F361823

General Info

Members Datasets Scaffolds Average Seq Length
250 157 500 119

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0591715|Ga0495592_0591715_26_445
Length 139
Sequence VAQTQSAQHCPLNRPLKRGQDLSAEDVDEYLRRIEEPKRSTLEALRRTILEIVPDAEQVISYKVPAFRVDSQIVAGFAAFKDHLSYLPFSGSVLPELAGELEGYTMTKSALHFPVDRPLPKTLVRKLIAARRSKAAIRH

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
48 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
49 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
50 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
51 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
54 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
68 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
69 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
70 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
82 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
83 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
84 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
85 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
86 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
87 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
88 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
89 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.8
Rhizosphere 82.4
Stem 0
Stem Tuber 0
Unclassified 27.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0591715 3300046454 Bacteria 677
2 Ga0070683_100273208 3300005329 Bacteria 1608
3 Ga0070683_100296401 3300005329 Bacteria 1538
4 Ga0070682_100572940 3300005337 Bacteria 887
5 Ga0068868_101019240 3300005338 Bacteria 758
6 Ga0070671_100664962 3300005355 Unclassified 902
7 Ga0070710_11225745 3300005437 Bacteria 555
8 Ga0070708_100460628 3300005445 Unclassified 1199
9 Ga0070678_100110182 3300005456 Bacteria 2153
10 Ga0070678_101298602 3300005456 Bacteria 677
11 Ga0070706_100914814 3300005467 Bacteria 810
12 Ga0070707_100193205 3300005468 Bacteria 1985
13 Ga0070707_100436379 3300005468 Bacteria 1270
14 Ga0070698_101153456 3300005471 Bacteria 724
15 Ga0070699_100260444 3300005518 Bacteria 1551
16 Ga0070684_100975401 3300005535 Unclassified 795
17 Ga0068856_100361368 3300005614 Unclassified 1470
18 Ga0068859_101286125 3300005617 Bacteria 806
19 Ga0068863_102038257 3300005841 Unclassified 584
20 Ga0081455_10647323 3300005937 Bacteria 681
21 Ga0070712_100711508 3300006175 Unclassified 857
22 Ga0070712_100826801 3300006175 Unclassified 796
23 Ga0097621_101277882 3300006237 Unclassified 693
24 Ga0068865_100509966 3300006881 Bacteria 1004
25 Ga0068865_101809156 3300006881 Unclassified 552
26 Ga0097620_101286379 3300006931 Bacteria 806
27 Ga0105245_10794837 3300009098 Unclassified 984
28 Ga0105245_10853874 3300009098 Bacteria 950
29 Ga0105243_11011585 3300009148 Bacteria 834
30 Ga0105243_11451949 3300009148 Unclassified 708
31 Ga0105242_10180951 3300009176 Bacteria 1860
32 Ga0105248_10594530 3300009177 Bacteria 1249
33 Ga0105248_11683331 3300009177 Bacteria 719
34 Ga0105246_10622297 3300011119 Bacteria 936
35 Ga0157374_10362736 3300013296 Bacteria 1441
36 Ga0157378_10861189 3300013297 Bacteria 935
37 Ga0157372_10996239 3300013307 Bacteria 971
38 Ga0157375_10093016 3300013308 Bacteria 3080
39 Ga0157375_10988681 3300013308 Bacteria 982
40 Ga0157380_12527942 3300014326 Unclassified 579
41 Ga0157379_11027692 3300014968 Bacteria 787
42 Ga0213874_10104126 3300021377 Unclassified 947
43 Ga0213876_10054250 3300021384 Bacteria 2116
44 Ga0213876_10075489 3300021384 Bacteria 1780
45 Ga0207684_10391259 3300025910 Bacteria 1195
46 Ga0207693_10469113 3300025915 Unclassified 983
47 Ga0207646_10225498 3300025922 Bacteria 1693
48 Ga0207644_10603122 3300025931 Unclassified 912
49 Ga0207686_10959614 3300025934 Bacteria 692
50 Ga0207709_11285526 3300025935 Unclassified 604
51 Ga0207670_10840960 3300025936 Bacteria 766
52 Ga0207704_10442955 3300025938 Bacteria 1035
53 Ga0207677_11052802 3300026023 Bacteria 740
54 Ga0207702_10366889 3300026078 Unclassified 1381
55 Ga0207702_10665430 3300026078 Unclassified 1025
56 Ga0207648_11251373 3300026089 Bacteria 697
57 Ga0207683_10142650 3300026121 Bacteria 2159
58 Ga0265319_1121647 3300028563 Bacteria 813
59 Ga0265319_1195862 3300028563 Unclassified 620
60 Ga0265319_1242985 3300028563 Unclassified 549
61 Ga0265334_10001115 3300028573 Bacteria 13121
62 Ga0265318_10000065 3300028577 Bacteria 102014
63 Ga0265318_10169525 3300028577 Unclassified 800
64 Ga0265322_10092250 3300028654 Bacteria 861
65 Ga0265336_10003492 3300028666 Bacteria 6150
66 Ga0265336_10016418 3300028666 Bacteria 2421
67 Ga0265338_10014383 3300028800 Bacteria 8808
68 Ga0265338_10035412 3300028800 Bacteria 4799
69 Ga0265338_10280920 3300028800 Bacteria 1216
70 Ga0265324_10023078 3300029957 Unclassified 2219
71 Ga0265324_10048729 3300029957 Bacteria 1457
72 Ga0265330_10000243 3300031235 Bacteria 41099
73 Ga0265332_10407561 3300031238 Unclassified 561
74 Ga0265328_10011660 3300031239 Bacteria 3507
75 Ga0265320_10060223 3300031240 Unclassified 1813
76 Ga0265320_10133471 3300031240 Unclassified 1127
77 Ga0265325_10000223 3300031241 Bacteria 40168
78 Ga0265329_10004362 3300031242 Bacteria 5900
79 Ga0265331_10474350 3300031250 Unclassified 562
80 Ga0265327_10016852 3300031251 Bacteria 4617
81 Ga0265316_10019517 3300031344 Bacteria 5795
82 Ga0265313_10001055 3300031595 Bacteria 26812
83 Ga0265314_10001513 3300031711 Bacteria 25737
84 Ga0265342_10002347 3300031712 Bacteria 16427
85 Ga0373945_0008269 3300035116 Bacteria 3385
86 Ga0373957_0204394 3300035120 Unclassified 824
87 Ga0373943_0002178 3300035170 Bacteria 8910
88 Ga0373943_0848900 3300035170 Unclassified 544
89 Ga0373946_0029380 3300035171 Bacteria 2187
90 Ga0373935_0046909 3300035692 Unclassified 2730
91 Ga0373947_0002918 3300035725 Bacteria 10206
92 Ga0373925_0007370 3300037068 Bacteria 8026
93 Ga0395899_0024943 3300037312 Bacteria 4516
94 Ga0395900_1299114 3300037418 Bacteria 642
95 Ga0395898_0042286 3300037466 Bacteria 4497
96 Ga0395905_0052057 3300037471 Bacteria 3834
97 Ga0436364_1382793 3300037853 Bacteria 14617
98 Ga0395901_0072456 3300038443 Bacteria 3591
99 Ga0436365_0537608 3300039437 Bacteria 4296
100 Ga0436365_1621669 3300039437 Bacteria 2982
101 Ga0436363_0979902 3300039450 Bacteria 14761
102 Ga0451789_1176336 3300041443 Bacteria 1070
103 Ga0451793_0093763 3300041452 Bacteria 1670
104 Ga0451793_0484534 3300041452 Bacteria 548
105 Ga0451802_1666544 3300041460 Bacteria 845
106 Ga0451804_0266220 3300041463 Bacteria 2186
107 Ga0451807_1654872 3300041486 Unclassified 849
108 Ga0451807_1718060 3300041486 Bacteria 988
109 Ga0451807_2586833 3300041486 Bacteria 630
110 Ga0451839_1617211 3300041496 Bacteria 535
111 Ga0451845_0192052 3300041501 Bacteria 2887
112 Ga0451851_1007477 3300041507 Bacteria 3637
113 Ga0451843_1171998 3300041509 Unclassified 1868
114 Ga0451853_2521774 3300041512 Bacteria 1093
115 Ga0466965_0005785 3300044683 Bacteria 5580
116 Ga0466966_0011293 3300044684 Bacteria 5926
117 Ga0466966_1006294 3300044684 Unclassified 503
118 Ga0466961_0217076 3300044693 Unclassified 1179
119 Ga0466963_0007496 3300044694 Bacteria 6510
120 Ga0466963_0109508 3300044694 Bacteria 1895
121 Ga0466964_0054872 3300044706 Unclassified 1644
122 Ga0466964_0115673 3300044706 Bacteria 1202
123 Ga0466964_0128560 3300044706 Bacteria 1151
124 Ga0466964_0133168 3300044706 Bacteria 1134
125 Ga0466971_0104277 3300044719 Bacteria 1305
126 Ga0466971_0549435 3300044719 Unclassified 573
127 Ga0466957_0000995 3300044842 Bacteria 14563
128 Ga0466959_0002338 3300045049 Bacteria 12107
129 Ga0466959_0011505 3300045049 Bacteria 6360
130 Ga0466958_0000797 3300045836 Bacteria 13889
131 Ga0466967_0008816 3300045976 Bacteria 7433
132 Ga0466967_0044795 3300045976 Bacteria 3840
133 Ga0466967_0240441 3300045976 Unclassified 1727
134 Ga0466967_0745345 3300045976 Bacteria 971
135 Ga0466967_0779074 3300045976 Bacteria 949
136 Ga0466967_0861060 3300045976 Bacteria 901
137 Ga0466967_1111782 3300045976 Bacteria 787
138 Ga0466967_1695484 3300045976 Bacteria 629
139 Ga0495629_0000319 3300046459 Bacteria 41153
140 Ga0495629_0065276 3300046459 Bacteria 2541
141 Ga0495641_0268417 3300046461 Bacteria 768
142 Ga0495641_0586566 3300046461 Unclassified 509
143 Ga0495651_0002835 3300046462 Bacteria 13428
144 Ga0495651_0226292 3300046462 Archaea 1291
145 Ga0495651_0696116 3300046462 Unclassified 634
146 Ga0495653_0023204 3300046463 Bacteria 5017
147 Ga0495653_0059374 3300046463 Bacteria 2903
148 Ga0495653_0081526 3300046463 Bacteria 2391
149 Ga0495580_0187651 3300046472 Bacteria 1427
150 Ga0495582_0000358 3300046473 Bacteria 24948
151 Ga0495582_0587781 3300046473 Bacteria 644
152 Ga0495639_0003560 3300046475 Bacteria 6719
153 Ga0495662_0002342 3300046476 Bacteria 9543
154 Ga0495662_0359546 3300046476 Bacteria 716
155 Ga0495664_0642888 3300046477 Bacteria 629
156 Ga0495608_0016890 3300046511 Bacteria 5052
157 Ga0495608_0212070 3300046511 Bacteria 1217
158 Ga0495618_0073600 3300046514 Unclassified 2175
159 Ga0495618_0221949 3300046514 Bacteria 1192
160 Ga0495618_0223458 3300046514 Bacteria 1187
161 Ga0495628_0524738 3300046516 Bacteria 853
162 Ga0495628_0717968 3300046516 Bacteria 705
163 Ga0495630_0009737 3300046517 Bacteria 6913
164 Ga0495630_0015470 3300046517 Bacteria 5571
165 Ga0495630_0666004 3300046517 Bacteria 797
166 Ga0495630_1338178 3300046517 Unclassified 539
167 Ga0495652_0102486 3300046529 Unclassified 2319
168 Ga0495652_0341276 3300046529 Unclassified 1076
169 Ga0495652_0747252 3300046529 Unclassified 655
170 Ga0495665_0000240 3300046531 Bacteria 27586
171 Ga0495640_0008426 3300046533 Bacteria 8088
172 Ga0495640_0043017 3300046533 Bacteria 3148
173 Ga0495640_0126092 3300046533 Unclassified 1660
174 Ga0495645_0125325 3300046543 Bacteria 1805
175 Ga0495633_0463219 3300046558 Unclassified 572
176 Ga0495667_0005716 3300046559 Bacteria 8421
177 Ga0495667_0010723 3300046559 Bacteria 6197
178 Ga0495667_0235405 3300046559 Unclassified 1167
179 Ga0495656_0081053 3300046615 Bacteria 1465
180 Ga0495656_0233781 3300046615 Bacteria 923
181 Ga0495634_0029178 3300046642 Bacteria 3820
182 Ga0495634_0107554 3300046642 Unclassified 1796
183 Ga0495634_0109716 3300046642 Bacteria 1775
184 Ga0495635_0010844 3300046663 Bacteria 6386
185 Ga0495635_0034906 3300046663 Bacteria 3488
186 Ga0495635_0328820 3300046663 Unclassified 1022
187 Ga0495588_0471008 3300046674 Unclassified 659
188 Ga0495657_0479658 3300046675 Bacteria 726
189 Ga0495657_0731111 3300046675 Bacteria 568
190 Ga0495599_0252720 3300046678 Bacteria 1072
191 Ga0495646_0242168 3300046680 Archaea 969
192 Ga0495647_0001162 3300046681 Bacteria 8091
193 Ga0495658_0123735 3300046683 Bacteria 1567
194 Ga0495613_0006397 3300046689 Bacteria 8801
195 Ga0495613_0253308 3300046689 Unclassified 1228
196 Ga0495613_0931082 3300046689 Unclassified 561
197 Ga0495624_0039505 3300046690 Bacteria 3025
198 Ga0495600_0029837 3300046809 Bacteria 3533
199 Ga0495600_0442562 3300046809 Unclassified 804
200 Ga0495600_0758263 3300046809 Unclassified 580
201 Ga0495581_0000481 3300047315 Bacteria 20285
202 Ga0495581_0359115 3300047315 Bacteria 850
203 Ga0495604_0229946 3300047317 Unclassified 1272
204 Ga0495604_0302564 3300047317 Bacteria 1074
205 Ga0495674_0014675 3300047319 Bacteria 7330
206 Ga0495674_0022126 3300047319 Bacteria 5867
207 Ga0495674_0042709 3300047319 Bacteria 4042
208 Ga0495674_0248003 3300047319 Unclassified 1466
209 Ga0495674_1463283 3300047319 Bacteria 507
210 Ga0495676_0006828 3300047321 Bacteria 10494
211 Ga0495676_0196769 3300047321 Bacteria 1403
212 Ga0495680_0004682 3300047322 Bacteria 13034
213 Ga0495680_0012126 3300047322 Bacteria 7605
214 Ga0495680_0012722 3300047322 Bacteria 7386
215 Ga0495684_0009739 3300047471 Bacteria 7414
216 Ga0495684_0014056 3300047471 Bacteria 6157
217 Ga0495593_0013109 3300047673 Bacteria 4732
218 Ga0495602_0177953 3300048088 Bacteria 1644
219 Ga0495614_0002914 3300048089 Bacteria 7623
220 Ga0496100_0010905 3300048903 Bacteria 5159
221 Ga0496101_0420837 3300048904 Bacteria 1053
222 Ga0496101_1627866 3300048904 Unclassified 501
223 Ga0496104_0084941 3300048907 Unclassified 3021
224 Ga0496104_1061695 3300048907 Unclassified 714
225 Ga0496105_0006413 3300048908 Bacteria 9044
226 Ga0496105_0205672 3300048908 Bacteria 1606
227 Ga0496105_0217434 3300048908 Unclassified 1556
228 Ga0496105_0430189 3300048908 Unclassified 1044
229 Ga0496107_1275113 3300048910 Unclassified 526
230 Ga0496108_0034214 3300048911 Bacteria 4221
231 Ga0496108_1517383 3300048911 Unclassified 557
232 Ga0496109_0140853 3300048912 Bacteria 2255
233 Ga0496109_0937190 3300048912 Bacteria 804
234 Ga0496110_0132484 3300048913 Bacteria 2251
235 Ga0496110_0210681 3300048913 Bacteria 1767
236 Ga0496110_1873133 3300048913 Unclassified 510
237 Ga0496111_0505184 3300048914 Unclassified 890
238 Ga0496112_0795938 3300048915 Bacteria 870
239 Ga0496113_0108130 3300048916 Bacteria 2162
240 Ga0496114_0072167 3300048917 Bacteria 2903
241 Ga0496114_0548721 3300048917 Bacteria 1021
242 Ga0496114_0789138 3300048917 Bacteria 828
243 Ga0496115_0098544 3300048918 Unclassified 2394
244 Ga0495601_0028490 3300053077 Bacteria 3459
245 Ga0495601_0890630 3300053077 Unclassified 562
246 Ga0495612_0145776 3300053078 Archaea 1028
247 Ga0495619_0002144 3300053085 Bacteria 13101
248 Ga0495619_0007014 3300053085 Bacteria 7129
249 Ga0466962_0059347 3300061719 Unclassified 1826
250 Ga0466962_0281576 3300061719 Unclassified 821
251 Ga0495592_0591715
252 Ga0070683_100273208
253 Ga0070683_100296401
254 Ga0070682_100572940
255 Ga0068868_101019240
256 Ga0070671_100664962
257 Ga0070710_11225745
258 Ga0070708_100460628
259 Ga0070678_100110182
260 Ga0070678_101298602
261 Ga0070706_100914814
262 Ga0070707_100193205
263 Ga0070707_100436379
264 Ga0070698_101153456
265 Ga0070699_100260444
266 Ga0070684_100975401
267 Ga0068856_100361368
268 Ga0068859_101286125
269 Ga0068863_102038257
270 Ga0081455_10647323
271 Ga0070712_100711508
272 Ga0070712_100826801
273 Ga0097621_101277882
274 Ga0068865_100509966
275 Ga0068865_101809156
276 Ga0097620_101286379
277 Ga0105245_10794837
278 Ga0105245_10853874
279 Ga0105243_11011585
280 Ga0105243_11451949
281 Ga0105242_10180951
282 Ga0105248_10594530
283 Ga0105248_11683331
284 Ga0105246_10622297
285 Ga0157374_10362736
286 Ga0157378_10861189
287 Ga0157372_10996239
288 Ga0157375_10093016
289 Ga0157375_10988681
290 Ga0157380_12527942
291 Ga0157379_11027692
292 Ga0213874_10104126
293 Ga0213876_10054250
294 Ga0213876_10075489
295 Ga0207684_10391259
296 Ga0207693_10469113
297 Ga0207646_10225498
298 Ga0207644_10603122
299 Ga0207686_10959614
300 Ga0207709_11285526
301 Ga0207670_10840960
302 Ga0207704_10442955
303 Ga0207677_11052802
304 Ga0207702_10366889
305 Ga0207702_10665430
306 Ga0207648_11251373
307 Ga0207683_10142650
308 Ga0265319_1121647
309 Ga0265319_1195862
310 Ga0265319_1242985
311 Ga0265334_10001115
312 Ga0265318_10000065
313 Ga0265318_10169525
314 Ga0265322_10092250
315 Ga0265336_10003492
316 Ga0265336_10016418
317 Ga0265338_10014383
318 Ga0265338_10035412
319 Ga0265338_10280920
320 Ga0265324_10023078
321 Ga0265324_10048729
322 Ga0265330_10000243
323 Ga0265332_10407561
324 Ga0265328_10011660
325 Ga0265320_10060223
326 Ga0265320_10133471
327 Ga0265325_10000223
328 Ga0265329_10004362
329 Ga0265331_10474350
330 Ga0265327_10016852
331 Ga0265316_10019517
332 Ga0265313_10001055
333 Ga0265314_10001513
334 Ga0265342_10002347
335 Ga0373945_0008269
336 Ga0373957_0204394
337 Ga0373943_0002178
338 Ga0373943_0848900
339 Ga0373946_0029380
340 Ga0373935_0046909
341 Ga0373947_0002918
342 Ga0373925_0007370
343 Ga0395899_0024943
344 Ga0395900_1299114
345 Ga0395898_0042286
346 Ga0395905_0052057
347 Ga0436364_1382793
348 Ga0395901_0072456
349 Ga0436365_0537608
350 Ga0436365_1621669
351 Ga0436363_0979902
352 Ga0451789_1176336
353 Ga0451793_0093763
354 Ga0451793_0484534
355 Ga0451802_1666544
356 Ga0451804_0266220
357 Ga0451807_1654872
358 Ga0451807_1718060
359 Ga0451807_2586833
360 Ga0451839_1617211
361 Ga0451845_0192052
362 Ga0451851_1007477
363 Ga0451843_1171998
364 Ga0451853_2521774
365 Ga0466965_0005785
366 Ga0466966_0011293
367 Ga0466966_1006294
368 Ga0466961_0217076
369 Ga0466963_0007496
370 Ga0466963_0109508
371 Ga0466964_0054872
372 Ga0466964_0115673
373 Ga0466964_0128560
374 Ga0466964_0133168
375 Ga0466971_0104277
376 Ga0466971_0549435
377 Ga0466957_0000995
378 Ga0466959_0002338
379 Ga0466959_0011505
380 Ga0466958_0000797
381 Ga0466967_0008816
382 Ga0466967_0044795
383 Ga0466967_0240441
384 Ga0466967_0745345
385 Ga0466967_0779074
386 Ga0466967_0861060
387 Ga0466967_1111782
388 Ga0466967_1695484
389 Ga0495629_0000319
390 Ga0495629_0065276
391 Ga0495641_0268417
392 Ga0495641_0586566
393 Ga0495651_0002835
394 Ga0495651_0226292
395 Ga0495651_0696116
396 Ga0495653_0023204
397 Ga0495653_0059374
398 Ga0495653_0081526
399 Ga0495580_0187651
400 Ga0495582_0000358
401 Ga0495582_0587781
402 Ga0495639_0003560
403 Ga0495662_0002342
404 Ga0495662_0359546
405 Ga0495664_0642888
406 Ga0495608_0016890
407 Ga0495608_0212070
408 Ga0495618_0073600
409 Ga0495618_0221949
410 Ga0495618_0223458
411 Ga0495628_0524738
412 Ga0495628_0717968
413 Ga0495630_0009737
414 Ga0495630_0015470
415 Ga0495630_0666004
416 Ga0495630_1338178
417 Ga0495652_0102486
418 Ga0495652_0341276
419 Ga0495652_0747252
420 Ga0495665_0000240
421 Ga0495640_0008426
422 Ga0495640_0043017
423 Ga0495640_0126092
424 Ga0495645_0125325
425 Ga0495633_0463219
426 Ga0495667_0005716
427 Ga0495667_0010723
428 Ga0495667_0235405
429 Ga0495656_0081053
430 Ga0495656_0233781
431 Ga0495634_0029178
432 Ga0495634_0107554
433 Ga0495634_0109716
434 Ga0495635_0010844
435 Ga0495635_0034906
436 Ga0495635_0328820
437 Ga0495588_0471008
438 Ga0495657_0479658
439 Ga0495657_0731111
440 Ga0495599_0252720
441 Ga0495646_0242168
442 Ga0495647_0001162
443 Ga0495658_0123735
444 Ga0495613_0006397
445 Ga0495613_0253308
446 Ga0495613_0931082
447 Ga0495624_0039505
448 Ga0495600_0029837
449 Ga0495600_0442562
450 Ga0495600_0758263
451 Ga0495581_0000481
452 Ga0495581_0359115
453 Ga0495604_0229946
454 Ga0495604_0302564
455 Ga0495674_0014675
456 Ga0495674_0022126
457 Ga0495674_0042709
458 Ga0495674_0248003
459 Ga0495674_1463283
460 Ga0495676_0006828
461 Ga0495676_0196769
462 Ga0495680_0004682
463 Ga0495680_0012126
464 Ga0495680_0012722
465 Ga0495684_0009739
466 Ga0495684_0014056
467 Ga0495593_0013109
468 Ga0495602_0177953
469 Ga0495614_0002914
470 Ga0496100_0010905
471 Ga0496101_0420837
472 Ga0496101_1627866
473 Ga0496104_0084941
474 Ga0496104_1061695
475 Ga0496105_0006413
476 Ga0496105_0205672
477 Ga0496105_0217434
478 Ga0496105_0430189
479 Ga0496107_1275113
480 Ga0496108_0034214
481 Ga0496108_1517383
482 Ga0496109_0140853
483 Ga0496109_0937190
484 Ga0496110_0132484
485 Ga0496110_0210681
486 Ga0496110_1873133
487 Ga0496111_0505184
488 Ga0496112_0795938
489 Ga0496113_0108130
490 Ga0496114_0072167
491 Ga0496114_0548721
492 Ga0496114_0789138
493 Ga0496115_0098544
494 Ga0495601_0028490
495 Ga0495601_0890630
496 Ga0495612_0145776
497 Ga0495619_0002144
498 Ga0495619_0007014
499 Ga0466962_0059347
500 Ga0466962_0281576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

38

131

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.899 5 113
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.8519 1 115
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.8483 5 113
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.8454 1 115
6ezd-assembly1.cif.gz_C pyrrolysyl-trna synthetase from canditatus methanomethylophilus alvus (mmapylrs) 0.6456 12 60
ID Description Score Start End Superfamily
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8828 5 115 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8611 5 115 3.90.1150.200
2i8dB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.755 6 63 3.90.1150.200
af_A0A1D6M2U7_21_185_2.40.160.200 Mainly Beta;Beta Barrel;Porin;LURP1-related 0.7537 35 67 2.40.160.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7399 4 111 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A6J7SQP9-F1-model_v4 Unannotated protein 0.9994 1 110
AF-A0A6J6PT43-F1-model_v4 Unannotated protein 0.9966 1 114
AF-A0A7K0YAM5-F1-model_v4 DUF1801 domain-containing protein 0.9962 6 115
AF-A0A535QLP8-F1-model_v4 DUF1801 domain-containing protein 0.995 2 114
AF-A0A6J6I995-F1-model_v4 Unannotated protein 0.9939 2 114

Map