F361729

General Info

Members Datasets Scaffolds Average Seq Length
250 136 250 131

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0128753|Ga0316584_0128753_212_676
Length 154
Sequence MLAVSACSLVAYPPQYPSKGETMKNIPEDFQDLFEDETKAFLFLATVMADGSPQVTPIWFNTDGEHILINSAKGRVKDRNLRARPQVAVAIMDPADPYRYIQLRGEVVEITEEGAREHIDALSLKYLGDPVYSGPPDQIRVTYKILPKRVDAHP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
77 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
80 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
95 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.4
Rhizosphere 98.8
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_987143 2162886007 Bacteria 6647
2 Ga0065704_10000291 3300005289 Bacteria 52676
3 Ga0065704_10089291 3300005289 Bacteria 2870
4 Ga0065704_10116935 3300005289 Bacteria 1841
5 Ga0065704_10134767 3300005289 Bacteria 1584
6 Ga0065704_10473335 3300005289 Bacteria 593
7 Ga0065712_10108797 3300005290 Bacteria 1867
8 Ga0065707_10000435 3300005295 Bacteria 91033
9 Ga0065707_10003021 3300005295 Bacteria 5035
10 Ga0065707_10101097 3300005295 Bacteria 2885
11 Ga0065707_10444767 3300005295 Unclassified 806
12 Ga0065707_10588196 3300005295 Unclassified 697
13 Ga0065707_10621946 3300005295 Bacteria 678
14 Ga0070690_100556660 3300005330 Bacteria 865
15 Ga0070670_100359998 3300005331 Bacteria 1279
16 Ga0070666_10244629 3300005335 Unclassified 1269
17 Ga0070666_11350880 3300005335 Unclassified 532
18 Ga0070680_101069021 3300005336 Unclassified 697
19 Ga0070691_10295477 3300005341 Unclassified 883
20 Ga0070692_11151247 3300005345 Bacteria 550
21 Ga0070675_100658784 3300005354 Bacteria 952
22 Ga0070688_100862113 3300005365 Unclassified 712
23 Ga0070705_100059619 3300005440 Bacteria 2261
24 Ga0070694_101907674 3300005444 Unclassified 507
25 Ga0070707_100287231 3300005468 Unclassified 1598
26 Ga0070707_101081043 3300005468 Bacteria 768
27 Ga0070698_100079473 3300005471 Bacteria 3276
28 Ga0070698_100133046 3300005471 Bacteria 2441
29 Ga0070698_100262170 3300005471 Bacteria 1660
30 Ga0070698_100592784 3300005471 Unclassified 1048
31 Ga0070698_102067071 3300005471 Unclassified 523
32 Ga0070699_100007775 3300005518 Bacteria 9319
33 Ga0070699_100029133 3300005518 Bacteria 4761
34 Ga0070699_100166840 3300005518 Bacteria 1950
35 Ga0070699_100179750 3300005518 Bacteria 1877
36 Ga0070699_100376740 3300005518 Bacteria 1281
37 Ga0070679_100020609 3300005530 Bacteria 6429
38 Ga0070697_100373573 3300005536 Bacteria 1234
39 Ga0070686_100512737 3300005544 Bacteria 932
40 Ga0070695_100252673 3300005545 Bacteria 1284
41 Ga0070696_100042840 3300005546 Unclassified 3130
42 Ga0070665_101901120 3300005548 Bacteria 601
43 Ga0070704_100376696 3300005549 Unclassified 1205
44 Ga0070704_100406398 3300005549 Unclassified 1163
45 Ga0068855_100241342 3300005563 Unclassified 2019
46 Ga0068857_100133922 3300005577 Bacteria 2237
47 Ga0070702_100056500 3300005615 Bacteria 2267
48 Ga0068864_100944277 3300005618 Unclassified 853
49 Ga0068861_100199849 3300005719 Bacteria 1677
50 Ga0068870_10146352 3300005840 Unclassified 1387
51 Ga0068870_11067232 3300005840 Bacteria 579
52 Ga0068863_101255609 3300005841 Unclassified 747
53 Ga0068860_101352786 3300005843 Unclassified 733
54 Ga0068862_100436569 3300005844 Bacteria 1232
55 Ga0081539_10013770 3300005985 Bacteria 6062
56 Ga0081539_10037730 3300005985 Unclassified 2874
57 Ga0075427_10000411 3300006194 Bacteria 4846
58 Ga0097621_100182673 3300006237 Unclassified 1813
59 Ga0068871_100092377 3300006358 Unclassified 2524
60 Ga0075430_100124706 3300006846 Unclassified 2147
61 Ga0075431_100054484 3300006847 Bacteria 4124
62 Ga0075431_100067919 3300006847 Bacteria 3680
63 Ga0075431_101596119 3300006847 Bacteria 610
64 Ga0075433_10175606 3300006852 Bacteria 1906
65 Ga0075434_102331073 3300006871 Unclassified 538
66 Ga0075429_100042465 3300006880 Bacteria 3957
67 Ga0075429_100299565 3300006880 Bacteria 1408
68 Ga0075429_101572701 3300006880 Unclassified 572
69 Ga0105240_10750137 3300009093 Bacteria 1061
70 Ga0105245_10765027 3300009098 Bacteria 1002
71 Ga0114129_10005862 3300009147 Bacteria 17393
72 Ga0114129_11292209 3300009147 Bacteria 905
73 Ga0114129_11454795 3300009147 Bacteria 844
74 Ga0114129_11806538 3300009147 Unclassified 743
75 Ga0105243_10035668 3300009148 Bacteria 3856
76 Ga0105243_12582896 3300009148 Bacteria 547
77 Ga0105242_10091760 3300009176 Unclassified 2558
78 Ga0105242_10127245 3300009176 Bacteria 2194
79 Ga0105242_10326232 3300009176 Unclassified 1410
80 Ga0105248_11081213 3300009177 Bacteria 906
81 Ga0105249_10221596 3300009553 Bacteria 1861
82 Ga0105249_10267294 3300009553 Bacteria 1702
83 Ga0157370_10857949 3300013104 Unclassified 825
84 Ga0157372_11291138 3300013307 Unclassified 842
85 Ga0163163_10220851 3300014325 Bacteria 1943
86 Ga0163163_10262692 3300014325 Unclassified 1777
87 Ga0157380_11813405 3300014326 Unclassified 669
88 Ga0207643_10364463 3300025908 Bacteria 909
89 Ga0207660_10913171 3300025917 Unclassified 716
90 Ga0207660_11350464 3300025917 Bacteria 578
91 Ga0207652_10032631 3300025921 Bacteria 4380
92 Ga0207646_10199190 3300025922 Unclassified 1809
93 Ga0207650_10457455 3300025925 Unclassified 1063
94 Ga0207659_10565505 3300025926 Bacteria 967
95 Ga0207700_11207146 3300025928 Unclassified 675
96 Ga0207686_10217503 3300025934 Bacteria 1377
97 Ga0207709_10669123 3300025935 Bacteria 828
98 Ga0207709_11192854 3300025935 Bacteria 627
99 Ga0207712_10313147 3300025961 Bacteria 1292
100 Ga0207712_11788102 3300025961 Bacteria 551
101 Ga0207676_10987502 3300026095 Unclassified 829
102 Ga0207676_11110990 3300026095 Unclassified 782
103 Ga0207676_11602393 3300026095 Bacteria 649
104 Ga0207674_10152364 3300026116 Bacteria 2268
105 Ga0207674_11764259 3300026116 Unclassified 586
106 Ga0207675_100185981 3300026118 Bacteria 1991
107 Ga0207675_100795827 3300026118 Bacteria 959
108 Ga0210000_1020013 3300027462 Bacteria 1020
109 Ga0209968_1024197 3300027526 Bacteria 996
110 Ga0268265_11357095 3300028380 Bacteria 712
111 Ga0265337_1009415 3300028556 Bacteria 3487
112 Ga0265334_10006582 3300028573 Bacteria 5000
113 Ga0265338_10024370 3300028800 Bacteria 6182
114 Ga0265327_10018855 3300031251 Bacteria 4261
115 Ga0265316_10815502 3300031344 Unclassified 654
116 Ga0307408_100604411 3300031548 Unclassified 975
117 Ga0316575_10002387 3300031665 Bacteria 6290
118 Ga0316575_10026355 3300031665 Bacteria 2259
119 Ga0316575_10026524 3300031665 Bacteria 2252
120 Ga0316579_10303412 3300031691 Unclassified 772
121 Ga0316579_10429295 3300031691 Unclassified 639
122 Ga0265314_10127228 3300031711 Bacteria 1594
123 Ga0316576_10034409 3300031727 Bacteria 3611
124 Ga0316576_10080448 3300031727 Bacteria 2417
125 Ga0316576_10529512 3300031727 Unclassified 865
126 Ga0316576_10532627 3300031727 Unclassified 862
127 Ga0316578_10118792 3300031728 Bacteria 1589
128 Ga0316578_10174786 3300031728 Unclassified 1294
129 Ga0307405_10095967 3300031731 Unclassified 1976
130 Ga0316577_10011392 3300031733 Bacteria 4815
131 Ga0316577_10041569 3300031733 Bacteria 2572
132 Ga0316577_10636709 3300031733 Unclassified 606
133 Ga0307413_11166061 3300031824 Unclassified 668
134 Ga0307410_10144268 3300031852 Bacteria 1765
135 Ga0307406_10814714 3300031901 Bacteria 789
136 Ga0307412_10637482 3300031911 Unclassified 907
137 Ga0307416_100134370 3300032002 Bacteria 2234
138 Ga0307411_10202470 3300032005 Unclassified 1526
139 Ga0307415_100211925 3300032126 Unclassified 1546
140 Ga0307415_101711135 3300032126 Unclassified 607
141 Ga0316585_10047457 3300032137 Bacteria 1375
142 Ga0373926_0428291 3300035083 Bacteria 524
143 Ga0373932_0035721 3300035112 Bacteria 1407
144 Ga0373956_0189614 3300035119 Bacteria 973
145 Ga0373961_0367128 3300035241 Unclassified 546
146 Ga0373962_0124528 3300035242 Bacteria 825
147 Ga0316574_0022093 3300035398 Bacteria 3786
148 Ga0316574_0130870 3300035398 Unclassified 1614
149 Ga0316574_0567928 3300035398 Unclassified 703
150 Ga0373937_0003701 3300036401 Bacteria 12916
151 Ga0316582_0004486 3300036647 Bacteria 7069
152 Ga0316582_0150185 3300036647 Bacteria 1575
153 Ga0316582_0574780 3300036647 Unclassified 776
154 Ga0316582_0747985 3300036647 Bacteria 671
155 Ga0316582_1002064 3300036647 Unclassified 570
156 Ga0316584_0003461 3300036712 Bacteria 10258
157 Ga0316584_0029911 3300036712 Bacteria 4022
158 Ga0316584_0070740 3300036712 Bacteria 2614
159 Ga0316584_0128753 3300036712 Bacteria 1891
160 Ga0316584_0363690 3300036712 Unclassified 1037
161 Ga0373925_0240687 3300037068 Unclassified 1449
162 Ga0373925_0452179 3300037068 Archaea 1052
163 Ga0316581_0026422 3300037588 Bacteria 1733
164 Ga0436360_0875102 3300039438 Bacteria 1581
165 Ga0436363_1524352 3300039450 Bacteria 2071
166 Ga0451791_0567397 3300041451 Unclassified 600
167 Ga0451853_3655376 3300041512 Unclassified 549
168 Ga0439435_0050235 3300042436 Bacteria 1192
169 Ga0451577_0122757 3300042876 Bacteria 2327
170 Ga0451577_0381241 3300042876 Bacteria 1279
171 Ga0451577_0521107 3300042876 Bacteria 1079
172 Ga0451577_0665152 3300042876 Unclassified 944
173 Ga0451577_1367959 3300042876 Unclassified 628
174 Ga0453683_0049391 3300044673 Bacteria 2637
175 Ga0453683_0064230 3300044673 Unclassified 2294
176 Ga0453683_0195658 3300044673 Unclassified 1283
177 Ga0453683_0484888 3300044673 Bacteria 801
178 Ga0453683_0690908 3300044673 Bacteria 668
179 Ga0453683_1107081 3300044673 Unclassified 528
180 Ga0453684_0000007 3300044712 Bacteria 1301482
181 Ga0453684_0000267 3300044712 Bacteria 225314
182 Ga0453684_0002372 3300044712 Bacteria 45994
183 Ga0453684_0003073 3300044712 Bacteria 38628
184 Ga0453684_0028705 3300044712 Bacteria 7925
185 Ga0453684_0038394 3300044712 Bacteria 6548
186 Ga0453684_0127381 3300044712 Bacteria 3062
187 Ga0453684_0137751 3300044712 Bacteria 2919
188 Ga0453684_0155919 3300044712 Bacteria 2708
189 Ga0453684_0158326 3300044712 Unclassified 2682
190 Ga0453684_0259363 3300044712 Unclassified 1992
191 Ga0453684_0297347 3300044712 Bacteria 1836
192 Ga0453684_0461688 3300044712 Unclassified 1412
193 Ga0453684_0563915 3300044712 Bacteria 1253
194 Ga0453684_1132711 3300044712 Unclassified 825
195 Ga0453684_1379491 3300044712 Unclassified 732
196 Ga0453684_1569414 3300044712 Unclassified 677
197 Ga0453684_2186570 3300044712 Unclassified 553
198 Ga0453684_2204209 3300044712 Unclassified 550
199 Ga0453684_2347449 3300044712 Unclassified 529
200 Ga0451576_0000058 3300045051 Bacteria 298769
201 Ga0451576_0002998 3300045051 Bacteria 23903
202 Ga0451576_0009104 3300045051 Bacteria 11552
203 Ga0451576_0016140 3300045051 Bacteria 8251
204 Ga0451576_0019566 3300045051 Bacteria 7388
205 Ga0451576_0024190 3300045051 Bacteria 6563
206 Ga0451576_0078728 3300045051 Bacteria 3430
207 Ga0451576_0309171 3300045051 Unclassified 1653
208 Ga0451576_0441809 3300045051 Bacteria 1365
209 Ga0451576_1644943 3300045051 Unclassified 666
210 Ga0495580_0902100 3300046472 Unclassified 568
211 Ga0495582_0053345 3300046473 Unclassified 2230
212 Ga0495665_0018562 3300046531 Bacteria 3737
213 Ga0495674_0704375 3300047319 Unclassified 792
214 Ga0501036_0297668 3300049572 Bacteria 1350
215 Ga0501041_0044611 3300049577 Bacteria 2695
216 Ga0501041_0326062 3300049577 Unclassified 969
217 Ga0501048_0321603 3300049582 Unclassified 1102
218 Ga0501071_0191406 3300049587 Unclassified 1534
219 Ga0501073_0780550 3300049589 Unclassified 659
220 Ga0501075_0110308 3300049591 Bacteria 2092
221 Ga0501076_0083434 3300049592 Bacteria 2566
222 Ga0501076_0420140 3300049592 Unclassified 1100
223 Ga0501076_0609550 3300049592 Unclassified 901
224 Ga0501077_0523204 3300049593 Unclassified 761
225 Ga0501233_111804 3300049668 Unclassified 731
226 Ga0501079_0403614 3300049741 Unclassified 1072
227 Ga0501080_0268336 3300049742 Bacteria 1554
228 Ga0501080_0341868 3300049742 Unclassified 1352
229 Ga0501081_0628250 3300049743 Unclassified 805
230 Ga0501081_0686344 3300049743 Unclassified 768
231 Ga0501045_0151923 3300049824 Unclassified 1723
232 nmdc:mga05p37_1515417_c1 3300050507 Unclassified 667
233 nmdc:mga05p37_26497_c1 3300050507 Bacteria 7051
234 nmdc:mga05p37_34090_c1 3300050507 Bacteria 6236
235 nmdc:mga09592_103143_c1 3300050508 Bacteria 2444
236 nmdc:mga09592_120670_c1 3300050508 Bacteria 2252
237 nmdc:mga09592_294119_c1 3300050508 Bacteria 1408
238 nmdc:mga09592_30213_c1 3300050508 Unclassified 4508
239 nmdc:mga0qj67_297643_c1 3300050509 Bacteria 1307
240 nmdc:mga0qj67_867278_c1 3300050509 Bacteria 712
241 nmdc:mga0qj67_91328_c1 3300050509 Unclassified 2447
242 nmdc:mga06r32_1028540_c1 3300050510 Unclassified 775
243 nmdc:mga06r32_1256371_c1 3300050510 Bacteria 685
244 nmdc:mga06r32_37466_c1 3300050510 Bacteria 4586
245 nmdc:mga06r32_58116_c1 3300050510 Bacteria 3717
246 nmdc:mga08y16_884333_c1 3300050511 Bacteria 880
247 nmdc:mga0a205_401509_c1 3300050515 Unclassified 1234
248 Ga0501084_0091044 3300054114 Unclassified 2561
249 Ga0501082_1343581 3300060353 Bacteria 624
250 Ga0530510_0476822 3300061734 Bacteria 945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0259363 Ga0453684_0259363_73_390 105
2 3300009176 Ga0105242_10326232 Ga0105242_103262324 106
3 3300042876 Ga0451577_0521107 Ga0451577_0521107_734_1054 106
4 3300044673 Ga0453683_1107081 Ga0453683_1107081_17_337 106
5 3300044712 Ga0453684_2186570 Ga0453684_2186570_180_500 106
6 3300031665 Ga0316575_10026524 Ga0316575_100265242 124
7 3300031727 Ga0316576_10532627 Ga0316576_105326272 124
8 3300031728 Ga0316578_10118792 Ga0316578_101187922 124
9 3300036647 Ga0316582_0150185 Ga0316582_0150185_1011_1388 124
10 3300036712 Ga0316584_0029911 Ga0316584_0029911_332_709 124
11 3300060353 Ga0501082_1343581 Ga0501082_1343581_17_391 124
12 3300035398 Ga0316574_0567928 Ga0316574_0567928_125_505 125
13 3300009176 Ga0105242_10091760 Ga0105242_100917601 126
14 3300009177 Ga0105248_11081213 Ga0105248_110812132 126
15 3300014325 Ga0163163_10262692 Ga0163163_102626921 126
16 3300013307 Ga0157372_11291138 Ga0157372_112911382 127
17 3300031665 Ga0316575_10002387 Ga0316575_100023872 128
18 3300035398 Ga0316574_0130870 Ga0316574_0130870_75_476 128
19 3300036647 Ga0316582_0747985 Ga0316582_0747985_135_536 128
20 3300039438 Ga0436360_0875102 Ga0436360_0875102_428_823 128
21 3300005330 Ga0070690_100556660 Ga0070690_1005566602 129
22 3300005335 Ga0070666_10244629 Ga0070666_102446292 129
23 3300005335 Ga0070666_11350880 Ga0070666_113508801 129
24 3300005563 Ga0068855_100241342 Ga0068855_1002413422 129
25 3300006237 Ga0097621_100182673 Ga0097621_1001826732 129
26 3300006358 Ga0068871_100092377 Ga0068871_1000923774 129
27 3300013104 Ga0157370_10857949 Ga0157370_108579491 129
28 3300025917 Ga0207660_11350464 Ga0207660_113504641 129
29 3300025928 Ga0207700_11207146 Ga0207700_112071462 129
30 3300025934 Ga0207686_10217503 Ga0207686_102175032 129
31 3300028556 Ga0265337_1009415 Ga0265337_10094154 129
32 3300028573 Ga0265334_10006582 Ga0265334_100065823 129
33 3300028800 Ga0265338_10024370 Ga0265338_100243704 129
34 3300031251 Ga0265327_10018855 Ga0265327_100188555 129
35 3300031344 Ga0265316_10815502 Ga0265316_108155022 129
36 3300031665 Ga0316575_10026355 Ga0316575_100263553 129
37 3300031691 Ga0316579_10429295 Ga0316579_104292951 129
38 3300031711 Ga0265314_10127228 Ga0265314_101272281 129
39 3300031727 Ga0316576_10529512 Ga0316576_105295122 129
40 3300031733 Ga0316577_10041569 Ga0316577_100415692 129
41 3300031733 Ga0316577_10636709 Ga0316577_106367091 129
42 3300035119 Ga0373956_0189614 Ga0373956_0189614_78_476 129
43 3300035398 Ga0316574_0022093 Ga0316574_0022093_2925_3329 129
44 3300036401 Ga0373937_0003701 Ga0373937_0003701_5326_5724 129
45 3300036647 Ga0316582_0004486 Ga0316582_0004486_362_766 129
46 3300036647 Ga0316582_0574780 Ga0316582_0574780_133_522 129
47 3300036712 Ga0316584_0070740 Ga0316584_0070740_1975_2379 129
48 3300037068 Ga0373925_0240687 Ga0373925_0240687_475_873 129
49 3300037068 Ga0373925_0452179 Ga0373925_0452179_66_464 129
50 3300037588 Ga0316581_0026422 Ga0316581_0026422_1117_1521 129
51 3300039450 Ga0436363_1524352 Ga0436363_1524352_696_1100 129
52 3300042876 Ga0451577_0122757 Ga0451577_0122757_395_787 129
53 3300042876 Ga0451577_0381241 Ga0451577_0381241_71_481 129
54 3300042876 Ga0451577_1367959 Ga0451577_1367959_15_407 129
55 3300044673 Ga0453683_0064230 Ga0453683_0064230_629_1027 129
56 3300044673 Ga0453683_0195658 Ga0453683_0195658_787_1179 129
57 3300044673 Ga0453683_0690908 Ga0453683_0690908_68_466 129
58 3300044712 Ga0453684_0000007 Ga0453684_0000007_795560_795970 129
59 3300044712 Ga0453684_0000267 Ga0453684_0000267_151874_152272 129
60 3300044712 Ga0453684_0002372 Ga0453684_0002372_25351_25743 129
61 3300044712 Ga0453684_0003073 Ga0453684_0003073_38080_38472 129
62 3300044712 Ga0453684_0038394 Ga0453684_0038394_4912_5304 129
63 3300044712 Ga0453684_0155919 Ga0453684_0155919_1064_1462 129
64 3300044712 Ga0453684_0158326 Ga0453684_0158326_519_917 129
65 3300044712 Ga0453684_0297347 Ga0453684_0297347_1359_1784 129
66 3300044712 Ga0453684_0461688 Ga0453684_0461688_880_1278 129
67 3300044712 Ga0453684_1132711 Ga0453684_1132711_55_453 129
68 3300044712 Ga0453684_1379491 Ga0453684_1379491_164_556 129
69 3300045051 Ga0451576_0000058 Ga0451576_0000058_257060_257458 129
70 3300045051 Ga0451576_0002998 Ga0451576_0002998_19044_19442 129
71 3300045051 Ga0451576_0009104 Ga0451576_0009104_6093_6491 129
72 3300045051 Ga0451576_0078728 Ga0451576_0078728_308_706 129
73 3300045051 Ga0451576_0309171 Ga0451576_0309171_62_454 129
74 3300045051 Ga0451576_1644943 Ga0451576_1644943_24_422 129
75 3300046472 Ga0495580_0902100 Ga0495580_0902100_74_472 129
76 3300046473 Ga0495582_0053345 Ga0495582_0053345_557_955 129
77 3300046531 Ga0495665_0018562 Ga0495665_0018562_891_1289 129
78 3300005289 Ga0065704_10116935 Ga0065704_101169354 130
79 3300005289 Ga0065704_10134767 Ga0065704_101347674 130
80 3300005289 Ga0065704_10473335 Ga0065704_104733351 130
81 3300005295 Ga0065707_10003021 Ga0065707_100030214 130
82 3300005295 Ga0065707_10444767 Ga0065707_104447672 130
83 3300005295 Ga0065707_10621946 Ga0065707_106219462 130
84 3300005331 Ga0070670_100359998 Ga0070670_1003599983 130
85 3300005336 Ga0070680_101069021 Ga0070680_1010690211 130
86 3300005341 Ga0070691_10295477 Ga0070691_102954772 130
87 3300005345 Ga0070692_11151247 Ga0070692_111512471 130
88 3300005354 Ga0070675_100658784 Ga0070675_1006587842 130
89 3300005440 Ga0070705_100059619 Ga0070705_1000596192 130
90 3300005444 Ga0070694_101907674 Ga0070694_1019076741 130
91 3300005468 Ga0070707_100287231 Ga0070707_1002872313 130
92 3300005468 Ga0070707_101081043 Ga0070707_1010810432 130
93 3300005471 Ga0070698_100079473 Ga0070698_1000794734 130
94 3300005471 Ga0070698_100133046 Ga0070698_1001330462 130
95 3300005471 Ga0070698_100262170 Ga0070698_1002621703 130
96 3300005471 Ga0070698_100592784 Ga0070698_1005927841 130
97 3300005518 Ga0070699_100007775 Ga0070699_1000077757 130
98 3300005518 Ga0070699_100029133 Ga0070699_1000291335 130
99 3300005518 Ga0070699_100166840 Ga0070699_1001668404 130
100 3300005518 Ga0070699_100179750 Ga0070699_1001797502 130
101 3300005518 Ga0070699_100376740 Ga0070699_1003767401 130
102 3300005530 Ga0070679_100020609 Ga0070679_1000206096 130
103 3300005536 Ga0070697_100373573 Ga0070697_1003735732 130
104 3300005544 Ga0070686_100512737 Ga0070686_1005127372 130
105 3300005545 Ga0070695_100252673 Ga0070695_1002526732 130
106 3300005546 Ga0070696_100042840 Ga0070696_1000428403 130
107 3300005548 Ga0070665_101901120 Ga0070665_1019011202 130
108 3300005549 Ga0070704_100376696 Ga0070704_1003766962 130
109 3300005577 Ga0068857_100133922 Ga0068857_1001339223 130
110 3300005615 Ga0070702_100056500 Ga0070702_1000565002 130
111 3300005618 Ga0068864_100944277 Ga0068864_1009442772 130
112 3300005719 Ga0068861_100199849 Ga0068861_1001998492 130
113 3300005840 Ga0068870_10146352 Ga0068870_101463522 130
114 3300005840 Ga0068870_11067232 Ga0068870_110672321 130
115 3300005843 Ga0068860_101352786 Ga0068860_1013527862 130
116 3300005844 Ga0068862_100436569 Ga0068862_1004365692 130
117 3300005985 Ga0081539_10037730 Ga0081539_100377302 130
118 3300006194 Ga0075427_10000411 Ga0075427_100004115 130
119 3300006846 Ga0075430_100124706 Ga0075430_1001247063 130
120 3300006847 Ga0075431_100054484 Ga0075431_1000544843 130
121 3300006847 Ga0075431_100067919 Ga0075431_1000679193 130
122 3300006847 Ga0075431_101596119 Ga0075431_1015961191 130
123 3300006852 Ga0075433_10175606 Ga0075433_101756064 130
124 3300006871 Ga0075434_102331073 Ga0075434_1023310731 130
125 3300006880 Ga0075429_100042465 Ga0075429_1000424654 130
126 3300006880 Ga0075429_100299565 Ga0075429_1002995651 130
127 3300006880 Ga0075429_101572701 Ga0075429_1015727012 130
128 3300009093 Ga0105240_10750137 Ga0105240_107501372 130
129 3300009098 Ga0105245_10765027 Ga0105245_107650271 130
130 3300009147 Ga0114129_10005862 Ga0114129_1000586210 130
131 3300009147 Ga0114129_11292209 Ga0114129_112922092 130
132 3300009147 Ga0114129_11454795 Ga0114129_114547952 130
133 3300009147 Ga0114129_11806538 Ga0114129_118065382 130
134 3300009148 Ga0105243_10035668 Ga0105243_100356684 130
135 3300009148 Ga0105243_12582896 Ga0105243_125828962 130
136 3300009176 Ga0105242_10127245 Ga0105242_101272453 130
137 3300009553 Ga0105249_10221596 Ga0105249_102215963 130
138 3300009553 Ga0105249_10267294 Ga0105249_102672942 130
139 3300014325 Ga0163163_10220851 Ga0163163_102208513 130
140 3300014326 Ga0157380_11813405 Ga0157380_118134051 130
141 3300025917 Ga0207660_10913171 Ga0207660_109131712 130
142 3300025921 Ga0207652_10032631 Ga0207652_100326315 130
143 3300025922 Ga0207646_10199190 Ga0207646_101991902 130
144 3300025925 Ga0207650_10457455 Ga0207650_104574551 130
145 3300025926 Ga0207659_10565505 Ga0207659_105655052 130
146 3300025935 Ga0207709_10669123 Ga0207709_106691232 130
147 3300025935 Ga0207709_11192854 Ga0207709_111928542 130
148 3300025961 Ga0207712_10313147 Ga0207712_103131471 130
149 3300025961 Ga0207712_11788102 Ga0207712_117881021 130
150 3300026095 Ga0207676_10987502 Ga0207676_109875021 130
151 3300026095 Ga0207676_11602393 Ga0207676_116023931 130
152 3300026116 Ga0207674_10152364 Ga0207674_101523643 130
153 3300026118 Ga0207675_100185981 Ga0207675_1001859812 130
154 3300026118 Ga0207675_100795827 Ga0207675_1007958271 130
155 3300027462 Ga0210000_1020013 Ga0210000_10200132 130
156 3300027526 Ga0209968_1024197 Ga0209968_10241971 130
157 3300028380 Ga0268265_11357095 Ga0268265_113570952 130
158 3300031548 Ga0307408_100604411 Ga0307408_1006044111 130
159 3300031691 Ga0316579_10303412 Ga0316579_103034122 130
160 3300031727 Ga0316576_10034409 Ga0316576_100344092 130
161 3300031727 Ga0316576_10080448 Ga0316576_100804485 130
162 3300031728 Ga0316578_10174786 Ga0316578_101747862 130
163 3300031731 Ga0307405_10095967 Ga0307405_100959673 130
164 3300031733 Ga0316577_10011392 Ga0316577_100113926 130
165 3300031824 Ga0307413_11166061 Ga0307413_111660611 130
166 3300031852 Ga0307410_10144268 Ga0307410_101442683 130
167 3300031911 Ga0307412_10637482 Ga0307412_106374822 130
168 3300032002 Ga0307416_100134370 Ga0307416_1001343702 130
169 3300032005 Ga0307411_10202470 Ga0307411_102024702 130
170 3300032126 Ga0307415_100211925 Ga0307415_1002119254 130
171 3300032137 Ga0316585_10047457 Ga0316585_100474572 130
172 3300035083 Ga0373926_0428291 Ga0373926_0428291_41_448 130
173 3300035112 Ga0373932_0035721 Ga0373932_0035721_940_1332 130
174 3300035241 Ga0373961_0367128 Ga0373961_0367128_138_530 130
175 3300035242 Ga0373962_0124528 Ga0373962_0124528_209_601 130
176 3300036647 Ga0316582_1002064 Ga0316582_1002064_160_558 130
177 3300036712 Ga0316584_0003461 Ga0316584_0003461_4974_5387 130
178 3300036712 Ga0316584_0128753 Ga0316584_0128753_212_676 130
179 3300036712 Ga0316584_0363690 Ga0316584_0363690_291_689 130
180 3300042436 Ga0439435_0050235 Ga0439435_0050235_90_482 130
181 3300044673 Ga0453683_0049391 Ga0453683_0049391_1066_1458 130
182 3300044673 Ga0453683_0484888 Ga0453683_0484888_379_771 130
183 3300044712 Ga0453684_0127381 Ga0453684_0127381_2510_2902 130
184 3300044712 Ga0453684_0137751 Ga0453684_0137751_315_707 130
185 3300044712 Ga0453684_0563915 Ga0453684_0563915_454_846 130
186 3300044712 Ga0453684_1569414 Ga0453684_1569414_61_453 130
187 3300044712 Ga0453684_2347449 Ga0453684_2347449_92_484 130
188 3300045051 Ga0451576_0016140 Ga0451576_0016140_2312_2704 130
189 3300045051 Ga0451576_0024190 Ga0451576_0024190_5445_5837 130
190 3300045051 Ga0451576_0441809 Ga0451576_0441809_900_1292 130
191 3300047319 Ga0495674_0704375 Ga0495674_0704375_85_522 130
192 3300049577 Ga0501041_0044611 Ga0501041_0044611_1996_2388 130
193 3300049582 Ga0501048_0321603 Ga0501048_0321603_81_473 130
194 3300049587 Ga0501071_0191406 Ga0501071_0191406_124_516 130
195 3300049592 Ga0501076_0083434 Ga0501076_0083434_1822_2214 130
196 3300049592 Ga0501076_0420140 Ga0501076_0420140_640_1035 130
197 3300049668 Ga0501233_111804 Ga0501233_111804_306_698 130
198 3300049741 Ga0501079_0403614 Ga0501079_0403614_530_925 130
199 3300049742 Ga0501080_0341868 Ga0501080_0341868_375_767 130
200 3300049743 Ga0501081_0686344 Ga0501081_0686344_208_600 130
201 3300049824 Ga0501045_0151923 Ga0501045_0151923_467_859 130
202 3300050507 nmdc:mga05p37_1515417_c1 nmdc:mga05p37_1515417_c1_74_466 130
203 3300050507 nmdc:mga05p37_26497_c1 nmdc:mga05p37_26497_c1_775_1167 130
204 3300050507 nmdc:mga05p37_34090_c1 nmdc:mga05p37_34090_c1_4321_4713 130
205 3300050508 nmdc:mga09592_103143_c1 nmdc:mga09592_103143_c1_218_610 130
206 3300050508 nmdc:mga09592_120670_c1 nmdc:mga09592_120670_c1_1239_1631 130
207 3300050508 nmdc:mga09592_294119_c1 nmdc:mga09592_294119_c1_254_646 130
208 3300050508 nmdc:mga09592_30213_c1 nmdc:mga09592_30213_c1_2954_3346 130
209 3300050509 nmdc:mga0qj67_297643_c1 nmdc:mga0qj67_297643_c1_538_930 130
210 3300050509 nmdc:mga0qj67_91328_c1 nmdc:mga0qj67_91328_c1_878_1270 130
211 3300050510 nmdc:mga06r32_1028540_c1 nmdc:mga06r32_1028540_c1_352_744 130
212 3300050510 nmdc:mga06r32_1256371_c1 nmdc:mga06r32_1256371_c1_61_453 130
213 3300050510 nmdc:mga06r32_37466_c1 nmdc:mga06r32_37466_c1_3168_3560 130
214 3300050510 nmdc:mga06r32_58116_c1 nmdc:mga06r32_58116_c1_2237_2629 130
215 3300050511 nmdc:mga08y16_884333_c1 nmdc:mga08y16_884333_c1_425_817 130
216 3300050515 nmdc:mga0a205_401509_c1 nmdc:mga0a205_401509_c1_377_769 130
217 3300054114 Ga0501084_0091044 Ga0501084_0091044_1816_2208 130
218 2162886007 SwRhRL2b_contig_987143 SwRhRL2b_0848.00007910 131
219 3300005289 Ga0065704_10000291 Ga0065704_1000029130 131
220 3300005289 Ga0065704_10089291 Ga0065704_100892912 131
221 3300005290 Ga0065712_10108797 Ga0065712_101087973 131
222 3300005295 Ga0065707_10000435 Ga0065707_1000043559 131
223 3300005295 Ga0065707_10101097 Ga0065707_101010972 131
224 3300005295 Ga0065707_10588196 Ga0065707_105881962 131
225 3300005365 Ga0070688_100862113 Ga0070688_1008621132 131
226 3300005471 Ga0070698_102067071 Ga0070698_1020670711 131
227 3300005549 Ga0070704_100406398 Ga0070704_1004063982 131
228 3300005841 Ga0068863_101255609 Ga0068863_1012556091 131
229 3300005985 Ga0081539_10013770 Ga0081539_100137703 131
230 3300025908 Ga0207643_10364463 Ga0207643_103644632 131
231 3300026095 Ga0207676_11110990 Ga0207676_111109902 131
232 3300026116 Ga0207674_11764259 Ga0207674_117642591 131
233 3300031901 Ga0307406_10814714 Ga0307406_108147142 131
234 3300032126 Ga0307415_101711135 Ga0307415_1017111351 131
235 3300041451 Ga0451791_0567397 Ga0451791_0567397_55_450 131
236 3300041512 Ga0451853_3655376 Ga0451853_3655376_82_477 131
237 3300042876 Ga0451577_0665152 Ga0451577_0665152_92_487 131
238 3300044712 Ga0453684_0028705 Ga0453684_0028705_4110_4505 131
239 3300044712 Ga0453684_2204209 Ga0453684_2204209_59_454 131
240 3300045051 Ga0451576_0019566 Ga0451576_0019566_5055_5450 131
241 3300049572 Ga0501036_0297668 Ga0501036_0297668_56_451 131
242 3300049577 Ga0501041_0326062 Ga0501041_0326062_256_651 131
243 3300049589 Ga0501073_0780550 Ga0501073_0780550_181_609 131
244 3300049591 Ga0501075_0110308 Ga0501075_0110308_1389_1784 131
245 3300049592 Ga0501076_0609550 Ga0501076_0609550_357_752 131
246 3300049593 Ga0501077_0523204 Ga0501077_0523204_141_536 131
247 3300049742 Ga0501080_0268336 Ga0501080_0268336_678_1073 131
248 3300049743 Ga0501081_0628250 Ga0501081_0628250_213_608 131
249 3300050509 nmdc:mga0qj67_867278_c1 nmdc:mga0qj67_867278_c1_220_615 131
250 3300061734 Ga0530510_0476822 Ga0530510_0476822_284_679 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

26

114

0.9

PF12900

Pyridox_ox_2

Pyridoxamine 5'-phosphate oxidase

37

152

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.8822 3 127
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.8627 3 127
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.8243 4 126
5jab-assembly2.cif.gz_D structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.8192 1 126
6vna-assembly1.cif.gz_C pden_1323 0.8036 9 126
ID Description Score Start End Superfamily
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8661 3 127 2.30.110.10
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8468 3 127 2.30.110.10
2iabB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7872 6 131 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.773 3 127 2.30.110.10
2asfA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7652 4 126 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7C3PL95-F1-model_v4 PPOX class F420-dependent oxidoreductase 1 1 130 GO:0005829
GO:0016627
GO:0070967
AF-A0A3N5GQC8-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9987 3 129 GO:0005829
GO:0016627
GO:0070967
AF-A0A363UCF0-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9976 1 130 GO:0005829
GO:0016627
GO:0070967
AF-A0A363UCF0-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.99 1 130 GO:0005829
GO:0016627
GO:0070967
AF-A0A419EFE4-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9893 1 129 GO:0005829
GO:0016627
GO:0070967

Feature Viewer

pLDDT pTM Quality
96.56 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map