F361907

General Info

Members Datasets Scaffolds Average Seq Length
250 198 216 242

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0028309|Ga0496117_0028309_3476_4315
Length 279
Sequence LPCFSTGIINAENRVNQCSEYTGGLTCFFLLLYSEQDAFMTDFSQADFDVRVEWGAPAIEHLAAEADCIVIIDVMSFSTCVSVAGERGGMIFPYPWKDASAQQFAAENDAECAQFDRRFQGQGFTLSPCSLLNMTAGTRLVLPSPNGSALTFKAKAHKAAIFTACFRNLTATARACEKYRQILIVPAGEKWPDNSLRPALEDFAAAGGLVSRLSHRRLSAEARAARAVYQHLTRAELERCGSARELNRRGFAADIALCLEEDVSDLACQFQGRYFTAHR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501039 Frankia saprophytica CN3 Isolate Nodule
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2547132181 Kosakonia sacchari SP1 Isolate Stem
7 2561511199 Enterobacter sp. R4-368 Isolate Nodule
8 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
9 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
10 2626541554 Frankia sp. AvcI.1 Isolate Nodule
11 2643221679 Angustibacter sp. Root456 Isolate Unclassified
12 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
13 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
14 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
15 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
16 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
17 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
18 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
19 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
20 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
21 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
22 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
23 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
24 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
25 2904504865 Serratia marcescens 1822 Isolate Unclassified
26 2919150387 Rahnella aceris 1817 Isolate Unclassified
27 2927143783 Rahnella sp. 2050 Isolate Unclassified
28 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
29 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
30 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
31 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
34 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
35 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
38 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
39 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
115 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
134 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
135 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 640753048 Serratia proteamaculans 568 Isolate Endosphere
196 8002775197 Frankia nepalensis CN7 Isolate Nodule
197 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
198 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.4
Metatranscriptomes 0
Isolates 13.6

Biome Distribution

Category Percentage (%)
Aerial Root 0.8
Bulb 0
Endosphere 8.4
Nodule 2.4
Rhizoplane 7.6
Rhizosphere 66.8
Stem 0.4
Stem Tuber 0
Unclassified 13.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1321628 2162886007 Bacteria 2327
2 JGI24739J22299_10000001 3300001989 Bacteria 99744
3 JGI25162J39368_1000010 3300002737 Bacteria 389629
4 JGI25163J39215_1000035 3300002771 Bacteria 62515
5 JGI25164J39214_1000003 3300002772 Bacteria 389390
6 JGI25151J46595_10028766 3300003187 Bacteria 2209
7 Ga0055538_1000009 3300003751 Bacteria 389629
8 Ga0055539_1000013 3300003752 Bacteria 389629
9 Ga0055533_1000017 3300003756 Bacteria 389629
10 Ga0055525_1000019 3300003759 Bacteria 389629
11 Ga0055541_1000010 3300003841 Bacteria 389629
12 Ga0065704_10000510 3300005289 Bacteria 31849
13 Ga0065704_10087936 3300005289 Bacteria 2981
14 Ga0070670_100176483 3300005331 Bacteria 1854
15 Ga0070680_100140633 3300005336 Bacteria 2024
16 Ga0070660_100079867 3300005339 Bacteria 2566
17 Ga0070660_100397790 3300005339 Bacteria 1139
18 Ga0070671_100001325 3300005355 Bacteria 18591
19 Ga0070671_100224987 3300005355 Bacteria 1592
20 Ga0070659_100110551 3300005366 Bacteria 2218
21 Ga0070708_100438568 3300005445 Bacteria 1232
22 Ga0068867_100016615 3300005459 Bacteria 5226
23 Ga0068867_100351417 3300005459 Bacteria 1230
24 Ga0070706_100000962 3300005467 Bacteria 31392
25 Ga0070706_100003916 3300005467 Bacteria 14515
26 Ga0070706_100053070 3300005467 Bacteria 3741
27 Ga0070707_100079810 3300005468 Bacteria 3158
28 Ga0070707_100299582 3300005468 Unclassified 1562
29 Ga0070707_100333618 3300005468 Unclassified 1473
30 Ga0070707_100880555 3300005468 Archaea 860
31 Ga0070698_100086512 3300005471 Bacteria 3120
32 Ga0070699_100007852 3300005518 Bacteria 9269
33 Ga0070679_100045599 3300005530 Bacteria 4369
34 Ga0070684_100572390 3300005535 Bacteria 1049
35 Ga0070697_100012271 3300005536 Bacteria 6711
36 Ga0070697_100187624 3300005536 Bacteria 1754
37 Ga0070696_100003770 3300005546 Bacteria 10124
38 Ga0070665_100009611 3300005548 Bacteria 9782
39 Ga0068855_100306890 3300005563 Bacteria 1756
40 Ga0070664_100458569 3300005564 Bacteria 1171
41 Ga0068864_100492048 3300005618 Bacteria 1179
42 Ga0068860_100011377 3300005843 Bacteria 8769
43 Ga0068862_100000114 3300005844 Bacteria 96243
44 Ga0075436_100276729 3300006914 Unclassified 1199
45 Ga0105251_10022557 3300009011 Bacteria 3266
46 Ga0105244_10000352 3300009036 Bacteria 43225
47 Ga0105244_10000469 3300009036 Bacteria 36819
48 Ga0105244_10022689 3300009036 Bacteria 3452
49 Ga0105244_10198455 3300009036 Bacteria 947
50 Ga0105250_10000017 3300009092 Bacteria 255998
51 Ga0105250_10011944 3300009092 Bacteria 3597
52 Ga0105247_10000128 3300009101 Bacteria 73288
53 Ga0114129_10412267 3300009147 Unclassified 1779
54 Ga0105239_10153859 3300010375 Bacteria 2567
55 Ga0157373_10007327 3300013100 Bacteria 8218
56 Ga0157371_10000237 3300013102 Bacteria 78761
57 Ga0157371_10000603 3300013102 Bacteria 42845
58 Ga0157371_10001259 3300013102 Bacteria 26712
59 Ga0157371_10013480 3300013102 Bacteria 6206
60 Ga0157370_10000982 3300013104 Bacteria 36103
61 Ga0163162_10242394 3300013306 Bacteria 1934
62 Ga0157372_10092679 3300013307 Bacteria 3437
63 Ga0157375_10053002 3300013308 Bacteria 3990
64 Ga0157380_10062309 3300014326 Bacteria 2987
65 Ga0163161_10113532 3300017792 Bacteria 2028
66 Ga0213876_10027412 3300021384 Bacteria 3007
67 Ga0209760_100067 3300025207 Bacteria 87264
68 Ga0209784_100012 3300025224 Bacteria 535823
69 Ga0209566_100010 3300025225 Bacteria 535823
70 Ga0209674_100023 3300025226 Bacteria 535823
71 Ga0209563_100027 3300025230 Bacteria 535823
72 Ga0207427_100017 3300025231 Bacteria 535823
73 Ga0209437_100029 3300025233 Bacteria 535823
74 Ga0209677_100014 3300025253 Bacteria 535823
75 Ga0209233_1000433 3300025261 Bacteria 30150
76 Ga0209025_1000343 3300025294 Bacteria 101870
77 Ga0209758_1028921 3300025297 Bacteria 2331
78 Ga0207696_1000015 3300025711 Bacteria 507848
79 Ga0207696_1000303 3300025711 Bacteria 56541
80 Ga0207655_1000484 3300025728 Bacteria 51406
81 Ga0207655_1006558 3300025728 Bacteria 7686
82 Ga0207655_1013016 3300025728 Bacteria 4806
83 Ga0207713_1037473 3300025735 Bacteria 2067
84 Ga0207710_10000224 3300025900 Bacteria 49005
85 Ga0207684_10000122 3300025910 Bacteria 142635
86 Ga0207684_10032364 3300025910 Bacteria 4447
87 Ga0207684_10411015 3300025910 Unclassified 1163
88 Ga0207657_10075262 3300025919 Bacteria 2849
89 Ga0207652_10315366 3300025921 Bacteria 1411
90 Ga0207652_10686375 3300025921 Bacteria 914
91 Ga0207646_10056910 3300025922 Bacteria 3494
92 Ga0207646_10649792 3300025922 Archaea 945
93 Ga0207644_10001232 3300025931 Bacteria 16460
94 Ga0207690_10060943 3300025932 Bacteria 2563
95 Ga0207690_10341013 3300025932 Bacteria 1183
96 Ga0207661_10558359 3300025944 Bacteria 1049
97 Ga0207667_10549244 3300025949 Bacteria 1168
98 Ga0207712_10043413 3300025961 Bacteria 3101
99 Ga0207668_10168988 3300025972 Bacteria 1713
100 Ga0207677_10062177 3300026023 Bacteria 2589
101 Ga0207641_10067553 3300026088 Unclassified 3063
102 Ga0207648_10041611 3300026089 Bacteria 4035
103 Ga0207676_10651016 3300026095 Bacteria 1017
104 Ga0209371_1029976 3300027312 Bacteria 1196
105 Ga0268265_10000008 3300028380 Bacteria 417328
106 Ga0268264_10008117 3300028381 Bacteria 8730
107 Ga0265336_10028063 3300028666 Bacteria 1759
108 Ga0265338_10005116 3300028800 Bacteria 17283
109 Ga0268256_1034122 3300030500 Bacteria 1196
110 Ga0316577_10228954 3300031733 Unclassified 1051
111 Ga0307410_10290238 3300031852 Bacteria 1287
112 Ga0307409_100198931 3300031995 Bacteria 1791
113 Ga0373953_0006900 3300035117 Bacteria 3771
114 Ga0373933_0025902 3300035724 Bacteria 3364
115 Ga0373947_0061071 3300035725 Bacteria 2290
116 Ga0373937_0107291 3300036401 Bacteria 2596
117 Ga0316584_0138249 3300036712 Bacteria 1818
118 Ga0373925_0480343 3300037068 Unclassified 1019
119 Ga0395900_0272762 3300037418 Bacteria 1686
120 Ga0395898_0195566 3300037466 Unclassified 1932
121 Ga0395905_0290396 3300037471 Unclassified 1522
122 Ga0395901_0358131 3300038443 Unclassified 1505
123 Ga0400483_144240 3300039062 Unclassified 4650
124 Ga0400483_217061 3300039062 Bacteria 2381
125 Ga0436365_0611526 3300039437 Bacteria 1555
126 Ga0436365_0657985 3300039437 Bacteria 3989
127 Ga0436365_1782700 3300039437 Unclassified 2365
128 Ga0436360_0926536 3300039438 Unclassified 1169
129 Ga0436360_1039560 3300039438 Bacteria 982
130 Ga0436360_1090470 3300039438 Unclassified 856
131 Ga0436363_0028113 3300039450 Bacteria 3310
132 Ga0436362_0658930 3300039453 Unclassified 891
133 Ga0439438_000005 3300041405 Bacteria 408610
134 Ga0451793_0430880 3300041452 Bacteria 5314
135 Ga0451833_0675184 3300041491 Bacteria 2139
136 Ga0451853_2695249 3300041512 Bacteria 2018
137 Ga0439432_010899 3300042006 Bacteria 3138
138 Ga0466967_0534966 3300045976 Bacteria 1152
139 Ga0495603_0000505 3300046455 Bacteria 21670
140 Ga0495603_0349266 3300046455 Bacteria 849
141 Ga0495590_0008726 3300046457 Bacteria 3857
142 Ga0495629_0003273 3300046459 Bacteria 12255
143 Ga0495629_0024708 3300046459 Bacteria 4277
144 Ga0495629_0127703 3300046459 Bacteria 1771
145 Ga0495651_0007661 3300046462 Bacteria 8254
146 Ga0495650_0000052 3300046471 Bacteria 318176
147 Ga0495605_0017978 3300046474 Bacteria 3797
148 Ga0495662_0018377 3300046476 Bacteria 3383
149 Ga0495662_0175410 3300046476 Bacteria 1056
150 Ga0495584_0034532 3300046491 Bacteria 2558
151 Ga0495594_0004397 3300046499 Bacteria 7254
152 Ga0495594_0063222 3300046499 Bacteria 2050
153 Ga0495594_0203136 3300046499 Bacteria 1129
154 Ga0495606_0019474 3300046507 Bacteria 5047
155 Ga0495616_0026176 3300046513 Bacteria 3108
156 Ga0495618_0160267 3300046514 Bacteria 1434
157 Ga0495628_0092913 3300046516 Bacteria 2333
158 Ga0495666_0054665 3300046526 Bacteria 1914
159 Ga0495640_0162464 3300046533 Bacteria 1430
160 Ga0495597_0046838 3300046542 Bacteria 1915
161 Ga0495622_0052167 3300046557 Bacteria 1897
162 Ga0495667_0004037 3300046559 Bacteria 9865
163 Ga0495668_0045955 3300046616 Bacteria 2426
164 Ga0495625_0055954 3300046660 Bacteria 2811
165 Ga0495588_0049050 3300046674 Bacteria 2170
166 Ga0495657_0019622 3300046675 Bacteria 4875
167 Ga0495657_0070690 3300046675 Bacteria 2280
168 Ga0495589_0018178 3300046794 Bacteria 3607
169 Ga0495660_0000006 3300046810 Bacteria 571713
170 Ga0495660_0101795 3300046810 Bacteria 1477
171 Ga0495581_0034638 3300047315 Bacteria 2921
172 Ga0495604_0146522 3300047317 Bacteria 1682
173 Ga0495676_0010087 3300047321 Bacteria 8578
174 Ga0495676_0037606 3300047321 Bacteria 4026
175 Ga0495676_0059939 3300047321 Bacteria 2985
176 Ga0495680_0005285 3300047322 Bacteria 12182
177 Ga0495683_0066910 3300047323 Bacteria 1769
178 Ga0495683_0067389 3300047323 Bacteria 1762
179 Ga0495687_039043 3300047443 Bacteria 2103
180 Ga0495687_041490 3300047443 Bacteria 2018
181 Ga0495681_0033370 3300047470 Bacteria 2579
182 Ga0495614_0035385 3300048089 Bacteria 2145
183 Ga0495626_0032569 3300048091 Bacteria 2502
184 Ga0496101_0507804 3300048904 Bacteria 952
185 Ga0496102_0220159 3300048905 Bacteria 1789
186 Ga0496102_0374608 3300048905 Bacteria 1340
187 Ga0496104_0000400 3300048907 Bacteria 38012
188 Ga0496104_0169117 3300048907 Bacteria 2096
189 Ga0496105_0054071 3300048908 Bacteria 3316
190 Ga0496107_0671070 3300048910 Bacteria 763
191 Ga0496109_0064640 3300048912 Bacteria 3348
192 Ga0496110_0908664 3300048913 Bacteria 786
193 Ga0496111_0104693 3300048914 Bacteria 2081
194 Ga0496112_0301612 3300048915 Bacteria 1547
195 Ga0496113_0053297 3300048916 Bacteria 3024
196 Ga0496114_0015031 3300048917 Bacteria 6223
197 Ga0496114_0324360 3300048917 Unclassified 1361
198 Ga0496114_0681234 3300048917 Bacteria 903
199 Ga0496116_0000020 3300048919 Bacteria 501307
200 Ga0496116_0000308 3300048919 Bacteria 82039
201 Ga0496117_0001038 3300048920 Bacteria 42361
202 Ga0496117_0007425 3300048920 Bacteria 10710
203 Ga0496117_0028309 3300048920 Bacteria 4343
204 Ga0496118_0000048 3300048921 Bacteria 253404
205 Ga0496118_0003859 3300048921 Bacteria 18419
206 Ga0496118_0028756 3300048921 Bacteria 4675
207 Ga0496118_0074116 3300048921 Bacteria 2434
208 Ga0496119_0065322 3300048922 Bacteria 2155
209 Ga0496120_0076328 3300048923 Bacteria 1826
210 Ga0496122_0000010 3300048925 Bacteria 547417
211 Ga0496123_0000025 3300048926 Bacteria 323956
212 Ga0496124_0000042 3300048927 Bacteria 301126
213 Ga0496125_0000054 3300048928 Bacteria 278377
214 Ga0496126_0000218 3300048929 Bacteria 126529
215 nmdc:mga05p37_882748_c1 3300050507 Bacteria 967
216 nmdc:mga08x19_298321_c1 3300050514 Bacteria 1119

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10092679 Ga0157372_100926792 183
2 3300005468 Ga0070707_100880555 Ga0070707_1008805551 186
3 3300025922 Ga0207646_10649792 Ga0207646_106497922 186
4 3300048913 Ga0496110_0908664 Ga0496110_0908664_181_768 187
5 3300009036 Ga0105244_10198455 Ga0105244_101984552 189
6 3300037471 Ga0395905_0290396 Ga0395905_0290396_43_675 195
7 3300005844 Ga0068862_100000114 Ga0068862_10000011442 199
8 3300025961 Ga0207712_10043413 Ga0207712_100434132 199
9 3300028380 Ga0268265_10000008 Ga0268265_10000008137 199
10 3300005563 Ga0068855_100306890 Ga0068855_1003068902 203
11 3300025949 Ga0207667_10549244 Ga0207667_105492442 203
12 3300005467 Ga0070706_100003916 Ga0070706_10000391612 205
13 3300025910 Ga0207684_10032364 Ga0207684_100323642 205
14 3300048910 Ga0496107_0671070 Ga0496107_0671070_40_690 208
15 3300047443 Ga0495687_039043 Ga0495687_039043_231_1073 209
16 3300046476 Ga0495662_0175410 Ga0495662_0175410_210_1028 211
17 iso_pu_bacteria 2643221679 2644446823 217
18 3300005331 Ga0070670_100176483 Ga0070670_1001764832 222
19 3300005355 Ga0070671_100224987 Ga0070671_1002249872 222
20 3300005459 Ga0068867_100351417 Ga0068867_1003514172 222
21 3300005535 Ga0070684_100572390 Ga0070684_1005723901 222
22 3300005618 Ga0068864_100492048 Ga0068864_1004920482 222
23 3300013306 Ga0163162_10242394 Ga0163162_102423943 222
24 3300013308 Ga0157375_10053002 Ga0157375_100530025 222
25 3300017792 Ga0163161_10113532 Ga0163161_101135322 222
26 3300025944 Ga0207661_10558359 Ga0207661_105583591 222
27 3300026023 Ga0207677_10062177 Ga0207677_100621772 222
28 3300026095 Ga0207676_10651016 Ga0207676_106510161 222
29 3300046455 Ga0495603_0349266 Ga0495603_0349266_81_773 222
30 3300048904 Ga0496101_0507804 Ga0496101_0507804_66_758 222
31 3300048905 Ga0496102_0220159 Ga0496102_0220159_252_944 222
32 3300048907 Ga0496104_0169117 Ga0496104_0169117_185_877 222
33 3300048908 Ga0496105_0054071 Ga0496105_0054071_1854_2546 222
34 3300048912 Ga0496109_0064640 Ga0496109_0064640_1182_1874 222
35 3300048914 Ga0496111_0104693 Ga0496111_0104693_230_922 222
36 3300048915 Ga0496112_0301612 Ga0496112_0301612_525_1217 222
37 3300048916 Ga0496113_0053297 Ga0496113_0053297_145_837 222
38 3300048917 Ga0496114_0015031 Ga0496114_0015031_1113_1805 222
39 3300031995 Ga0307409_100198931 Ga0307409_1001989312 223
40 3300046476 Ga0495662_0018377 Ga0495662_0018377_803_1636 223
41 3300046514 Ga0495618_0160267 Ga0495618_0160267_168_1001 223
42 3300046516 Ga0495628_0092913 Ga0495628_0092913_984_1817 223
43 3300046533 Ga0495640_0162464 Ga0495640_0162464_322_1155 223
44 3300046675 Ga0495657_0070690 Ga0495657_0070690_647_1480 223
45 3300047315 Ga0495581_0034638 Ga0495581_0034638_990_1823 223
46 3300047321 Ga0495676_0059939 Ga0495676_0059939_808_1641 223
47 3300005467 Ga0070706_100000962 Ga0070706_10000096215 224
48 3300005468 Ga0070707_100079810 Ga0070707_1000798104 224
49 3300005536 Ga0070697_100012271 Ga0070697_1000122714 224
50 3300013102 Ga0157371_10000603 Ga0157371_100006036 224
51 3300025910 Ga0207684_10000122 Ga0207684_1000012254 224
52 3300025922 Ga0207646_10056910 Ga0207646_100569102 224
53 3300041405 Ga0439438_000005 Ga0439438_000005_329365_330123 224
54 iso_pu_bacteria 2626541554 2626635204 224
55 3300005471 Ga0070698_100086512 Ga0070698_1000865124 225
56 3300005536 Ga0070697_100187624 Ga0070697_1001876241 225
57 3300005467 Ga0070706_100053070 Ga0070706_1000530704 226
58 3300005468 Ga0070707_100299582 Ga0070707_1002995821 226
59 3300005468 Ga0070707_100333618 Ga0070707_1003336182 226
60 3300005518 Ga0070699_100007852 Ga0070699_1000078529 226
61 3300005530 Ga0070679_100045599 Ga0070679_1000455992 226
62 3300009147 Ga0114129_10412267 Ga0114129_104122672 226
63 3300021384 Ga0213876_10027412 Ga0213876_100274124 226
64 3300025910 Ga0207684_10411015 Ga0207684_104110152 226
65 3300025921 Ga0207652_10686375 Ga0207652_106863751 226
66 3300031852 Ga0307410_10290238 Ga0307410_102902382 226
67 3300039437 Ga0436365_0611526 Ga0436365_0611526_109_879 226
68 3300039450 Ga0436363_0028113 Ga0436363_0028113_1546_2316 226
69 3300047323 Ga0495683_0066910 Ga0495683_0066910_590_1411 226
70 3300045976 Ga0466967_0534966 Ga0466967_0534966_30_794 227
71 3300048917 Ga0496114_0681234 Ga0496114_0681234_65_835 227
72 3300005548 Ga0070665_100009611 Ga0070665_1000096119 228
73 3300005843 Ga0068860_100011377 Ga0068860_1000113772 228
74 3300028381 Ga0268264_10008117 Ga0268264_100081172 228
75 3300035117 Ga0373953_0006900 Ga0373953_0006900_395_1249 228
76 3300035725 Ga0373947_0061071 Ga0373947_0061071_594_1448 228
77 3300039438 Ga0436360_1039560 Ga0436360_1039560_30_734 228
78 3300039438 Ga0436360_0926536 Ga0436360_0926536_339_1046 229
79 3300047317 Ga0495604_0146522 Ga0495604_0146522_787_1641 229
80 3300005336 Ga0070680_100140633 Ga0070680_1001406333 230
81 3300005546 Ga0070696_100003770 Ga0070696_1000037706 230
82 3300025921 Ga0207652_10315366 Ga0207652_103153662 230
83 3300035724 Ga0373933_0025902 Ga0373933_0025902_1115_2026 230
84 3300037418 Ga0395900_0272762 Ga0395900_0272762_575_1312 230
85 3300037466 Ga0395898_0195566 Ga0395898_0195566_1142_1879 230
86 3300038443 Ga0395901_0358131 Ga0395901_0358131_43_780 230
87 3300039062 Ga0400483_217061 Ga0400483_217061_762_1652 230
88 3300039437 Ga0436365_1782700 Ga0436365_1782700_533_1351 230
89 3300046459 Ga0495629_0127703 Ga0495629_0127703_54_965 230
90 3300046462 Ga0495651_0007661 Ga0495651_0007661_2998_3909 230
91 3300046559 Ga0495667_0004037 Ga0495667_0004037_2734_3645 230
92 3300047322 Ga0495680_0005285 Ga0495680_0005285_6961_7872 230
93 3300047443 Ga0495687_041490 Ga0495687_041490_354_1175 230
94 3300005289 Ga0065704_10087936 Ga0065704_100879361 231
95 3300005445 Ga0070708_100438568 Ga0070708_1004385682 231
96 3300028666 Ga0265336_10028063 Ga0265336_100280631 231
97 3300028800 Ga0265338_10005116 Ga0265338_100051163 231
98 3300031733 Ga0316577_10228954 Ga0316577_102289541 231
99 3300036712 Ga0316584_0138249 Ga0316584_0138249_651_1385 231
100 3300037068 Ga0373925_0480343 Ga0373925_0480343_235_981 231
101 3300005459 Ga0068867_100016615 Ga0068867_1000166153 232
102 3300014326 Ga0157380_10062309 Ga0157380_100623092 232
103 3300026089 Ga0207648_10041611 Ga0207648_100416113 232
104 3300039438 Ga0436360_1090470 Ga0436360_1090470_72_788 232
105 3300039453 Ga0436362_0658930 Ga0436362_0658930_121_837 232
106 3300046675 Ga0495657_0019622 Ga0495657_0019622_45_899 233
107 iso_pu_bacteria 2508501039 2508674081 233
108 3300050507 nmdc:mga05p37_882748_c1 nmdc:mga05p37_882748_c1_33_752 234
109 iso_pu_bacteria 8054913762 8054917265 234
110 3300006914 Ga0075436_100276729 Ga0075436_1002767292 235
111 3300036401 Ga0373937_0107291 Ga0373937_0107291_947_1858 235
112 3300050514 nmdc:mga08x19_298321_c1 nmdc:mga08x19_298321_c1_326_1054 235
113 iso_pu_bacteria 2837268691 2837275499 235
114 iso_pu_bacteria 2888373701 2888377008 235
115 iso_pu_bacteria 8002775197 8002778099 235
116 iso_pu_bacteria 8054920844 8054924142 235
117 3300046457 Ga0495590_0008726 Ga0495590_0008726_557_1378 236
118 3300046474 Ga0495605_0017978 Ga0495605_0017978_2394_3215 236
119 3300046491 Ga0495584_0034532 Ga0495584_0034532_244_1065 236
120 3300046499 Ga0495594_0063222 Ga0495594_0063222_298_1119 236
121 3300046499 Ga0495594_0203136 Ga0495594_0203136_11_832 236
122 3300046507 Ga0495606_0019474 Ga0495606_0019474_2101_2922 236
123 3300046513 Ga0495616_0026176 Ga0495616_0026176_898_1719 236
124 3300046526 Ga0495666_0054665 Ga0495666_0054665_389_1210 236
125 3300046542 Ga0495597_0046838 Ga0495597_0046838_391_1212 236
126 3300046616 Ga0495668_0045955 Ga0495668_0045955_949_1770 236
127 3300046660 Ga0495625_0055954 Ga0495625_0055954_1387_2208 236
128 3300046794 Ga0495589_0018178 Ga0495589_0018178_1990_2811 236
129 3300046810 Ga0495660_0101795 Ga0495660_0101795_298_1119 236
130 3300047321 Ga0495676_0037606 Ga0495676_0037606_1711_2532 236
131 3300047323 Ga0495683_0067389 Ga0495683_0067389_583_1404 236
132 3300048089 Ga0495614_0035385 Ga0495614_0035385_297_1118 236
133 3300048091 Ga0495626_0032569 Ga0495626_0032569_1028_1849 236
134 iso_pu_bacteria 2506520007 2506578358 236
135 iso_pu_bacteria 2506520008 2506583496 236
136 iso_pu_bacteria 2508501071 2508852358 236
137 iso_pu_bacteria 2585427591 2585828101 236
138 iso_pu_bacteria 2599185299 2599928869 236
139 iso_pu_bacteria 2648501693 2650897536 236
140 iso_pu_bacteria 2654587920 2656276554 236
141 iso_pu_bacteria 2667528173 2671107503 236
142 iso_pu_bacteria 2684622997 2686354911 236
143 iso_pu_bacteria 2687453601 2689444908 236
144 iso_pu_bacteria 2806310673 2807180533 236
145 iso_pu_bacteria 2808606414 2809126376 236
146 iso_pu_bacteria 2847797336 2847798540 236
147 iso_pu_bacteria 2869551831 2869554321 236
148 iso_pu_bacteria 2904474040 2904476495 236
149 iso_pu_bacteria 2904504865 2904508453 236
150 iso_pu_bacteria 2919150387 2919152664 236
151 iso_pu_bacteria 2927143783 2927146625 236
152 iso_pu_bacteria 2939602548 2939603729 236
153 iso_pu_bacteria 2984494565 2984495357 236
154 iso_pu_bacteria 2990261002 2990265068 236
155 3300039062 Ga0400483_144240 Ga0400483_144240_3780_4625 237
156 3300046459 Ga0495629_0024708 Ga0495629_0024708_1714_2535 237
157 iso_pu_bacteria 2929160207 2929164951 237
158 3300005339 Ga0070660_100079867 Ga0070660_1000798674 238
159 3300005339 Ga0070660_100397790 Ga0070660_1003977902 238
160 3300005366 Ga0070659_100110551 Ga0070659_1001105512 238
161 3300005564 Ga0070664_100458569 Ga0070664_1004585692 238
162 3300010375 Ga0105239_10153859 Ga0105239_101538592 238
163 3300025297 Ga0209758_1028921 Ga0209758_10289212 238
164 3300025919 Ga0207657_10075262 Ga0207657_100752623 238
165 3300025932 Ga0207690_10060943 Ga0207690_100609433 238
166 3300025932 Ga0207690_10341013 Ga0207690_103410132 238
167 3300041452 Ga0451793_0430880 Ga0451793_0430880_542_1303 238
168 3300041512 Ga0451853_2695249 Ga0451853_2695249_881_1777 238
169 3300046455 Ga0495603_0000505 Ga0495603_0000505_5643_6398 238
170 3300046459 Ga0495629_0003273 Ga0495629_0003273_1400_2155 238
171 3300046499 Ga0495594_0004397 Ga0495594_0004397_1048_1803 238
172 3300046557 Ga0495622_0052167 Ga0495622_0052167_1103_1858 238
173 3300046674 Ga0495588_0049050 Ga0495588_0049050_167_922 238
174 3300047321 Ga0495676_0010087 Ga0495676_0010087_6664_7419 238
175 3300048905 Ga0496102_0374608 Ga0496102_0374608_551_1330 238
176 3300048917 Ga0496114_0324360 Ga0496114_0324360_288_1046 238
177 iso_pu_bacteria 2547132181 2547694659 238
178 iso_pu_bacteria 2561511199 2562466734 238
179 iso_pu_bacteria 2791355010 2792314876 238
180 3300003187 JGI25151J46595_10028766 JGI25151J46595_100287663 239
181 3300025294 Ga0209025_1000343 Ga0209025_100034359 239
182 3300039437 Ga0436365_0657985 Ga0436365_0657985_2294_3049 239
183 3300047470 Ga0495681_0033370 Ga0495681_0033370_1109_1828 239
184 2162886007 SwRhRL2b_contig_1321628 SwRhRL2b_0917.00005040 240
185 3300001989 JGI24739J22299_10000001 JGI24739J22299_1000000162 240
186 3300002737 JGI25162J39368_1000010 JGI25162J39368_100001054 240
187 3300002771 JGI25163J39215_1000035 JGI25163J39215_100003523 240
188 3300002772 JGI25164J39214_1000003 JGI25164J39214_1000003309 240
189 3300003751 Ga0055538_1000009 Ga0055538_100000954 240
190 3300003752 Ga0055539_1000013 Ga0055539_100001354 240
191 3300003756 Ga0055533_1000017 Ga0055533_100001754 240
192 3300003759 Ga0055525_1000019 Ga0055525_100001954 240
193 3300003841 Ga0055541_1000010 Ga0055541_100001054 240
194 3300005289 Ga0065704_10000510 Ga0065704_1000051025 240
195 3300005355 Ga0070671_100001325 Ga0070671_10000132515 240
196 3300009011 Ga0105251_10022557 Ga0105251_100225573 240
197 3300009036 Ga0105244_10000352 Ga0105244_100003527 240
198 3300009036 Ga0105244_10000469 Ga0105244_1000046926 240
199 3300009036 Ga0105244_10022689 Ga0105244_100226891 240
200 3300009092 Ga0105250_10000017 Ga0105250_1000001797 240
201 3300009092 Ga0105250_10011944 Ga0105250_100119442 240
202 3300009101 Ga0105247_10000128 Ga0105247_1000012832 240
203 3300013100 Ga0157373_10007327 Ga0157373_100073277 240
204 3300013102 Ga0157371_10000237 Ga0157371_1000023769 240
205 3300013102 Ga0157371_10001259 Ga0157371_1000125923 240
206 3300013102 Ga0157371_10013480 Ga0157371_100134805 240
207 3300013104 Ga0157370_10000982 Ga0157370_100009822 240
208 3300025207 Ga0209760_100067 Ga0209760_10006776 240
209 3300025224 Ga0209784_100012 Ga0209784_10001253 240
210 3300025225 Ga0209566_100010 Ga0209566_10001053 240
211 3300025226 Ga0209674_100023 Ga0209674_10002353 240
212 3300025230 Ga0209563_100027 Ga0209563_10002753 240
213 3300025231 Ga0207427_100017 Ga0207427_10001753 240
214 3300025233 Ga0209437_100029 Ga0209437_10002953 240
215 3300025253 Ga0209677_100014 Ga0209677_10001453 240
216 3300025261 Ga0209233_1000433 Ga0209233_100043321 240
217 3300025711 Ga0207696_1000015 Ga0207696_100001581 240
218 3300025711 Ga0207696_1000303 Ga0207696_100030325 240
219 3300025728 Ga0207655_1000484 Ga0207655_100048424 240
220 3300025728 Ga0207655_1006558 Ga0207655_10065586 240
221 3300025728 Ga0207655_1013016 Ga0207655_10130167 240
222 3300025735 Ga0207713_1037473 Ga0207713_10374733 240
223 3300025900 Ga0207710_10000224 Ga0207710_1000022438 240
224 3300025931 Ga0207644_10001232 Ga0207644_100012325 240
225 3300025972 Ga0207668_10168988 Ga0207668_101689882 240
226 3300026088 Ga0207641_10067553 Ga0207641_100675532 240
227 3300027312 Ga0209371_1029976 Ga0209371_10299762 240
228 3300030500 Ga0268256_1034122 Ga0268256_10341222 240
229 3300041491 Ga0451833_0675184 Ga0451833_0675184_597_1379 240
230 3300042006 Ga0439432_010899 Ga0439432_010899_1461_2198 240
231 3300046471 Ga0495650_0000052 Ga0495650_0000052_33403_34125 240
232 3300046810 Ga0495660_0000006 Ga0495660_0000006_31060_31782 240
233 3300048907 Ga0496104_0000400 Ga0496104_0000400_36552_37274 240
234 3300048919 Ga0496116_0000020 Ga0496116_0000020_45367_46089 240
235 3300048919 Ga0496116_0000308 Ga0496116_0000308_23969_24706 240
236 3300048920 Ga0496117_0001038 Ga0496117_0001038_38778_39515 240
237 3300048920 Ga0496117_0007425 Ga0496117_0007425_8774_9496 240
238 3300048920 Ga0496117_0028309 Ga0496117_0028309_3476_4315 240
239 3300048921 Ga0496118_0000048 Ga0496118_0000048_236205_237044 240
240 3300048921 Ga0496118_0003859 Ga0496118_0003859_14105_14842 240
241 3300048921 Ga0496118_0028756 Ga0496118_0028756_3030_3761 240
242 3300048921 Ga0496118_0074116 Ga0496118_0074116_642_1364 240
243 3300048922 Ga0496119_0065322 Ga0496119_0065322_1340_2062 240
244 3300048923 Ga0496120_0076328 Ga0496120_0076328_509_1231 240
245 3300048925 Ga0496122_0000010 Ga0496122_0000010_273688_274410 240
246 3300048926 Ga0496123_0000025 Ga0496123_0000025_266097_266819 240
247 3300048927 Ga0496124_0000042 Ga0496124_0000042_62083_62805 240
248 3300048928 Ga0496125_0000054 Ga0496125_0000054_100923_101645 240
249 3300048929 Ga0496126_0000218 Ga0496126_0000218_44155_44877 240
250 iso_pu_bacteria 640753048 640937869 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04029

2-ph_phosp

2-phosphosulpholactate phosphatase

57

273

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vr0-assembly1.cif.gz_A crystal structure of putative 2-phosphosulfolactate phosphatase (15026306) from clostridium acetobutylicum at 2.6 a resolution 0.8511 11 236
2z0j-assembly3.cif.gz_F crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 0.8413 11 239
1vr0-assembly1.cif.gz_A crystal structure of putative 2-phosphosulfolactate phosphatase (15026306) from clostridium acetobutylicum at 2.6 a resolution 0.8143 11 236
2yzo-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermotoga maritima 0.8137 12 239
2z0j-assembly3.cif.gz_F crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 0.812 11 239
ID Description Score Start End Superfamily
1vr0B00 Alpha Beta;Alpha-Beta Complex;putative 2-phosphosulfolactate phosphatase;ComB-like 0.8496 11 236 3.90.1560.10
2z0jF00 Alpha Beta;Alpha-Beta Complex;putative 2-phosphosulfolactate phosphatase;ComB-like 0.8413 11 239 3.90.1560.10
1vr0B00 Alpha Beta;Alpha-Beta Complex;putative 2-phosphosulfolactate phosphatase;ComB-like 0.8392 11 236 3.90.1560.10
af_Q58540_5_221_3.90.1560.10 Alpha Beta;Alpha-Beta Complex;putative 2-phosphosulfolactate phosphatase;ComB-like 0.8302 27 237 3.90.1560.10
2yyvA00 Alpha Beta;Alpha-Beta Complex;putative 2-phosphosulfolactate phosphatase;ComB-like 0.8222 12 239 3.90.1560.10
ID Description Score Start End GO Terms
AF-H2J268-F1-model_v4 Probable 2-phosphosulfolactate phosphatase (EC 3.1.3.71) 0.9991 1 240 GO:0000287
GO:0050532
GO:0050545
AF-A0A7V8G1L4-F1-model_v4 Probable 2-phosphosulfolactate phosphatase 0.9789 1 240 GO:0000287
GO:0005886
GO:0050532
AF-A0A7V8G1L4-F1-model_v4 Probable 2-phosphosulfolactate phosphatase 0.9749 1 240 GO:0000287
GO:0005886
GO:0050532
AF-A0A7Z1ZID8-F1-model_v4 deleted 0.9683 34 239
AF-A0A849IK23-F1-model_v4 Probable 2-phosphosulfolactate phosphatase (EC 3.1.3.71) 0.9661 6 240 GO:0000287
GO:0050532
GO:0050545

Feature Viewer

pLDDT pTM Quality
94.8 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map