F362047

General Info

Members Datasets Scaffolds Average Seq Length
250 197 500 260

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2990059506|2990063224
Length 293
Sequence RPKCPQEPPQRLPPQSPQREVSAWRPHVPGIVEVFHAHYTEYAYPMHVHDVWTLLIVDDGAVRYELDRHEHGTPHDTVSLLPPHVPHNGSPVTAEGFRKRVLYLDPAASALDESLIGAAVDTPDLRDPVLRLRVGQLHAALARQGDELEAESRLALVGERLRGHLRPRAARGPRPDGRTLAHRLRELIDERVADGLTLEEAAGVVHAHPAHLVRAFGAAFGIAPHQYLMSRRVGLARRLLLEGLRPGEVAVAAGFYDQAHLTRHFRRWVGTTPGRYQGGPRPLEDRSVRVSGG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
10 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
11 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
12 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
13 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
14 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
15 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
19 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
20 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
21 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
22 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
23 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
24 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
25 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
26 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
27 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
28 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
29 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
30 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
31 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
32 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
33 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
34 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
35 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
36 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
37 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
38 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
39 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
40 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
41 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
42 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
43 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
44 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
45 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
46 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
47 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
48 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
49 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
50 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
51 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
52 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
53 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
54 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
55 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
56 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
57 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
58 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
59 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
60 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
61 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
62 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
63 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
68 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
71 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
72 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
73 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
74 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
77 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
78 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
83 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
92 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
93 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
97 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
108 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
142 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
143 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
144 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
145 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
146 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
147 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
148 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
149 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
150 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
151 2643221548 Streptomyces sp. Root55 Isolate Unclassified
152 2643221647 Streptomyces sp. Root369 Isolate Unclassified
153 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
154 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
155 2643221714 Streptomyces sp. Root264 Isolate Unclassified
156 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
157 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
158 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
159 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
160 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
161 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
162 2808606448 Streptomyces sp. 193411 Isolate Unclassified
163 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
164 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
165 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
166 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
167 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
168 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
169 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
170 2867428634 Streptomyces sp. RP5T Isolate Unclassified
171 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
172 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
173 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
174 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
175 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
176 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
177 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
178 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
179 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
180 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
181 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
182 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
183 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
184 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
185 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
186 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
187 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
188 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
189 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
190 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
191 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
192 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
193 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
194 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
195 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
196 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
197 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.2
Metatranscriptomes 0.4
Isolates 20.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.6
Nodule 0.8
Rhizoplane 1.2
Rhizosphere 75.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10070454 3300003320 Bacteria 1744
2 JGI25407J50210_10000875 3300003373 Bacteria 6485
3 Ga0006562J51391_1049900 3300003578 Bacteria 8890
4 Ga0070710_10001700 3300005437 Bacteria 10372
5 Ga0068853_100039455 3300005539 Bacteria 4027
6 Ga0070672_100146804 3300005543 Bacteria 1949
7 Ga0068855_100114111 3300005563 Bacteria 3098
8 Ga0081538_10000197 3300005981 Bacteria 66585
9 Ga0105245_10077697 3300009098 Bacteria 3027
10 Ga0105239_11007987 3300010375 Bacteria 957
11 Ga0105246_10002827 3300011119 Bacteria 10519
12 Ga0157372_10090545 3300013307 Bacteria 3478
13 Ga0183367_1005 3300015688 Bacteria 652063
14 Ga0207426_1012120 3300025302 Bacteria 3253
15 Ga0207647_10020918 3300025904 Bacteria 4378
16 Ga0207687_10416301 3300025927 Bacteria 1108
17 Ga0207667_10257918 3300025949 Bacteria 1783
18 Ga0307515_10101683 3300028794 Bacteria 3466
19 Ga0307511_10026054 3300030521 Bacteria 5371
20 Ga0307511_10145387 3300030521 Bacteria 1379
21 Ga0307512_10029668 3300030522 Bacteria 4773
22 Ga0316177_1102702 3300030731 Bacteria 6447
23 Ga0316176_1056888 3300030732 Bacteria 3298
24 Ga0314311_1035677 3300030733 Bacteria 3847
25 Ga0307513_10003213 3300031456 Bacteria 22294
26 Ga0307513_10003878 3300031456 Bacteria 20119
27 Ga0307513_10031755 3300031456 Bacteria 5974
28 Ga0307509_10080401 3300031507 Bacteria 3371
29 Ga0307508_10009562 3300031616 Bacteria 8908
30 Ga0307514_10011573 3300031649 Bacteria 7332
31 Ga0307516_10008286 3300031730 Bacteria 11785
32 Ga0307518_10043929 3300031838 Bacteria 3253
33 Ga0307518_10240270 3300031838 Bacteria 1163
34 Ga0307507_10065864 3300033179 Bacteria 3326
35 Ga0307510_10011806 3300033180 Bacteria 10363
36 Ga0307510_10044091 3300033180 Bacteria 4836
37 Ga0395900_0188163 3300037418 Bacteria 2095
38 Ga0395898_0006614 3300037466 Bacteria 12352
39 Ga0395898_0039491 3300037466 Bacteria 4672
40 Ga0395905_0077343 3300037471 Bacteria 3118
41 Ga0439436_0004582 3300041404 Bacteria 4238
42 Ga0439439_0001257 3300041406 Bacteria 4940
43 Ga0451802_0444064 3300041460 Bacteria 1001
44 Ga0451837_1264737 3300041494 Bacteria 3786
45 Ga0451853_0132015 3300041512 Bacteria 2349
46 Ga0451853_0664345 3300041512 Bacteria 2264
47 Ga0439433_0003730 3300041999 Bacteria 3271
48 Ga0439448_0059739 3300042005 Bacteria 1259
49 Ga0439449_0032548 3300042007 Bacteria 1943
50 Ga0439457_000643 3300042014 Bacteria 10318
51 Ga0439462_0004817 3300042015 Bacteria 3310
52 Ga0450897_004940 3300042128 Bacteria 1137
53 Ga0450894_000015 3300042131 Bacteria 24349
54 Ga0450896_017579 3300042133 Bacteria 1033
55 Ga0450898_000138 3300042134 Bacteria 7225
56 Ga0450899_002683 3300042135 Bacteria 1923
57 Ga0450906_000144 3300042145 Bacteria 13088
58 Ga0439458_0013330 3300042157 Bacteria 1850
59 Ga0466969_0087513 3300044656 Bacteria 1479
60 Ga0466972_0001054 3300044658 Bacteria 13225
61 Ga0466972_0047134 3300044658 Bacteria 2084
62 Ga0466965_0000304 3300044683 Bacteria 16357
63 Ga0466965_0004202 3300044683 Bacteria 6402
64 Ga0466965_0019932 3300044683 Bacteria 3220
65 Ga0466965_0029531 3300044683 Bacteria 2668
66 Ga0466966_0012643 3300044684 Bacteria 5594
67 Ga0466961_0012377 3300044693 Bacteria 5454
68 Ga0466963_0001527 3300044694 Bacteria 12532
69 Ga0466963_0002099 3300044694 Bacteria 11008
70 Ga0466964_0008542 3300044706 Bacteria 3849
71 Ga0466971_0114158 3300044719 Bacteria 1248
72 Ga0466968_0032078 3300044735 Bacteria 2183
73 Ga0466970_0000615 3300044765 Bacteria 17486
74 Ga0466970_0005385 3300044765 Bacteria 6349
75 Ga0466957_0006082 3300044842 Bacteria 6813
76 Ga0466960_0004891 3300044901 Bacteria 5271
77 Ga0466959_0001154 3300045049 Bacteria 15895
78 Ga0466958_0007270 3300045836 Bacteria 6077
79 Ga0466967_0033880 3300045976 Bacteria 4328
80 Ga0495592_0002354 3300046454 Bacteria 13351
81 Ga0495592_0028537 3300046454 Bacteria 4226
82 Ga0495603_0005558 3300046455 Bacteria 7524
83 Ga0495603_0007842 3300046455 Bacteria 6437
84 Ga0495629_0009008 3300046459 Bacteria 7322
85 Ga0495651_0044787 3300046462 Bacteria 3428
86 Ga0495653_0130502 3300046463 Bacteria 1780
87 Ga0495639_0007433 3300046475 Bacteria 4702
88 Ga0495662_0000163 3300046476 Bacteria 26131
89 Ga0495662_0036173 3300046476 Bacteria 2383
90 Ga0495662_0085548 3300046476 Bacteria 1535
91 Ga0495662_0087395 3300046476 Bacteria 1518
92 Ga0495664_0007698 3300046477 Bacteria 5991
93 Ga0495664_0100324 3300046477 Bacteria 1743
94 Ga0495594_0001004 3300046499 Bacteria 14698
95 Ga0495608_0079790 3300046511 Bacteria 2128
96 Ga0495610_0076784 3300046512 Bacteria 1544
97 Ga0495618_0162252 3300046514 Bacteria 1424
98 Ga0495628_0052353 3300046516 Bacteria 3225
99 Ga0495628_0222432 3300046516 Bacteria 1417
100 Ga0495652_0032838 3300046529 Bacteria 4536
101 Ga0495640_0019016 3300046533 Bacteria 5078
102 Ga0495640_0019987 3300046533 Bacteria 4937
103 Ga0495586_0041431 3300046535 Bacteria 2480
104 Ga0495586_0112969 3300046535 Bacteria 1513
105 Ga0495586_0254703 3300046535 Bacteria 1002
106 Ga0495587_0006772 3300046536 Bacteria 7459
107 Ga0495645_0002903 3300046543 Bacteria 11633
108 Ga0495622_0077775 3300046557 Bacteria 1528
109 Ga0495622_0095913 3300046557 Bacteria 1361
110 Ga0495667_0193933 3300046559 Bacteria 1301
111 Ga0495668_0061013 3300046616 Bacteria 2080
112 Ga0495634_0003211 3300046642 Bacteria 13222
113 Ga0495634_0059423 3300046642 Bacteria 2546
114 Ga0495625_0014687 3300046660 Bacteria 6238
115 Ga0495635_0014330 3300046663 Bacteria 5546
116 Ga0495635_0181345 3300046663 Bacteria 1431
117 Ga0495588_0030846 3300046674 Bacteria 2696
118 Ga0495588_0103348 3300046674 Bacteria 1498
119 Ga0495657_0000588 3300046675 Bacteria 33293
120 Ga0495657_0033848 3300046675 Bacteria 3553
121 Ga0495657_0115975 3300046675 Bacteria 1691
122 Ga0495646_0069230 3300046680 Bacteria 2082
123 Ga0495658_0007098 3300046683 Bacteria 5534
124 Ga0495613_0004185 3300046689 Bacteria 10798
125 Ga0495613_0024496 3300046689 Bacteria 4496
126 Ga0495613_0028043 3300046689 Bacteria 4190
127 Ga0495613_0133157 3300046689 Bacteria 1779
128 Ga0495670_0057878 3300046691 Bacteria 1946
129 Ga0495649_0075910 3300046694 Bacteria 1799
130 Ga0495600_0196701 3300046809 Bacteria 1295
131 Ga0495581_0065745 3300047315 Bacteria 2096
132 Ga0495604_0000878 3300047317 Bacteria 25046
133 Ga0495604_0025877 3300047317 Bacteria 4672
134 Ga0495636_0057957 3300047318 Bacteria 1632
135 Ga0495636_0079027 3300047318 Bacteria 1414
136 Ga0495674_0221415 3300047319 Bacteria 1564
137 Ga0495676_0004122 3300047321 Bacteria 13248
138 Ga0495676_0030287 3300047321 Bacteria 4596
139 Ga0495676_0150839 3300047321 Bacteria 1654
140 Ga0495680_0006827 3300047322 Bacteria 10543
141 Ga0495687_096171 3300047443 Bacteria 1121
142 Ga0495675_0055616 3300047444 Bacteria 2510
143 Ga0495675_0067515 3300047444 Bacteria 2259
144 Ga0495675_0119012 3300047444 Bacteria 1645
145 Ga0495685_033203 3300047447 Bacteria 1773
146 Ga0495593_0000751 3300047673 Bacteria 18842
147 Ga0495593_0020957 3300047673 Bacteria 3654
148 Ga0495593_0057386 3300047673 Bacteria 2044
149 Ga0495602_0011983 3300048088 Bacteria 8942
150 Ga0495614_0139285 3300048089 Bacteria 1077
151 Ga0496102_0354783 3300048905 Bacteria 1381
152 Ga0496105_0566578 3300048908 Bacteria 885
153 Ga0496116_0036084 3300048919 Bacteria 3465
154 Ga0496117_0032564 3300048920 Bacteria 3958
155 Ga0496118_0029370 3300048921 Bacteria 4611
156 Ga0496120_0002279 3300048923 Bacteria 19926
157 Ga0496122_0000054 3300048925 Bacteria 259135
158 Ga0496123_0000039 3300048926 Bacteria 259107
159 Ga0501032_0050997 3300049569 Bacteria 2790
160 Ga0501033_0052667 3300049570 Bacteria 3016
161 Ga0501033_0150763 3300049570 Bacteria 1677
162 Ga0501033_0206066 3300049570 Bacteria 1403
163 Ga0501034_0009282 3300049571 Bacteria 10310
164 Ga0501034_0208615 3300049571 Bacteria 1909
165 Ga0501036_0007030 3300049572 Bacteria 9162
166 Ga0501037_0006798 3300049573 Bacteria 8360
167 Ga0501038_0040814 3300049574 Bacteria 4049
168 Ga0501038_0083162 3300049574 Bacteria 2695
169 Ga0501038_0095575 3300049574 Bacteria 2482
170 Ga0501039_0010639 3300049575 Bacteria 7009
171 Ga0501042_0099436 3300049578 Bacteria 2091
172 Ga0501042_0221715 3300049578 Bacteria 1364
173 Ga0501043_0006985 3300049579 Bacteria 8991
174 Ga0501043_0052128 3300049579 Bacteria 3214
175 Ga0501046_0041499 3300049580 Bacteria 3671
176 Ga0501047_0000065 3300049581 Bacteria 132939
177 Ga0501047_0036189 3300049581 Bacteria 4770
178 Ga0501048_0021443 3300049582 Bacteria 4730
179 Ga0501068_0022498 3300049584 Bacteria 3687
180 Ga0501069_0266926 3300049585 Bacteria 1000
181 Ga0501070_0002065 3300049586 Bacteria 17650
182 Ga0501074_0015736 3300049590 Bacteria 5499
183 Ga0501080_0269059 3300049742 Bacteria 1551
184 Ga0501035_0000268 3300049822 Bacteria 61655
185 Ga0501035_0011254 3300049822 Bacteria 8289
186 Ga0501035_0015100 3300049822 Bacteria 7126
187 Ga0501035_0038333 3300049822 Bacteria 4340
188 Ga0501044_0263575 3300049823 Bacteria 1661
189 Ga0501044_0409374 3300049823 Bacteria 1267
190 nmdc:mga0yw44_169828_c1 3300050492 Bacteria 1431
191 nmdc:mga0yw44_304918_c1 3300050492 Bacteria 1067
192 nmdc:mga07m45_78182_c1 3300050496 Bacteria 1887
193 Ga0495619_0037718 3300053085 Bacteria 3151
194 Ga0500640_014615 3300053095 Bacteria 3272
195 Ga0500553_122625 3300053101 Bacteria 1067
196 Ga0500572_004147 3300053111 Bacteria 3293
197 Ga0500624_002726 3300053157 Bacteria 2348
198 Ga0500636_0226910 3300053177 Bacteria 969
199 Ga0466962_0001919 3300061719 Bacteria 9793
200 2990063224 2990059506 Bacteria 9321252
201 2547408264 2547132111 Bacteria 8013147
202 2585310230 2582581313 Bacteria 10042643
203 2616694922 2616644814 Bacteria 11555299
204 2643760393 2643221548 Bacteria 8053412
205 2644262477 2643221647 Bacteria 10741251
206 2644437277 2643221678 Bacteria 9540101
207 2644459476 2643221682 Bacteria 6743283
208 2644629015 2643221714 Bacteria 9015452
209 2784588739 2784132148 Bacteria 8627943
210 2785369652 2784746768 Bacteria 10036182
211 2786670739 2786546132 Bacteria 10419719
212 2804847676 2802429296 Bacteria 7227771
213 2808842179 2808606359 Bacteria 9866990
214 2808920707 2808606375 Bacteria 9466072
215 2809232347 2808606448 Bacteria 8656184
216 2812357946 2811994879 Bacteria 9313447
217 2812480393 2811994917 Bacteria 7761064
218 2862180675 2862178590 Bacteria 8583590
219 2862285789 2862281513 Bacteria 9621493
220 2862391743 2862382967 Bacteria 10317375
221 2862511665 2862507626 Bacteria 9425308
222 2863404452 2863404153 Bacteria 9672205
223 2867431169 2867428634 Bacteria 9590268
224 2877680972 2877676314 Bacteria 9512378
225 2912719812 2912715099 Bacteria 9460473
226 2912724211 2912723979 Bacteria 8557534
227 2918502186 2918501144 Bacteria 8668083
228 2919469402 2919468124 Bacteria 9133025
229 2946067905 2946064051 Bacteria 8957905
230 2946076040 2946072368 Bacteria 8999607
231 2947229056 2947224130 Bacteria 9938529
232 2954386078 2954380949 Bacteria 10050426
233 2954677063 2954673503 Bacteria 9685905
234 2954687093 2954682443 Bacteria 9862841
235 2954696726 2954691527 Bacteria 10720516
236 2954705435 2954701450 Bacteria 10834262
237 2954716081 2954711539 Bacteria 10867210
238 2954726026 2954721474 Bacteria 10456478
239 2954735776 2954731030 Bacteria 10243860
240 2954744961 2954740390 Bacteria 10229294
241 2954754641 2954749733 Bacteria 10366972
242 2954763948 2954759201 Bacteria 9358192
243 3006323458 3006321560 Bacteria 8247479
244 3006500889 3006493962 Bacteria 8825450
245 8008567109 8008558824 Bacteria 10610750
246 8008578766 8008574985 Bacteria 7815457
247 8023627071 8023623736 Bacteria 8593882
248 8025416484 8025413630 Bacteria 7014048
249 8054164690 8054160619 Bacteria 7783213
250 8056833481 8056829672 Bacteria 9045328
251 rootH2_10070454
252 JGI25407J50210_10000875
253 Ga0006562J51391_1049900
254 Ga0070710_10001700
255 Ga0068853_100039455
256 Ga0070672_100146804
257 Ga0068855_100114111
258 Ga0081538_10000197
259 Ga0105245_10077697
260 Ga0105239_11007987
261 Ga0105246_10002827
262 Ga0157372_10090545
263 Ga0183367_1005
264 Ga0207426_1012120
265 Ga0207647_10020918
266 Ga0207687_10416301
267 Ga0207667_10257918
268 Ga0307515_10101683
269 Ga0307511_10026054
270 Ga0307511_10145387
271 Ga0307512_10029668
272 Ga0316177_1102702
273 Ga0316176_1056888
274 Ga0314311_1035677
275 Ga0307513_10003213
276 Ga0307513_10003878
277 Ga0307513_10031755
278 Ga0307509_10080401
279 Ga0307508_10009562
280 Ga0307514_10011573
281 Ga0307516_10008286
282 Ga0307518_10043929
283 Ga0307518_10240270
284 Ga0307507_10065864
285 Ga0307510_10011806
286 Ga0307510_10044091
287 Ga0395900_0188163
288 Ga0395898_0006614
289 Ga0395898_0039491
290 Ga0395905_0077343
291 Ga0439436_0004582
292 Ga0439439_0001257
293 Ga0451802_0444064
294 Ga0451837_1264737
295 Ga0451853_0132015
296 Ga0451853_0664345
297 Ga0439433_0003730
298 Ga0439448_0059739
299 Ga0439449_0032548
300 Ga0439457_000643
301 Ga0439462_0004817
302 Ga0450897_004940
303 Ga0450894_000015
304 Ga0450896_017579
305 Ga0450898_000138
306 Ga0450899_002683
307 Ga0450906_000144
308 Ga0439458_0013330
309 Ga0466969_0087513
310 Ga0466972_0001054
311 Ga0466972_0047134
312 Ga0466965_0000304
313 Ga0466965_0004202
314 Ga0466965_0019932
315 Ga0466965_0029531
316 Ga0466966_0012643
317 Ga0466961_0012377
318 Ga0466963_0001527
319 Ga0466963_0002099
320 Ga0466964_0008542
321 Ga0466971_0114158
322 Ga0466968_0032078
323 Ga0466970_0000615
324 Ga0466970_0005385
325 Ga0466957_0006082
326 Ga0466960_0004891
327 Ga0466959_0001154
328 Ga0466958_0007270
329 Ga0466967_0033880
330 Ga0495592_0002354
331 Ga0495592_0028537
332 Ga0495603_0005558
333 Ga0495603_0007842
334 Ga0495629_0009008
335 Ga0495651_0044787
336 Ga0495653_0130502
337 Ga0495639_0007433
338 Ga0495662_0000163
339 Ga0495662_0036173
340 Ga0495662_0085548
341 Ga0495662_0087395
342 Ga0495664_0007698
343 Ga0495664_0100324
344 Ga0495594_0001004
345 Ga0495608_0079790
346 Ga0495610_0076784
347 Ga0495618_0162252
348 Ga0495628_0052353
349 Ga0495628_0222432
350 Ga0495652_0032838
351 Ga0495640_0019016
352 Ga0495640_0019987
353 Ga0495586_0041431
354 Ga0495586_0112969
355 Ga0495586_0254703
356 Ga0495587_0006772
357 Ga0495645_0002903
358 Ga0495622_0077775
359 Ga0495622_0095913
360 Ga0495667_0193933
361 Ga0495668_0061013
362 Ga0495634_0003211
363 Ga0495634_0059423
364 Ga0495625_0014687
365 Ga0495635_0014330
366 Ga0495635_0181345
367 Ga0495588_0030846
368 Ga0495588_0103348
369 Ga0495657_0000588
370 Ga0495657_0033848
371 Ga0495657_0115975
372 Ga0495646_0069230
373 Ga0495658_0007098
374 Ga0495613_0004185
375 Ga0495613_0024496
376 Ga0495613_0028043
377 Ga0495613_0133157
378 Ga0495670_0057878
379 Ga0495649_0075910
380 Ga0495600_0196701
381 Ga0495581_0065745
382 Ga0495604_0000878
383 Ga0495604_0025877
384 Ga0495636_0057957
385 Ga0495636_0079027
386 Ga0495674_0221415
387 Ga0495676_0004122
388 Ga0495676_0030287
389 Ga0495676_0150839
390 Ga0495680_0006827
391 Ga0495687_096171
392 Ga0495675_0055616
393 Ga0495675_0067515
394 Ga0495675_0119012
395 Ga0495685_033203
396 Ga0495593_0000751
397 Ga0495593_0020957
398 Ga0495593_0057386
399 Ga0495602_0011983
400 Ga0495614_0139285
401 Ga0496102_0354783
402 Ga0496105_0566578
403 Ga0496116_0036084
404 Ga0496117_0032564
405 Ga0496118_0029370
406 Ga0496120_0002279
407 Ga0496122_0000054
408 Ga0496123_0000039
409 Ga0501032_0050997
410 Ga0501033_0052667
411 Ga0501033_0150763
412 Ga0501033_0206066
413 Ga0501034_0009282
414 Ga0501034_0208615
415 Ga0501036_0007030
416 Ga0501037_0006798
417 Ga0501038_0040814
418 Ga0501038_0083162
419 Ga0501038_0095575
420 Ga0501039_0010639
421 Ga0501042_0099436
422 Ga0501042_0221715
423 Ga0501043_0006985
424 Ga0501043_0052128
425 Ga0501046_0041499
426 Ga0501047_0000065
427 Ga0501047_0036189
428 Ga0501048_0021443
429 Ga0501068_0022498
430 Ga0501069_0266926
431 Ga0501070_0002065
432 Ga0501074_0015736
433 Ga0501080_0269059
434 Ga0501035_0000268
435 Ga0501035_0011254
436 Ga0501035_0015100
437 Ga0501035_0038333
438 Ga0501044_0263575
439 Ga0501044_0409374
440 nmdc:mga0yw44_169828_c1
441 nmdc:mga0yw44_304918_c1
442 nmdc:mga07m45_78182_c1
443 Ga0495619_0037718
444 Ga0500640_014615
445 Ga0500553_122625
446 Ga0500572_004147
447 Ga0500624_002726
448 Ga0500636_0226910
449 Ga0466962_0001919
450 2990063224
451 2547408264
452 2585310230
453 2616694922
454 2643760393
455 2644262477
456 2644437277
457 2644459476
458 2644629015
459 2784588739
460 2785369652
461 2786670739
462 2804847676
463 2808842179
464 2808920707
465 2809232347
466 2812357946
467 2812480393
468 2862180675
469 2862285789
470 2862391743
471 2862511665
472 2863404452
473 2867431169
474 2877680972
475 2912719812
476 2912724211
477 2918502186
478 2919469402
479 2946067905
480 2946076040
481 2947229056
482 2954386078
483 2954677063
484 2954687093
485 2954696726
486 2954705435
487 2954716081
488 2954726026
489 2954735776
490 2954744961
491 2954754641
492 2954763948
493 3006323458
494 3006500889
495 8008567109
496 8008578766
497 8023627071
498 8025416484
499 8054164690
500 8056833481

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

29

157

0.96

PF12833

HTH_18

Helix-turn-helix domain

201

279

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9019 167 261
3mn2-assembly2.cif.gz_B the crystal structure of a probable arac family transcriptional regulator from rhodopseudomonas palustris cga009 0.8914 162 260
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8885 167 255
3lsg-assembly2.cif.gz_D the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8777 167 252
6v7j-assembly1.cif.gz_B the c2221 crystal form of canavalin at 173 k 0.8755 19 91
ID Description Score Start End Superfamily
af_P09377_170_274_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9308 163 260 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9096 213 260 1.10.10.60
af_P31449_179_288_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9074 157 260 1.10.10.60
af_P0A9E0_176_235_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9061 162 217 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8925 164 260 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7C6LIE2-F1-model_v4 Helix-turn-helix transcriptional regulator 0.959 163 260 GO:0003700
GO:0043565
AF-A0A2T0HIK9-F1-model_v4 deleted 0.9523 30 93
AF-A0A0E4FUN8-F1-model_v4 Transcriptional regulatory protein 0.9475 167 260 GO:0003700
GO:0043565
AF-A0A7M3MNL8-F1-model_v4 Methylated-DNA--[protein]-cysteine S-methyltransferase (EC 2.1.1.63) 0.9466 158 260 GO:0003700
GO:0003908
GO:0006281
GO:0032259
GO:0043565
AF-A0A7W3JEA1-F1-model_v4 AraC-like DNA-binding protein 0.9465 2 260 GO:0003700
GO:0043565

Map