F361907
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 198 | 216 | 242 |
Family's Representative Sequence
| Representative Sequence | 3300048920|Ga0496117_0028309|Ga0496117_0028309_3476_4315 |
| Length | 279 |
| Sequence | LPCFSTGIINAENRVNQCSEYTGGLTCFFLLLYSEQDAFMTDFSQADFDVRVEWGAPAIEHLAAEADCIVIIDVMSFSTCVSVAGERGGMIFPYPWKDASAQQFAAENDAECAQFDRRFQGQGFTLSPCSLLNMTAGTRLVLPSPNGSALTFKAKAHKAAIFTACFRNLTATARACEKYRQILIVPAGEKWPDNSLRPALEDFAAAGGLVSRLSHRRLSAEARAARAVYQHLTRAELERCGSARELNRRGFAADIALCLEEDVSDLACQFQGRYFTAHR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 3 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 4 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 5 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 6 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 7 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 8 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 9 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 10 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 11 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 12 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 13 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 14 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 15 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 16 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 17 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 18 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 19 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 20 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 21 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 22 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 23 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 24 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 25 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 26 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 27 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 28 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 29 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 30 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 31 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 32 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 33 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 34 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 35 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 36 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 37 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 80 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 115 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 116 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 119 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 120 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 123 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 129 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 130 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 131 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 132 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 133 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 134 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 136 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 137 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 138 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 139 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 174 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 175 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 176 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 177 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 179 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 180 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 181 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 182 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 183 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 184 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 185 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 186 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 187 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 188 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 189 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 190 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 191 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 192 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 193 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 195 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 196 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 197 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 198 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.4 |
| Metatranscriptomes | 0 |
| Isolates | 13.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.8 |
| Bulb | 0 |
| Endosphere | 8.4 |
| Nodule | 2.4 |
| Rhizoplane | 7.6 |
| Rhizosphere | 66.8 |
| Stem | 0.4 |
| Stem Tuber | 0 |
| Unclassified | 13.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1321628 | 2162886007 | Bacteria | 2327 |
| 2 | JGI24739J22299_10000001 | 3300001989 | Bacteria | 99744 |
| 3 | JGI25162J39368_1000010 | 3300002737 | Bacteria | 389629 |
| 4 | JGI25163J39215_1000035 | 3300002771 | Bacteria | 62515 |
| 5 | JGI25164J39214_1000003 | 3300002772 | Bacteria | 389390 |
| 6 | JGI25151J46595_10028766 | 3300003187 | Bacteria | 2209 |
| 7 | Ga0055538_1000009 | 3300003751 | Bacteria | 389629 |
| 8 | Ga0055539_1000013 | 3300003752 | Bacteria | 389629 |
| 9 | Ga0055533_1000017 | 3300003756 | Bacteria | 389629 |
| 10 | Ga0055525_1000019 | 3300003759 | Bacteria | 389629 |
| 11 | Ga0055541_1000010 | 3300003841 | Bacteria | 389629 |
| 12 | Ga0065704_10000510 | 3300005289 | Bacteria | 31849 |
| 13 | Ga0065704_10087936 | 3300005289 | Bacteria | 2981 |
| 14 | Ga0070670_100176483 | 3300005331 | Bacteria | 1854 |
| 15 | Ga0070680_100140633 | 3300005336 | Bacteria | 2024 |
| 16 | Ga0070660_100079867 | 3300005339 | Bacteria | 2566 |
| 17 | Ga0070660_100397790 | 3300005339 | Bacteria | 1139 |
| 18 | Ga0070671_100001325 | 3300005355 | Bacteria | 18591 |
| 19 | Ga0070671_100224987 | 3300005355 | Bacteria | 1592 |
| 20 | Ga0070659_100110551 | 3300005366 | Bacteria | 2218 |
| 21 | Ga0070708_100438568 | 3300005445 | Bacteria | 1232 |
| 22 | Ga0068867_100016615 | 3300005459 | Bacteria | 5226 |
| 23 | Ga0068867_100351417 | 3300005459 | Bacteria | 1230 |
| 24 | Ga0070706_100000962 | 3300005467 | Bacteria | 31392 |
| 25 | Ga0070706_100003916 | 3300005467 | Bacteria | 14515 |
| 26 | Ga0070706_100053070 | 3300005467 | Bacteria | 3741 |
| 27 | Ga0070707_100079810 | 3300005468 | Bacteria | 3158 |
| 28 | Ga0070707_100299582 | 3300005468 | Unclassified | 1562 |
| 29 | Ga0070707_100333618 | 3300005468 | Unclassified | 1473 |
| 30 | Ga0070707_100880555 | 3300005468 | Archaea | 860 |
| 31 | Ga0070698_100086512 | 3300005471 | Bacteria | 3120 |
| 32 | Ga0070699_100007852 | 3300005518 | Bacteria | 9269 |
| 33 | Ga0070679_100045599 | 3300005530 | Bacteria | 4369 |
| 34 | Ga0070684_100572390 | 3300005535 | Bacteria | 1049 |
| 35 | Ga0070697_100012271 | 3300005536 | Bacteria | 6711 |
| 36 | Ga0070697_100187624 | 3300005536 | Bacteria | 1754 |
| 37 | Ga0070696_100003770 | 3300005546 | Bacteria | 10124 |
| 38 | Ga0070665_100009611 | 3300005548 | Bacteria | 9782 |
| 39 | Ga0068855_100306890 | 3300005563 | Bacteria | 1756 |
| 40 | Ga0070664_100458569 | 3300005564 | Bacteria | 1171 |
| 41 | Ga0068864_100492048 | 3300005618 | Bacteria | 1179 |
| 42 | Ga0068860_100011377 | 3300005843 | Bacteria | 8769 |
| 43 | Ga0068862_100000114 | 3300005844 | Bacteria | 96243 |
| 44 | Ga0075436_100276729 | 3300006914 | Unclassified | 1199 |
| 45 | Ga0105251_10022557 | 3300009011 | Bacteria | 3266 |
| 46 | Ga0105244_10000352 | 3300009036 | Bacteria | 43225 |
| 47 | Ga0105244_10000469 | 3300009036 | Bacteria | 36819 |
| 48 | Ga0105244_10022689 | 3300009036 | Bacteria | 3452 |
| 49 | Ga0105244_10198455 | 3300009036 | Bacteria | 947 |
| 50 | Ga0105250_10000017 | 3300009092 | Bacteria | 255998 |
| 51 | Ga0105250_10011944 | 3300009092 | Bacteria | 3597 |
| 52 | Ga0105247_10000128 | 3300009101 | Bacteria | 73288 |
| 53 | Ga0114129_10412267 | 3300009147 | Unclassified | 1779 |
| 54 | Ga0105239_10153859 | 3300010375 | Bacteria | 2567 |
| 55 | Ga0157373_10007327 | 3300013100 | Bacteria | 8218 |
| 56 | Ga0157371_10000237 | 3300013102 | Bacteria | 78761 |
| 57 | Ga0157371_10000603 | 3300013102 | Bacteria | 42845 |
| 58 | Ga0157371_10001259 | 3300013102 | Bacteria | 26712 |
| 59 | Ga0157371_10013480 | 3300013102 | Bacteria | 6206 |
| 60 | Ga0157370_10000982 | 3300013104 | Bacteria | 36103 |
| 61 | Ga0163162_10242394 | 3300013306 | Bacteria | 1934 |
| 62 | Ga0157372_10092679 | 3300013307 | Bacteria | 3437 |
| 63 | Ga0157375_10053002 | 3300013308 | Bacteria | 3990 |
| 64 | Ga0157380_10062309 | 3300014326 | Bacteria | 2987 |
| 65 | Ga0163161_10113532 | 3300017792 | Bacteria | 2028 |
| 66 | Ga0213876_10027412 | 3300021384 | Bacteria | 3007 |
| 67 | Ga0209760_100067 | 3300025207 | Bacteria | 87264 |
| 68 | Ga0209784_100012 | 3300025224 | Bacteria | 535823 |
| 69 | Ga0209566_100010 | 3300025225 | Bacteria | 535823 |
| 70 | Ga0209674_100023 | 3300025226 | Bacteria | 535823 |
| 71 | Ga0209563_100027 | 3300025230 | Bacteria | 535823 |
| 72 | Ga0207427_100017 | 3300025231 | Bacteria | 535823 |
| 73 | Ga0209437_100029 | 3300025233 | Bacteria | 535823 |
| 74 | Ga0209677_100014 | 3300025253 | Bacteria | 535823 |
| 75 | Ga0209233_1000433 | 3300025261 | Bacteria | 30150 |
| 76 | Ga0209025_1000343 | 3300025294 | Bacteria | 101870 |
| 77 | Ga0209758_1028921 | 3300025297 | Bacteria | 2331 |
| 78 | Ga0207696_1000015 | 3300025711 | Bacteria | 507848 |
| 79 | Ga0207696_1000303 | 3300025711 | Bacteria | 56541 |
| 80 | Ga0207655_1000484 | 3300025728 | Bacteria | 51406 |
| 81 | Ga0207655_1006558 | 3300025728 | Bacteria | 7686 |
| 82 | Ga0207655_1013016 | 3300025728 | Bacteria | 4806 |
| 83 | Ga0207713_1037473 | 3300025735 | Bacteria | 2067 |
| 84 | Ga0207710_10000224 | 3300025900 | Bacteria | 49005 |
| 85 | Ga0207684_10000122 | 3300025910 | Bacteria | 142635 |
| 86 | Ga0207684_10032364 | 3300025910 | Bacteria | 4447 |
| 87 | Ga0207684_10411015 | 3300025910 | Unclassified | 1163 |
| 88 | Ga0207657_10075262 | 3300025919 | Bacteria | 2849 |
| 89 | Ga0207652_10315366 | 3300025921 | Bacteria | 1411 |
| 90 | Ga0207652_10686375 | 3300025921 | Bacteria | 914 |
| 91 | Ga0207646_10056910 | 3300025922 | Bacteria | 3494 |
| 92 | Ga0207646_10649792 | 3300025922 | Archaea | 945 |
| 93 | Ga0207644_10001232 | 3300025931 | Bacteria | 16460 |
| 94 | Ga0207690_10060943 | 3300025932 | Bacteria | 2563 |
| 95 | Ga0207690_10341013 | 3300025932 | Bacteria | 1183 |
| 96 | Ga0207661_10558359 | 3300025944 | Bacteria | 1049 |
| 97 | Ga0207667_10549244 | 3300025949 | Bacteria | 1168 |
| 98 | Ga0207712_10043413 | 3300025961 | Bacteria | 3101 |
| 99 | Ga0207668_10168988 | 3300025972 | Bacteria | 1713 |
| 100 | Ga0207677_10062177 | 3300026023 | Bacteria | 2589 |
| 101 | Ga0207641_10067553 | 3300026088 | Unclassified | 3063 |
| 102 | Ga0207648_10041611 | 3300026089 | Bacteria | 4035 |
| 103 | Ga0207676_10651016 | 3300026095 | Bacteria | 1017 |
| 104 | Ga0209371_1029976 | 3300027312 | Bacteria | 1196 |
| 105 | Ga0268265_10000008 | 3300028380 | Bacteria | 417328 |
| 106 | Ga0268264_10008117 | 3300028381 | Bacteria | 8730 |
| 107 | Ga0265336_10028063 | 3300028666 | Bacteria | 1759 |
| 108 | Ga0265338_10005116 | 3300028800 | Bacteria | 17283 |
| 109 | Ga0268256_1034122 | 3300030500 | Bacteria | 1196 |
| 110 | Ga0316577_10228954 | 3300031733 | Unclassified | 1051 |
| 111 | Ga0307410_10290238 | 3300031852 | Bacteria | 1287 |
| 112 | Ga0307409_100198931 | 3300031995 | Bacteria | 1791 |
| 113 | Ga0373953_0006900 | 3300035117 | Bacteria | 3771 |
| 114 | Ga0373933_0025902 | 3300035724 | Bacteria | 3364 |
| 115 | Ga0373947_0061071 | 3300035725 | Bacteria | 2290 |
| 116 | Ga0373937_0107291 | 3300036401 | Bacteria | 2596 |
| 117 | Ga0316584_0138249 | 3300036712 | Bacteria | 1818 |
| 118 | Ga0373925_0480343 | 3300037068 | Unclassified | 1019 |
| 119 | Ga0395900_0272762 | 3300037418 | Bacteria | 1686 |
| 120 | Ga0395898_0195566 | 3300037466 | Unclassified | 1932 |
| 121 | Ga0395905_0290396 | 3300037471 | Unclassified | 1522 |
| 122 | Ga0395901_0358131 | 3300038443 | Unclassified | 1505 |
| 123 | Ga0400483_144240 | 3300039062 | Unclassified | 4650 |
| 124 | Ga0400483_217061 | 3300039062 | Bacteria | 2381 |
| 125 | Ga0436365_0611526 | 3300039437 | Bacteria | 1555 |
| 126 | Ga0436365_0657985 | 3300039437 | Bacteria | 3989 |
| 127 | Ga0436365_1782700 | 3300039437 | Unclassified | 2365 |
| 128 | Ga0436360_0926536 | 3300039438 | Unclassified | 1169 |
| 129 | Ga0436360_1039560 | 3300039438 | Bacteria | 982 |
| 130 | Ga0436360_1090470 | 3300039438 | Unclassified | 856 |
| 131 | Ga0436363_0028113 | 3300039450 | Bacteria | 3310 |
| 132 | Ga0436362_0658930 | 3300039453 | Unclassified | 891 |
| 133 | Ga0439438_000005 | 3300041405 | Bacteria | 408610 |
| 134 | Ga0451793_0430880 | 3300041452 | Bacteria | 5314 |
| 135 | Ga0451833_0675184 | 3300041491 | Bacteria | 2139 |
| 136 | Ga0451853_2695249 | 3300041512 | Bacteria | 2018 |
| 137 | Ga0439432_010899 | 3300042006 | Bacteria | 3138 |
| 138 | Ga0466967_0534966 | 3300045976 | Bacteria | 1152 |
| 139 | Ga0495603_0000505 | 3300046455 | Bacteria | 21670 |
| 140 | Ga0495603_0349266 | 3300046455 | Bacteria | 849 |
| 141 | Ga0495590_0008726 | 3300046457 | Bacteria | 3857 |
| 142 | Ga0495629_0003273 | 3300046459 | Bacteria | 12255 |
| 143 | Ga0495629_0024708 | 3300046459 | Bacteria | 4277 |
| 144 | Ga0495629_0127703 | 3300046459 | Bacteria | 1771 |
| 145 | Ga0495651_0007661 | 3300046462 | Bacteria | 8254 |
| 146 | Ga0495650_0000052 | 3300046471 | Bacteria | 318176 |
| 147 | Ga0495605_0017978 | 3300046474 | Bacteria | 3797 |
| 148 | Ga0495662_0018377 | 3300046476 | Bacteria | 3383 |
| 149 | Ga0495662_0175410 | 3300046476 | Bacteria | 1056 |
| 150 | Ga0495584_0034532 | 3300046491 | Bacteria | 2558 |
| 151 | Ga0495594_0004397 | 3300046499 | Bacteria | 7254 |
| 152 | Ga0495594_0063222 | 3300046499 | Bacteria | 2050 |
| 153 | Ga0495594_0203136 | 3300046499 | Bacteria | 1129 |
| 154 | Ga0495606_0019474 | 3300046507 | Bacteria | 5047 |
| 155 | Ga0495616_0026176 | 3300046513 | Bacteria | 3108 |
| 156 | Ga0495618_0160267 | 3300046514 | Bacteria | 1434 |
| 157 | Ga0495628_0092913 | 3300046516 | Bacteria | 2333 |
| 158 | Ga0495666_0054665 | 3300046526 | Bacteria | 1914 |
| 159 | Ga0495640_0162464 | 3300046533 | Bacteria | 1430 |
| 160 | Ga0495597_0046838 | 3300046542 | Bacteria | 1915 |
| 161 | Ga0495622_0052167 | 3300046557 | Bacteria | 1897 |
| 162 | Ga0495667_0004037 | 3300046559 | Bacteria | 9865 |
| 163 | Ga0495668_0045955 | 3300046616 | Bacteria | 2426 |
| 164 | Ga0495625_0055954 | 3300046660 | Bacteria | 2811 |
| 165 | Ga0495588_0049050 | 3300046674 | Bacteria | 2170 |
| 166 | Ga0495657_0019622 | 3300046675 | Bacteria | 4875 |
| 167 | Ga0495657_0070690 | 3300046675 | Bacteria | 2280 |
| 168 | Ga0495589_0018178 | 3300046794 | Bacteria | 3607 |
| 169 | Ga0495660_0000006 | 3300046810 | Bacteria | 571713 |
| 170 | Ga0495660_0101795 | 3300046810 | Bacteria | 1477 |
| 171 | Ga0495581_0034638 | 3300047315 | Bacteria | 2921 |
| 172 | Ga0495604_0146522 | 3300047317 | Bacteria | 1682 |
| 173 | Ga0495676_0010087 | 3300047321 | Bacteria | 8578 |
| 174 | Ga0495676_0037606 | 3300047321 | Bacteria | 4026 |
| 175 | Ga0495676_0059939 | 3300047321 | Bacteria | 2985 |
| 176 | Ga0495680_0005285 | 3300047322 | Bacteria | 12182 |
| 177 | Ga0495683_0066910 | 3300047323 | Bacteria | 1769 |
| 178 | Ga0495683_0067389 | 3300047323 | Bacteria | 1762 |
| 179 | Ga0495687_039043 | 3300047443 | Bacteria | 2103 |
| 180 | Ga0495687_041490 | 3300047443 | Bacteria | 2018 |
| 181 | Ga0495681_0033370 | 3300047470 | Bacteria | 2579 |
| 182 | Ga0495614_0035385 | 3300048089 | Bacteria | 2145 |
| 183 | Ga0495626_0032569 | 3300048091 | Bacteria | 2502 |
| 184 | Ga0496101_0507804 | 3300048904 | Bacteria | 952 |
| 185 | Ga0496102_0220159 | 3300048905 | Bacteria | 1789 |
| 186 | Ga0496102_0374608 | 3300048905 | Bacteria | 1340 |
| 187 | Ga0496104_0000400 | 3300048907 | Bacteria | 38012 |
| 188 | Ga0496104_0169117 | 3300048907 | Bacteria | 2096 |
| 189 | Ga0496105_0054071 | 3300048908 | Bacteria | 3316 |
| 190 | Ga0496107_0671070 | 3300048910 | Bacteria | 763 |
| 191 | Ga0496109_0064640 | 3300048912 | Bacteria | 3348 |
| 192 | Ga0496110_0908664 | 3300048913 | Bacteria | 786 |
| 193 | Ga0496111_0104693 | 3300048914 | Bacteria | 2081 |
| 194 | Ga0496112_0301612 | 3300048915 | Bacteria | 1547 |
| 195 | Ga0496113_0053297 | 3300048916 | Bacteria | 3024 |
| 196 | Ga0496114_0015031 | 3300048917 | Bacteria | 6223 |
| 197 | Ga0496114_0324360 | 3300048917 | Unclassified | 1361 |
| 198 | Ga0496114_0681234 | 3300048917 | Bacteria | 903 |
| 199 | Ga0496116_0000020 | 3300048919 | Bacteria | 501307 |
| 200 | Ga0496116_0000308 | 3300048919 | Bacteria | 82039 |
| 201 | Ga0496117_0001038 | 3300048920 | Bacteria | 42361 |
| 202 | Ga0496117_0007425 | 3300048920 | Bacteria | 10710 |
| 203 | Ga0496117_0028309 | 3300048920 | Bacteria | 4343 |
| 204 | Ga0496118_0000048 | 3300048921 | Bacteria | 253404 |
| 205 | Ga0496118_0003859 | 3300048921 | Bacteria | 18419 |
| 206 | Ga0496118_0028756 | 3300048921 | Bacteria | 4675 |
| 207 | Ga0496118_0074116 | 3300048921 | Bacteria | 2434 |
| 208 | Ga0496119_0065322 | 3300048922 | Bacteria | 2155 |
| 209 | Ga0496120_0076328 | 3300048923 | Bacteria | 1826 |
| 210 | Ga0496122_0000010 | 3300048925 | Bacteria | 547417 |
| 211 | Ga0496123_0000025 | 3300048926 | Bacteria | 323956 |
| 212 | Ga0496124_0000042 | 3300048927 | Bacteria | 301126 |
| 213 | Ga0496125_0000054 | 3300048928 | Bacteria | 278377 |
| 214 | Ga0496126_0000218 | 3300048929 | Bacteria | 126529 |
| 215 | nmdc:mga05p37_882748_c1 | 3300050507 | Bacteria | 967 |
| 216 | nmdc:mga08x19_298321_c1 | 3300050514 | Bacteria | 1119 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013307 | Ga0157372_10092679 | Ga0157372_100926792 | 183 |
| 2 | 3300005468 | Ga0070707_100880555 | Ga0070707_1008805551 | 186 |
| 3 | 3300025922 | Ga0207646_10649792 | Ga0207646_106497922 | 186 |
| 4 | 3300048913 | Ga0496110_0908664 | Ga0496110_0908664_181_768 | 187 |
| 5 | 3300009036 | Ga0105244_10198455 | Ga0105244_101984552 | 189 |
| 6 | 3300037471 | Ga0395905_0290396 | Ga0395905_0290396_43_675 | 195 |
| 7 | 3300005844 | Ga0068862_100000114 | Ga0068862_10000011442 | 199 |
| 8 | 3300025961 | Ga0207712_10043413 | Ga0207712_100434132 | 199 |
| 9 | 3300028380 | Ga0268265_10000008 | Ga0268265_10000008137 | 199 |
| 10 | 3300005563 | Ga0068855_100306890 | Ga0068855_1003068902 | 203 |
| 11 | 3300025949 | Ga0207667_10549244 | Ga0207667_105492442 | 203 |
| 12 | 3300005467 | Ga0070706_100003916 | Ga0070706_10000391612 | 205 |
| 13 | 3300025910 | Ga0207684_10032364 | Ga0207684_100323642 | 205 |
| 14 | 3300048910 | Ga0496107_0671070 | Ga0496107_0671070_40_690 | 208 |
| 15 | 3300047443 | Ga0495687_039043 | Ga0495687_039043_231_1073 | 209 |
| 16 | 3300046476 | Ga0495662_0175410 | Ga0495662_0175410_210_1028 | 211 |
| 17 | iso_pu_bacteria | 2643221679 | 2644446823 | 217 |
| 18 | 3300005331 | Ga0070670_100176483 | Ga0070670_1001764832 | 222 |
| 19 | 3300005355 | Ga0070671_100224987 | Ga0070671_1002249872 | 222 |
| 20 | 3300005459 | Ga0068867_100351417 | Ga0068867_1003514172 | 222 |
| 21 | 3300005535 | Ga0070684_100572390 | Ga0070684_1005723901 | 222 |
| 22 | 3300005618 | Ga0068864_100492048 | Ga0068864_1004920482 | 222 |
| 23 | 3300013306 | Ga0163162_10242394 | Ga0163162_102423943 | 222 |
| 24 | 3300013308 | Ga0157375_10053002 | Ga0157375_100530025 | 222 |
| 25 | 3300017792 | Ga0163161_10113532 | Ga0163161_101135322 | 222 |
| 26 | 3300025944 | Ga0207661_10558359 | Ga0207661_105583591 | 222 |
| 27 | 3300026023 | Ga0207677_10062177 | Ga0207677_100621772 | 222 |
| 28 | 3300026095 | Ga0207676_10651016 | Ga0207676_106510161 | 222 |
| 29 | 3300046455 | Ga0495603_0349266 | Ga0495603_0349266_81_773 | 222 |
| 30 | 3300048904 | Ga0496101_0507804 | Ga0496101_0507804_66_758 | 222 |
| 31 | 3300048905 | Ga0496102_0220159 | Ga0496102_0220159_252_944 | 222 |
| 32 | 3300048907 | Ga0496104_0169117 | Ga0496104_0169117_185_877 | 222 |
| 33 | 3300048908 | Ga0496105_0054071 | Ga0496105_0054071_1854_2546 | 222 |
| 34 | 3300048912 | Ga0496109_0064640 | Ga0496109_0064640_1182_1874 | 222 |
| 35 | 3300048914 | Ga0496111_0104693 | Ga0496111_0104693_230_922 | 222 |
| 36 | 3300048915 | Ga0496112_0301612 | Ga0496112_0301612_525_1217 | 222 |
| 37 | 3300048916 | Ga0496113_0053297 | Ga0496113_0053297_145_837 | 222 |
| 38 | 3300048917 | Ga0496114_0015031 | Ga0496114_0015031_1113_1805 | 222 |
| 39 | 3300031995 | Ga0307409_100198931 | Ga0307409_1001989312 | 223 |
| 40 | 3300046476 | Ga0495662_0018377 | Ga0495662_0018377_803_1636 | 223 |
| 41 | 3300046514 | Ga0495618_0160267 | Ga0495618_0160267_168_1001 | 223 |
| 42 | 3300046516 | Ga0495628_0092913 | Ga0495628_0092913_984_1817 | 223 |
| 43 | 3300046533 | Ga0495640_0162464 | Ga0495640_0162464_322_1155 | 223 |
| 44 | 3300046675 | Ga0495657_0070690 | Ga0495657_0070690_647_1480 | 223 |
| 45 | 3300047315 | Ga0495581_0034638 | Ga0495581_0034638_990_1823 | 223 |
| 46 | 3300047321 | Ga0495676_0059939 | Ga0495676_0059939_808_1641 | 223 |
| 47 | 3300005467 | Ga0070706_100000962 | Ga0070706_10000096215 | 224 |
| 48 | 3300005468 | Ga0070707_100079810 | Ga0070707_1000798104 | 224 |
| 49 | 3300005536 | Ga0070697_100012271 | Ga0070697_1000122714 | 224 |
| 50 | 3300013102 | Ga0157371_10000603 | Ga0157371_100006036 | 224 |
| 51 | 3300025910 | Ga0207684_10000122 | Ga0207684_1000012254 | 224 |
| 52 | 3300025922 | Ga0207646_10056910 | Ga0207646_100569102 | 224 |
| 53 | 3300041405 | Ga0439438_000005 | Ga0439438_000005_329365_330123 | 224 |
| 54 | iso_pu_bacteria | 2626541554 | 2626635204 | 224 |
| 55 | 3300005471 | Ga0070698_100086512 | Ga0070698_1000865124 | 225 |
| 56 | 3300005536 | Ga0070697_100187624 | Ga0070697_1001876241 | 225 |
| 57 | 3300005467 | Ga0070706_100053070 | Ga0070706_1000530704 | 226 |
| 58 | 3300005468 | Ga0070707_100299582 | Ga0070707_1002995821 | 226 |
| 59 | 3300005468 | Ga0070707_100333618 | Ga0070707_1003336182 | 226 |
| 60 | 3300005518 | Ga0070699_100007852 | Ga0070699_1000078529 | 226 |
| 61 | 3300005530 | Ga0070679_100045599 | Ga0070679_1000455992 | 226 |
| 62 | 3300009147 | Ga0114129_10412267 | Ga0114129_104122672 | 226 |
| 63 | 3300021384 | Ga0213876_10027412 | Ga0213876_100274124 | 226 |
| 64 | 3300025910 | Ga0207684_10411015 | Ga0207684_104110152 | 226 |
| 65 | 3300025921 | Ga0207652_10686375 | Ga0207652_106863751 | 226 |
| 66 | 3300031852 | Ga0307410_10290238 | Ga0307410_102902382 | 226 |
| 67 | 3300039437 | Ga0436365_0611526 | Ga0436365_0611526_109_879 | 226 |
| 68 | 3300039450 | Ga0436363_0028113 | Ga0436363_0028113_1546_2316 | 226 |
| 69 | 3300047323 | Ga0495683_0066910 | Ga0495683_0066910_590_1411 | 226 |
| 70 | 3300045976 | Ga0466967_0534966 | Ga0466967_0534966_30_794 | 227 |
| 71 | 3300048917 | Ga0496114_0681234 | Ga0496114_0681234_65_835 | 227 |
| 72 | 3300005548 | Ga0070665_100009611 | Ga0070665_1000096119 | 228 |
| 73 | 3300005843 | Ga0068860_100011377 | Ga0068860_1000113772 | 228 |
| 74 | 3300028381 | Ga0268264_10008117 | Ga0268264_100081172 | 228 |
| 75 | 3300035117 | Ga0373953_0006900 | Ga0373953_0006900_395_1249 | 228 |
| 76 | 3300035725 | Ga0373947_0061071 | Ga0373947_0061071_594_1448 | 228 |
| 77 | 3300039438 | Ga0436360_1039560 | Ga0436360_1039560_30_734 | 228 |
| 78 | 3300039438 | Ga0436360_0926536 | Ga0436360_0926536_339_1046 | 229 |
| 79 | 3300047317 | Ga0495604_0146522 | Ga0495604_0146522_787_1641 | 229 |
| 80 | 3300005336 | Ga0070680_100140633 | Ga0070680_1001406333 | 230 |
| 81 | 3300005546 | Ga0070696_100003770 | Ga0070696_1000037706 | 230 |
| 82 | 3300025921 | Ga0207652_10315366 | Ga0207652_103153662 | 230 |
| 83 | 3300035724 | Ga0373933_0025902 | Ga0373933_0025902_1115_2026 | 230 |
| 84 | 3300037418 | Ga0395900_0272762 | Ga0395900_0272762_575_1312 | 230 |
| 85 | 3300037466 | Ga0395898_0195566 | Ga0395898_0195566_1142_1879 | 230 |
| 86 | 3300038443 | Ga0395901_0358131 | Ga0395901_0358131_43_780 | 230 |
| 87 | 3300039062 | Ga0400483_217061 | Ga0400483_217061_762_1652 | 230 |
| 88 | 3300039437 | Ga0436365_1782700 | Ga0436365_1782700_533_1351 | 230 |
| 89 | 3300046459 | Ga0495629_0127703 | Ga0495629_0127703_54_965 | 230 |
| 90 | 3300046462 | Ga0495651_0007661 | Ga0495651_0007661_2998_3909 | 230 |
| 91 | 3300046559 | Ga0495667_0004037 | Ga0495667_0004037_2734_3645 | 230 |
| 92 | 3300047322 | Ga0495680_0005285 | Ga0495680_0005285_6961_7872 | 230 |
| 93 | 3300047443 | Ga0495687_041490 | Ga0495687_041490_354_1175 | 230 |
| 94 | 3300005289 | Ga0065704_10087936 | Ga0065704_100879361 | 231 |
| 95 | 3300005445 | Ga0070708_100438568 | Ga0070708_1004385682 | 231 |
| 96 | 3300028666 | Ga0265336_10028063 | Ga0265336_100280631 | 231 |
| 97 | 3300028800 | Ga0265338_10005116 | Ga0265338_100051163 | 231 |
| 98 | 3300031733 | Ga0316577_10228954 | Ga0316577_102289541 | 231 |
| 99 | 3300036712 | Ga0316584_0138249 | Ga0316584_0138249_651_1385 | 231 |
| 100 | 3300037068 | Ga0373925_0480343 | Ga0373925_0480343_235_981 | 231 |
| 101 | 3300005459 | Ga0068867_100016615 | Ga0068867_1000166153 | 232 |
| 102 | 3300014326 | Ga0157380_10062309 | Ga0157380_100623092 | 232 |
| 103 | 3300026089 | Ga0207648_10041611 | Ga0207648_100416113 | 232 |
| 104 | 3300039438 | Ga0436360_1090470 | Ga0436360_1090470_72_788 | 232 |
| 105 | 3300039453 | Ga0436362_0658930 | Ga0436362_0658930_121_837 | 232 |
| 106 | 3300046675 | Ga0495657_0019622 | Ga0495657_0019622_45_899 | 233 |
| 107 | iso_pu_bacteria | 2508501039 | 2508674081 | 233 |
| 108 | 3300050507 | nmdc:mga05p37_882748_c1 | nmdc:mga05p37_882748_c1_33_752 | 234 |
| 109 | iso_pu_bacteria | 8054913762 | 8054917265 | 234 |
| 110 | 3300006914 | Ga0075436_100276729 | Ga0075436_1002767292 | 235 |
| 111 | 3300036401 | Ga0373937_0107291 | Ga0373937_0107291_947_1858 | 235 |
| 112 | 3300050514 | nmdc:mga08x19_298321_c1 | nmdc:mga08x19_298321_c1_326_1054 | 235 |
| 113 | iso_pu_bacteria | 2837268691 | 2837275499 | 235 |
| 114 | iso_pu_bacteria | 2888373701 | 2888377008 | 235 |
| 115 | iso_pu_bacteria | 8002775197 | 8002778099 | 235 |
| 116 | iso_pu_bacteria | 8054920844 | 8054924142 | 235 |
| 117 | 3300046457 | Ga0495590_0008726 | Ga0495590_0008726_557_1378 | 236 |
| 118 | 3300046474 | Ga0495605_0017978 | Ga0495605_0017978_2394_3215 | 236 |
| 119 | 3300046491 | Ga0495584_0034532 | Ga0495584_0034532_244_1065 | 236 |
| 120 | 3300046499 | Ga0495594_0063222 | Ga0495594_0063222_298_1119 | 236 |
| 121 | 3300046499 | Ga0495594_0203136 | Ga0495594_0203136_11_832 | 236 |
| 122 | 3300046507 | Ga0495606_0019474 | Ga0495606_0019474_2101_2922 | 236 |
| 123 | 3300046513 | Ga0495616_0026176 | Ga0495616_0026176_898_1719 | 236 |
| 124 | 3300046526 | Ga0495666_0054665 | Ga0495666_0054665_389_1210 | 236 |
| 125 | 3300046542 | Ga0495597_0046838 | Ga0495597_0046838_391_1212 | 236 |
| 126 | 3300046616 | Ga0495668_0045955 | Ga0495668_0045955_949_1770 | 236 |
| 127 | 3300046660 | Ga0495625_0055954 | Ga0495625_0055954_1387_2208 | 236 |
| 128 | 3300046794 | Ga0495589_0018178 | Ga0495589_0018178_1990_2811 | 236 |
| 129 | 3300046810 | Ga0495660_0101795 | Ga0495660_0101795_298_1119 | 236 |
| 130 | 3300047321 | Ga0495676_0037606 | Ga0495676_0037606_1711_2532 | 236 |
| 131 | 3300047323 | Ga0495683_0067389 | Ga0495683_0067389_583_1404 | 236 |
| 132 | 3300048089 | Ga0495614_0035385 | Ga0495614_0035385_297_1118 | 236 |
| 133 | 3300048091 | Ga0495626_0032569 | Ga0495626_0032569_1028_1849 | 236 |
| 134 | iso_pu_bacteria | 2506520007 | 2506578358 | 236 |
| 135 | iso_pu_bacteria | 2506520008 | 2506583496 | 236 |
| 136 | iso_pu_bacteria | 2508501071 | 2508852358 | 236 |
| 137 | iso_pu_bacteria | 2585427591 | 2585828101 | 236 |
| 138 | iso_pu_bacteria | 2599185299 | 2599928869 | 236 |
| 139 | iso_pu_bacteria | 2648501693 | 2650897536 | 236 |
| 140 | iso_pu_bacteria | 2654587920 | 2656276554 | 236 |
| 141 | iso_pu_bacteria | 2667528173 | 2671107503 | 236 |
| 142 | iso_pu_bacteria | 2684622997 | 2686354911 | 236 |
| 143 | iso_pu_bacteria | 2687453601 | 2689444908 | 236 |
| 144 | iso_pu_bacteria | 2806310673 | 2807180533 | 236 |
| 145 | iso_pu_bacteria | 2808606414 | 2809126376 | 236 |
| 146 | iso_pu_bacteria | 2847797336 | 2847798540 | 236 |
| 147 | iso_pu_bacteria | 2869551831 | 2869554321 | 236 |
| 148 | iso_pu_bacteria | 2904474040 | 2904476495 | 236 |
| 149 | iso_pu_bacteria | 2904504865 | 2904508453 | 236 |
| 150 | iso_pu_bacteria | 2919150387 | 2919152664 | 236 |
| 151 | iso_pu_bacteria | 2927143783 | 2927146625 | 236 |
| 152 | iso_pu_bacteria | 2939602548 | 2939603729 | 236 |
| 153 | iso_pu_bacteria | 2984494565 | 2984495357 | 236 |
| 154 | iso_pu_bacteria | 2990261002 | 2990265068 | 236 |
| 155 | 3300039062 | Ga0400483_144240 | Ga0400483_144240_3780_4625 | 237 |
| 156 | 3300046459 | Ga0495629_0024708 | Ga0495629_0024708_1714_2535 | 237 |
| 157 | iso_pu_bacteria | 2929160207 | 2929164951 | 237 |
| 158 | 3300005339 | Ga0070660_100079867 | Ga0070660_1000798674 | 238 |
| 159 | 3300005339 | Ga0070660_100397790 | Ga0070660_1003977902 | 238 |
| 160 | 3300005366 | Ga0070659_100110551 | Ga0070659_1001105512 | 238 |
| 161 | 3300005564 | Ga0070664_100458569 | Ga0070664_1004585692 | 238 |
| 162 | 3300010375 | Ga0105239_10153859 | Ga0105239_101538592 | 238 |
| 163 | 3300025297 | Ga0209758_1028921 | Ga0209758_10289212 | 238 |
| 164 | 3300025919 | Ga0207657_10075262 | Ga0207657_100752623 | 238 |
| 165 | 3300025932 | Ga0207690_10060943 | Ga0207690_100609433 | 238 |
| 166 | 3300025932 | Ga0207690_10341013 | Ga0207690_103410132 | 238 |
| 167 | 3300041452 | Ga0451793_0430880 | Ga0451793_0430880_542_1303 | 238 |
| 168 | 3300041512 | Ga0451853_2695249 | Ga0451853_2695249_881_1777 | 238 |
| 169 | 3300046455 | Ga0495603_0000505 | Ga0495603_0000505_5643_6398 | 238 |
| 170 | 3300046459 | Ga0495629_0003273 | Ga0495629_0003273_1400_2155 | 238 |
| 171 | 3300046499 | Ga0495594_0004397 | Ga0495594_0004397_1048_1803 | 238 |
| 172 | 3300046557 | Ga0495622_0052167 | Ga0495622_0052167_1103_1858 | 238 |
| 173 | 3300046674 | Ga0495588_0049050 | Ga0495588_0049050_167_922 | 238 |
| 174 | 3300047321 | Ga0495676_0010087 | Ga0495676_0010087_6664_7419 | 238 |
| 175 | 3300048905 | Ga0496102_0374608 | Ga0496102_0374608_551_1330 | 238 |
| 176 | 3300048917 | Ga0496114_0324360 | Ga0496114_0324360_288_1046 | 238 |
| 177 | iso_pu_bacteria | 2547132181 | 2547694659 | 238 |
| 178 | iso_pu_bacteria | 2561511199 | 2562466734 | 238 |
| 179 | iso_pu_bacteria | 2791355010 | 2792314876 | 238 |
| 180 | 3300003187 | JGI25151J46595_10028766 | JGI25151J46595_100287663 | 239 |
| 181 | 3300025294 | Ga0209025_1000343 | Ga0209025_100034359 | 239 |
| 182 | 3300039437 | Ga0436365_0657985 | Ga0436365_0657985_2294_3049 | 239 |
| 183 | 3300047470 | Ga0495681_0033370 | Ga0495681_0033370_1109_1828 | 239 |
| 184 | 2162886007 | SwRhRL2b_contig_1321628 | SwRhRL2b_0917.00005040 | 240 |
| 185 | 3300001989 | JGI24739J22299_10000001 | JGI24739J22299_1000000162 | 240 |
| 186 | 3300002737 | JGI25162J39368_1000010 | JGI25162J39368_100001054 | 240 |
| 187 | 3300002771 | JGI25163J39215_1000035 | JGI25163J39215_100003523 | 240 |
| 188 | 3300002772 | JGI25164J39214_1000003 | JGI25164J39214_1000003309 | 240 |
| 189 | 3300003751 | Ga0055538_1000009 | Ga0055538_100000954 | 240 |
| 190 | 3300003752 | Ga0055539_1000013 | Ga0055539_100001354 | 240 |
| 191 | 3300003756 | Ga0055533_1000017 | Ga0055533_100001754 | 240 |
| 192 | 3300003759 | Ga0055525_1000019 | Ga0055525_100001954 | 240 |
| 193 | 3300003841 | Ga0055541_1000010 | Ga0055541_100001054 | 240 |
| 194 | 3300005289 | Ga0065704_10000510 | Ga0065704_1000051025 | 240 |
| 195 | 3300005355 | Ga0070671_100001325 | Ga0070671_10000132515 | 240 |
| 196 | 3300009011 | Ga0105251_10022557 | Ga0105251_100225573 | 240 |
| 197 | 3300009036 | Ga0105244_10000352 | Ga0105244_100003527 | 240 |
| 198 | 3300009036 | Ga0105244_10000469 | Ga0105244_1000046926 | 240 |
| 199 | 3300009036 | Ga0105244_10022689 | Ga0105244_100226891 | 240 |
| 200 | 3300009092 | Ga0105250_10000017 | Ga0105250_1000001797 | 240 |
| 201 | 3300009092 | Ga0105250_10011944 | Ga0105250_100119442 | 240 |
| 202 | 3300009101 | Ga0105247_10000128 | Ga0105247_1000012832 | 240 |
| 203 | 3300013100 | Ga0157373_10007327 | Ga0157373_100073277 | 240 |
| 204 | 3300013102 | Ga0157371_10000237 | Ga0157371_1000023769 | 240 |
| 205 | 3300013102 | Ga0157371_10001259 | Ga0157371_1000125923 | 240 |
| 206 | 3300013102 | Ga0157371_10013480 | Ga0157371_100134805 | 240 |
| 207 | 3300013104 | Ga0157370_10000982 | Ga0157370_100009822 | 240 |
| 208 | 3300025207 | Ga0209760_100067 | Ga0209760_10006776 | 240 |
| 209 | 3300025224 | Ga0209784_100012 | Ga0209784_10001253 | 240 |
| 210 | 3300025225 | Ga0209566_100010 | Ga0209566_10001053 | 240 |
| 211 | 3300025226 | Ga0209674_100023 | Ga0209674_10002353 | 240 |
| 212 | 3300025230 | Ga0209563_100027 | Ga0209563_10002753 | 240 |
| 213 | 3300025231 | Ga0207427_100017 | Ga0207427_10001753 | 240 |
| 214 | 3300025233 | Ga0209437_100029 | Ga0209437_10002953 | 240 |
| 215 | 3300025253 | Ga0209677_100014 | Ga0209677_10001453 | 240 |
| 216 | 3300025261 | Ga0209233_1000433 | Ga0209233_100043321 | 240 |
| 217 | 3300025711 | Ga0207696_1000015 | Ga0207696_100001581 | 240 |
| 218 | 3300025711 | Ga0207696_1000303 | Ga0207696_100030325 | 240 |
| 219 | 3300025728 | Ga0207655_1000484 | Ga0207655_100048424 | 240 |
| 220 | 3300025728 | Ga0207655_1006558 | Ga0207655_10065586 | 240 |
| 221 | 3300025728 | Ga0207655_1013016 | Ga0207655_10130167 | 240 |
| 222 | 3300025735 | Ga0207713_1037473 | Ga0207713_10374733 | 240 |
| 223 | 3300025900 | Ga0207710_10000224 | Ga0207710_1000022438 | 240 |
| 224 | 3300025931 | Ga0207644_10001232 | Ga0207644_100012325 | 240 |
| 225 | 3300025972 | Ga0207668_10168988 | Ga0207668_101689882 | 240 |
| 226 | 3300026088 | Ga0207641_10067553 | Ga0207641_100675532 | 240 |
| 227 | 3300027312 | Ga0209371_1029976 | Ga0209371_10299762 | 240 |
| 228 | 3300030500 | Ga0268256_1034122 | Ga0268256_10341222 | 240 |
| 229 | 3300041491 | Ga0451833_0675184 | Ga0451833_0675184_597_1379 | 240 |
| 230 | 3300042006 | Ga0439432_010899 | Ga0439432_010899_1461_2198 | 240 |
| 231 | 3300046471 | Ga0495650_0000052 | Ga0495650_0000052_33403_34125 | 240 |
| 232 | 3300046810 | Ga0495660_0000006 | Ga0495660_0000006_31060_31782 | 240 |
| 233 | 3300048907 | Ga0496104_0000400 | Ga0496104_0000400_36552_37274 | 240 |
| 234 | 3300048919 | Ga0496116_0000020 | Ga0496116_0000020_45367_46089 | 240 |
| 235 | 3300048919 | Ga0496116_0000308 | Ga0496116_0000308_23969_24706 | 240 |
| 236 | 3300048920 | Ga0496117_0001038 | Ga0496117_0001038_38778_39515 | 240 |
| 237 | 3300048920 | Ga0496117_0007425 | Ga0496117_0007425_8774_9496 | 240 |
| 238 | 3300048920 | Ga0496117_0028309 | Ga0496117_0028309_3476_4315 | 240 |
| 239 | 3300048921 | Ga0496118_0000048 | Ga0496118_0000048_236205_237044 | 240 |
| 240 | 3300048921 | Ga0496118_0003859 | Ga0496118_0003859_14105_14842 | 240 |
| 241 | 3300048921 | Ga0496118_0028756 | Ga0496118_0028756_3030_3761 | 240 |
| 242 | 3300048921 | Ga0496118_0074116 | Ga0496118_0074116_642_1364 | 240 |
| 243 | 3300048922 | Ga0496119_0065322 | Ga0496119_0065322_1340_2062 | 240 |
| 244 | 3300048923 | Ga0496120_0076328 | Ga0496120_0076328_509_1231 | 240 |
| 245 | 3300048925 | Ga0496122_0000010 | Ga0496122_0000010_273688_274410 | 240 |
| 246 | 3300048926 | Ga0496123_0000025 | Ga0496123_0000025_266097_266819 | 240 |
| 247 | 3300048927 | Ga0496124_0000042 | Ga0496124_0000042_62083_62805 | 240 |
| 248 | 3300048928 | Ga0496125_0000054 | Ga0496125_0000054_100923_101645 | 240 |
| 249 | 3300048929 | Ga0496126_0000218 | Ga0496126_0000218_44155_44877 | 240 |
| 250 | iso_pu_bacteria | 640753048 | 640937869 | 240 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vr0-assembly1.cif.gz_A | crystal structure of putative 2-phosphosulfolactate phosphatase (15026306) from clostridium acetobutylicum at 2.6 a resolution | 0.8511 | 11 | 236 |
| 2z0j-assembly3.cif.gz_F | crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 | 0.8413 | 11 | 239 |
| 1vr0-assembly1.cif.gz_A | crystal structure of putative 2-phosphosulfolactate phosphatase (15026306) from clostridium acetobutylicum at 2.6 a resolution | 0.8143 | 11 | 236 |
| 2yzo-assembly1.cif.gz_A | crystal structure of uncharacterized conserved protein from thermotoga maritima | 0.8137 | 12 | 239 |
| 2z0j-assembly3.cif.gz_F | crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 | 0.812 | 11 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vr0B00 | Alpha Beta;Alpha-Beta Complex;putative 2-phosphosulfolactate phosphatase;ComB-like | 0.8496 | 11 | 236 | 3.90.1560.10 |
| 2z0jF00 | Alpha Beta;Alpha-Beta Complex;putative 2-phosphosulfolactate phosphatase;ComB-like | 0.8413 | 11 | 239 | 3.90.1560.10 |
| 1vr0B00 | Alpha Beta;Alpha-Beta Complex;putative 2-phosphosulfolactate phosphatase;ComB-like | 0.8392 | 11 | 236 | 3.90.1560.10 |
| af_Q58540_5_221_3.90.1560.10 | Alpha Beta;Alpha-Beta Complex;putative 2-phosphosulfolactate phosphatase;ComB-like | 0.8302 | 27 | 237 | 3.90.1560.10 |
| 2yyvA00 | Alpha Beta;Alpha-Beta Complex;putative 2-phosphosulfolactate phosphatase;ComB-like | 0.8222 | 12 | 239 | 3.90.1560.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H2J268-F1-model_v4 | Probable 2-phosphosulfolactate phosphatase (EC 3.1.3.71) | 0.9991 | 1 | 240 |
GO:0000287
GO:0050532 GO:0050545 |
| AF-A0A7V8G1L4-F1-model_v4 | Probable 2-phosphosulfolactate phosphatase | 0.9789 | 1 | 240 |
GO:0000287
GO:0005886 GO:0050532 |
| AF-A0A7V8G1L4-F1-model_v4 | Probable 2-phosphosulfolactate phosphatase | 0.9749 | 1 | 240 |
GO:0000287
GO:0005886 GO:0050532 |
| AF-A0A7Z1ZID8-F1-model_v4 | deleted | 0.9683 | 34 | 239 |
|
| AF-A0A849IK23-F1-model_v4 | Probable 2-phosphosulfolactate phosphatase (EC 3.1.3.71) | 0.9661 | 6 | 240 |
GO:0000287
GO:0050532 GO:0050545 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar