
113 Ga0495667_0028268 3300046559 Bacteria 3775
114 Ga0495667_0082896 3300046559 Unclassified 2083
115 Ga0495667_0093726 3300046559 Bacteria 1944
116 Ga0495667_0182607 3300046559 Bacteria 1346
117 Ga0495634_0304535 3300046642 Unclassified 963
118 Ga0495635_0151300 3300046663 Bacteria 1580
119 Ga0495599_0037033 3300046678 Bacteria 3065
120 Ga0495623_0004869 3300046679 Bacteria 8806
121 Ga0495646_0359085 3300046680 Unclassified 762
122 Ga0495624_0195617 3300046690 Bacteria 1229
123 Ga0495674_0055998 3300047319 Bacteria 3456
124 Ga0495674_0287274 3300047319 Bacteria 1346
125 Ga0495680_0492765 3300047322 Bacteria 833
126 Ga0495675_0039666 3300047444 Bacteria 2999
127 Ga0495684_0012501 3300047471 Bacteria 6542
128 Ga0495684_0038994 3300047471 Bacteria 3641
129 Ga0495602_0441400 3300048088 Unclassified 920
130 Ga0496100_0005330 3300048903 Bacteria 6913
131 Ga0496101_0012095 3300048904 Bacteria 5752
132 Ga0496101_0030933 3300048904 Bacteria 3758
133 Ga0496101_0036108 3300048904 Bacteria 3499
134 Ga0496102_0000724 3300048905 Bacteria 32465
135 Ga0496102_0014250 3300048905 Bacteria 6907
136 Ga0496102_0047865 3300048905 Bacteria 3887
137 Ga0496103_0000019 3300048906 Bacteria 234311
138 Ga0496103_0012743 3300048906 Bacteria 4987
139 Ga0496104_0013532 3300048907 Bacteria 7352
140 Ga0496104_0030147 3300048907 Bacteria 5038
141 Ga0496104_0396449 3300048907 Bacteria 1292
142 Ga0496105_0009191 3300048908 Bacteria 7716
143 Ga0496105_0023169 3300048908 Bacteria 5034
144 Ga0496106_0190793 3300048909 Bacteria 1629
145 Ga0496107_0003980 3300048910 Bacteria 9947
146 Ga0496107_0028052 3300048910 Bacteria 4000
147 Ga0496107_0036478 3300048910 Bacteria 3526
148 Ga0496108_0026391 3300048911 Bacteria 4791
149 Ga0496108_0411321 3300048911 Bacteria 1181
150 Ga0496109_0023193 3300048912 Bacteria 5506
151 Ga0496109_0440858 3300048912 Bacteria 1230
152 Ga0496110_0068882 3300048913 Bacteria 3132
153 Ga0496111_0008560 3300048914 Bacteria 6778
154 Ga0496112_0272025 3300048915 Bacteria 1642
155 Ga0496113_0285377 3300048916 Bacteria 1320
156 Ga0496114_0003035 3300048917 Bacteria 12860
157 Ga0496115_0070027 3300048918 Bacteria 2842
158 Ga0496116_0000363 3300048919 Bacteria 69750
159 Ga0496117_0000101 3300048920 Bacteria 191796
160 Ga0496118_0000267 3300048921 Bacteria 91458
161 Ga0496119_0001242 3300048922 Bacteria 31717
162 Ga0496120_0008261 3300048923 Bacteria 7603
163 Ga0496121_0020771 3300048924 Bacteria 6474
164 Ga0496121_0060912 3300048924 Bacteria 3101
165 Ga0496124_0046187 3300048927 Bacteria 3730
166 Ga0496125_0016655 3300048928 Bacteria 7047
167 Ga0496126_0000198 3300048929 Bacteria 133897
168 Ga0501031_0066959 3300049568 Bacteria 2340
169 Ga0501031_0079242 3300049568 Unclassified 2140
170 Ga0501032_0076676 3300049569 Bacteria 2226
171 Ga0501036_0004243 3300049572 Bacteria 11557
172 Ga0501036_0016976 3300049572 Bacteria 6081
173 Ga0501037_0024220 3300049573 Bacteria 4489
174 Ga0501038_0021365 3300049574 Bacteria 5810
175 Ga0501038_0047405 3300049574 Bacteria 3722
176 Ga0501039_0011735 3300049575 Bacteria 6673
177 Ga0501039_0095601 3300049575 Unclassified 2316
178 Ga0501039_0218477 3300049575 Bacteria 1499
179 Ga0501040_0002786 3300049576 Bacteria 11263
180 Ga0501040_0017104 3300049576 Bacteria 4811
181 Ga0501040_0034175 3300049576 Bacteria 3445
182 Ga0501040_0308083 3300049576 Bacteria 1132
183 Ga0501041_0080463 3300049577 Bacteria 2006
184 Ga0501042_0060302 3300049578 Bacteria 2709
185 Ga0501043_0061740 3300049579 Bacteria 2943
186 Ga0501046_0249984 3300049580 Bacteria 1305
187 Ga0501048_0037212 3300049582 Bacteria 3494
188 Ga0501048_0107244 3300049582 Bacteria 1972
189 Ga0501048_0174753 3300049582 Bacteria 1522
190 Ga0501068_0021395 3300049584 Bacteria 3776
191 Ga0501069_0012475 3300049585 Bacteria 4520
192 Ga0501069_0052079 3300049585 Bacteria 2279
193 Ga0501070_0258989 3300049586 Bacteria 1422
194 Ga0501071_0009128 3300049587 Bacteria 6587
195 Ga0501071_0030322 3300049587 Bacteria 3824
196 Ga0501071_0119262 3300049587 Bacteria 1955
197 Ga0501071_0371425 3300049587 Unclassified 1090
198 Ga0501072_0004516 3300049588 Bacteria 10581
199 Ga0501074_0005007 3300049590 Bacteria 9509
200 Ga0501074_0095622 3300049590 Bacteria 2127
201 Ga0501075_0017153 3300049591 Bacteria 5226
202 Ga0501076_0006200 3300049592 Bacteria 8654
203 Ga0501076_0065113 3300049592 Bacteria 2906
204 Ga0501076_0069455 3300049592 Bacteria 2815
205 Ga0501077_0320106 3300049593 Bacteria 989
206 Ga0501079_0002238 3300049741 Bacteria 13964
207 Ga0501079_0025467 3300049741 Bacteria 4537
208 Ga0501079_0033031 3300049741 Bacteria 3980
209 Ga0501080_0037008 3300049742 Bacteria 4556
210 Ga0501081_0001015 3300049743 Bacteria 16750
211 Ga0501081_0021819 3300049743 Bacteria 4278
212 Ga0501081_0231250 3300049743 Unclassified 1346
213 Ga0501081_0361991 3300049743 Unclassified 1070
214 Ga0501035_0069178 3300049822 Bacteria 3130
215 Ga0501035_0261464 3300049822 Unclassified 1467
216 Ga0501045_0022750 3300049824 Bacteria 4489
217 Ga0501045_0199833 3300049824 Bacteria 1489
218 Ga0501045_0256786 3300049824 Bacteria 1301
219 nmdc:mga03n38_79108_c1 3300050490 Bacteria 1540
220 nmdc:mga00v17_60954_c1 3300050491 Bacteria 2318
221 nmdc:mga0yw44_113137_c1 3300050492 Bacteria 1741
222 nmdc:mga0yw44_287948_c1 3300050492 Unclassified 1099
223 nmdc:mga0yw44_45373_c1 3300050492 Bacteria 2634
224 nmdc:mga05p37_108769_c1 3300050507 Bacteria 3410
225 nmdc:mga08y16_131961_c1 3300050511 Bacteria 2597
226 Ga0495601_0039724 3300053077 Bacteria 2947
227 Ga0495601_0061714 3300053077 Bacteria 2379
228 Ga0495601_0076925 3300053077 Unclassified 2137
229 Ga0495612_0080163 3300053078 Bacteria 1371
230 Ga0495612_0214655 3300053078 Unclassified 851
231 Ga0495619_0036702 3300053085 Bacteria 3192
232 Ga0495619_0099627 3300053085 Bacteria 1976
233 Ga0495619_0179661 3300053085 Bacteria 1464
234 Ga0495619_0728296 3300053085 Bacteria 673
235 Ga0500644_0002390 3300053088 Bacteria 4710
236 Ga0500595_045891 3300053119 Bacteria 1377
237 Ga0501084_0007337 3300054114 Bacteria 9082
238 Ga0501082_0000399 3300060353 Bacteria 38506
239 Ga0501082_0051748 3300060353 Bacteria 3540
240 Ga0501082_0073576 3300060353 Bacteria 2943
241 Ga0501082_0647063 3300060353 Bacteria 925
242 Ga0530510_0001786 3300061734 Bacteria 14672
243 Ga0530510_0035179 3300061734 Bacteria 3609
244 Ga0530510_0063669 3300061734 Unclassified 2670
245 Ga0530510_0352037 3300061734 Bacteria 1106
246 8054472372 8054472261 Bacteria 7464355
247 2816509335 2816332139 Bacteria 9138787
248 2891330625 2891326441 Bacteria 6439512
249 2899362728 2899359706 Bacteria 10940472
250 2899371259 2899370129 Bacteria 6781179
251 JGI25406J46586_10001006
252 Ga0070690_100117283
253 Ga0070671_100004505
254 Ga0070674_100077004
255 Ga0070688_100196049
256 Ga0070667_100000591
257 Ga0070667_100219038
258 Ga0070711_100018198
259 Ga0070678_100115063
260 Ga0070699_100403007
261 Ga0070697_100216608
262 Ga0070696_100331274
263 Ga0070665_100017416
264 Ga0070665_100044211
265 Ga0070704_100062901
266 Ga0068859_100709559
267 Ga0068863_100006883
268 Ga0068863_100048858
269 Ga0068860_100024810
270 Ga0068862_100001325
271 Ga0081455_10017593
272 Ga0081455_10023289
273 Ga0081455_10042199
274 Ga0081455_10043284
275 Ga0081455_10201712
276 Ga0081538_10001744
277 Ga0081538_10019317
278 Ga0081538_10040514
279 Ga0081540_1046834
280 Ga0081539_10000195
281 Ga0075365_10006507
282 Ga0075365_10007767
283 Ga0075365_10061765
284 Ga0075365_10177363
285 Ga0075363_100047623
286 Ga0075364_10165729
287 Ga0070712_100080997
288 Ga0070712_100090881
289 Ga0070712_100215688
290 Ga0075370_10167936
291 Ga0075428_100724478
292 Ga0097620_100709577
293 Ga0111539_10495702
294 Ga0111539_10821072
295 Ga0105245_10009000
296 Ga0105245_10790431
297 Ga0114129_10123242
298 Ga0114129_10454514
299 Ga0114129_10785079
300 Ga0105237_10687507
301 Ga0105239_10183967
302 Ga0157379_10162913
303 Ga0157379_10257582
304 Ga0207680_10124258
305 Ga0207693_10005337
306 Ga0207687_10113960
307 Ga0207644_10029132
308 Ga0207704_10066843
309 Ga0207661_10634082
310 Ga0207712_10098765
311 Ga0207668_10043003
312 Ga0207658_10003191
313 Ga0207658_10022798
314 Ga0207703_10083718
315 Ga0207641_10006505
316 Ga0268266_10000775
317 Ga0268266_10034161
318 Ga0268265_10004341
319 Ga0268264_10055240
320 Ga0307512_10009231
321 Ga0265327_10005556
322 Ga0316579_10011922
323 Ga0316576_10025689
324 Ga0316577_10006057
325 Ga0307409_100223405
326 Ga0307416_100387678
327 Ga0307416_100488561
328 Ga0307415_100175440
329 Ga0307415_100499176
330 Ga0373943_0143362
331 Ga0373943_0176548
332 Ga0373955_0357626
333 Ga0373947_0299390
334 Ga0373937_0624106
335 Ga0316582_0073028
336 Ga0316584_0015102
337 Ga0316584_0346409
338 Ga0316581_0034551
339 Ga0439463_010259
340 Ga0466965_0173276
341 Ga0466961_0087645
342 Ga0466963_0360826
343 Ga0466971_0019085
344 Ga0466970_0026636
345 Ga0466959_0047607
346 Ga0466959_0201541
347 Ga0466958_0057963
348 Ga0466967_0020061
349 Ga0495592_0029477
350 Ga0495651_0034041
351 Ga0495653_0091123
352 Ga0495664_0030182
353 Ga0495594_0300847
354 Ga0495608_0066791
355 Ga0495608_0145530
356 Ga0495608_0233441
357 Ga0495618_0093161
358 Ga0495628_0308859
359 Ga0495630_0083248
360 Ga0495630_0129651
361 Ga0495652_0098675
362 Ga0495587_0017026
363 Ga0495667_0028268
364 Ga0495667_0082896
365 Ga0495667_0093726
366 Ga0495667_0182607
367 Ga0495634_0304535
368 Ga0495635_0151300
369 Ga0495599_0037033
370 Ga0495623_0004869
371 Ga0495646_0359085
372 Ga0495624_0195617
373 Ga0495674_0055998
374 Ga0495674_0287274
375 Ga0495680_0492765
376 Ga0495675_0039666
377 Ga0495684_0012501
378 Ga0495684_0038994
379 Ga0495602_0441400
380 Ga0496100_0005330
381 Ga0496101_0012095
382 Ga0496101_0030933
383 Ga0496101_0036108
384 Ga0496102_0000724
385 Ga0496102_0014250
386 Ga0496102_0047865
387 Ga0496103_0000019
388 Ga0496103_0012743
389 Ga0496104_0013532
390 Ga0496104_0030147
391 Ga0496104_0396449
392 Ga0496105_0009191
393 Ga0496105_0023169
394 Ga0496106_0190793
395 Ga0496107_0003980
396 Ga0496107_0028052
397 Ga0496107_0036478
398 Ga0496108_0026391
399 Ga0496108_0411321
400 Ga0496109_0023193
401 Ga0496109_0440858
402 Ga0496110_0068882
403 Ga0496111_0008560
404 Ga0496112_0272025
405 Ga0496113_0285377
406 Ga0496114_0003035
407 Ga0496115_0070027
408 Ga0496116_0000363
409 Ga0496117_0000101
410 Ga0496118_0000267
411 Ga0496119_0001242
412 Ga0496120_0008261
413 Ga0496121_0020771
414 Ga0496121_0060912
415 Ga0496124_0046187
416 Ga0496125_0016655
417 Ga0496126_0000198
418 Ga0501031_0066959
419 Ga0501031_0079242
420 Ga0501032_0076676
421 Ga0501036_0004243
422 Ga0501036_0016976
423 Ga0501037_0024220
424 Ga0501038_0021365
425 Ga0501038_0047405
426 Ga0501039_0011735
427 Ga0501039_0095601
428 Ga0501039_0218477
429 Ga0501040_0002786
430 Ga0501040_0017104
431 Ga0501040_0034175
432 Ga0501040_0308083
433 Ga0501041_0080463
434 Ga0501042_0060302
435 Ga0501043_0061740
436 Ga0501046_0249984
437 Ga0501048_0037212
438 Ga0501048_0107244
439 Ga0501048_0174753
440 Ga0501068_0021395
441 Ga0501069_0012475
442 Ga0501069_0052079
443 Ga0501070_0258989
444 Ga0501071_0009128
445 Ga0501071_0030322
446 Ga0501071_0119262
447 Ga0501071_0371425
448 Ga0501072_0004516
449 Ga0501074_0005007
450 Ga0501074_0095622
451 Ga0501075_0017153
452 Ga0501076_0006200
453 Ga0501076_0065113
454 Ga0501076_0069455
455 Ga0501077_0320106
456 Ga0501079_0002238
457 Ga0501079_0025467
458 Ga0501079_0033031
459 Ga0501080_0037008
460 Ga0501081_0001015
461 Ga0501081_0021819
462 Ga0501081_0231250
463 Ga0501081_0361991
464 Ga0501035_0069178
465 Ga0501035_0261464
466 Ga0501045_0022750
467 Ga0501045_0199833
468 Ga0501045_0256786
469 nmdc:mga03n38_79108_c1
470 nmdc:mga00v17_60954_c1
471 nmdc:mga0yw44_113137_c1
472 nmdc:mga0yw44_287948_c1
473 nmdc:mga0yw44_45373_c1
474 nmdc:mga05p37_108769_c1
475 nmdc:mga08y16_131961_c1
476 Ga0495601_0039724
477 Ga0495601_0061714
478 Ga0495601_0076925
479 Ga0495612_0080163
480 Ga0495612_0214655
481 Ga0495619_0036702
482 Ga0495619_0099627
483 Ga0495619_0179661
484 Ga0495619_0728296
485 Ga0500644_0002390
486 Ga0500595_045891
487 Ga0501084_0007337
488 Ga0501082_0000399
489 Ga0501082_0051748
490 Ga0501082_0073576
491 Ga0501082_0647063
492 Ga0530510_0001786
493 Ga0530510_0035179
494 Ga0530510_0063669
495 Ga0530510_0352037
496 8054472372
497 2816509335
498 2891330625
499 2899362728
500 2899371259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

20

209

0.89

PF13483

Lactamase_B_3

Beta-lactamase superfamily domain

4

208

0.88

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

5

208

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3x2y-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h8a from thermotoga maritima 0.8508 3 261
3x2y-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h8a from thermotoga maritima 0.8473 3 261
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.847 3 261
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.8435 3 261
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.8413 3 261
ID Description Score Start End Superfamily
af_Q8BH82_99_394_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8285 1 258 3.60.15.10
af_A4HVR7_83_395_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8265 3 250 3.60.15.10
3x30A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8226 5 261 3.60.15.10
af_Q5ABA9_138_440_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8193 4 258 3.60.15.10
3x30A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8159 5 261 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A1G4XG43-F1-model_v4 L-ascorbate metabolism protein UlaG, beta-lactamase superfamily 0.9584 5 262
AF-A0A2N3WCH0-F1-model_v4 L-ascorbate metabolism protein UlaG (Beta-lactamase superfamily) 0.9563 1 262
AF-A0A4R4RIY4-F1-model_v4 MBL fold metallo-hydrolase 0.9551 7 257 GO:0016787
AF-A0A0S8AW39-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9539 2 243
AF-A0A4R4V0D8-F1-model_v4 MBL fold metallo-hydrolase 0.9535 4 258 GO:0016787

Map