F361675

General Info

Members Datasets Scaffolds Average Seq Length
250 176 500 160

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10136502|Ga0265327_101365022
Length 177
Sequence MAESDLVALPDGALDEVASRVGASLHGSTDGTGLRVGIACAEFNGGITLRLLDGALEALNEAGTDRRDVTLAWAPGAFELPVVARAFAHAGKVDAVLCLGAVIRGDTGHYDFVAGQCASGIQQVQLATGVPVVFGVLTTDTLEQALVRSEPDHTNKGREAALTGVEMVRLLRSGPLS

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
46 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
64 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
65 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
66 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
67 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
68 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
69 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
74 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
75 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
76 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
77 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
81 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
82 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
160 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
164 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
165 2643221641 Nocardioides sp. Root122 Isolate Unclassified
166 2739367898 Nocardioides sp. CF479 Isolate Unclassified
167 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
168 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
169 2867369537 Streptomyces sp. Z26 Isolate Unclassified
170 2867475112 Streptomyces sp. TM32 Isolate Unclassified
171 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
172 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
173 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
174 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
175 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
176 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.6
Metatranscriptomes 0.4
Isolates 6

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 15.6
Nodule 0.4
Rhizoplane 3.2
Rhizosphere 73.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10136502 3300031251 Bacteria 1150
2 JGI25160J50197_1009716 3300003354 Bacteria 3540
3 Ga0070683_100172747 3300005329 Bacteria 2051
4 Ga0070683_101005235 3300005329 Bacteria 801
5 Ga0070670_100185668 3300005331 Bacteria 1805
6 Ga0070666_10100150 3300005335 Bacteria 1996
7 Ga0070682_100897958 3300005337 Bacteria 728
8 Ga0068868_100120945 3300005338 Bacteria 2136
9 Ga0070661_100014634 3300005344 Bacteria 5531
10 Ga0070675_100023337 3300005354 Bacteria 4945
11 Ga0070671_100003040 3300005355 Bacteria 13056
12 Ga0070674_100088667 3300005356 Bacteria 2227
13 Ga0070662_100234913 3300005457 Bacteria 1468
14 Ga0070707_100435043 3300005468 Bacteria 1272
15 Ga0070699_100000222 3300005518 Bacteria 56552
16 Ga0070684_100268980 3300005535 Bacteria 1560
17 Ga0068853_100032660 3300005539 Bacteria 4411
18 Ga0068853_100123492 3300005539 Bacteria 2312
19 Ga0070665_100246729 3300005548 Bacteria 1786
20 Ga0070664_100169458 3300005564 Bacteria 1936
21 Ga0070664_100828212 3300005564 Bacteria 866
22 Ga0068852_100146539 3300005616 Bacteria 2190
23 Ga0068864_100131361 3300005618 Bacteria 2249
24 Ga0068861_100736947 3300005719 Bacteria 919
25 Ga0068870_10064377 3300005840 Bacteria 1980
26 Ga0075365_10275052 3300006038 Bacteria 1185
27 Ga0075365_10421239 3300006038 Bacteria 943
28 Ga0075368_10009225 3300006042 Bacteria 3544
29 Ga0075368_10018174 3300006042 Bacteria 2640
30 Ga0075363_100044731 3300006048 Bacteria 2346
31 Ga0075363_100303680 3300006048 Bacteria 926
32 Ga0075363_100492111 3300006048 Bacteria 727
33 Ga0075364_10018096 3300006051 Bacteria 4408
34 Ga0075364_10112783 3300006051 Bacteria 1815
35 Ga0075364_10116030 3300006051 Bacteria 1790
36 Ga0075364_10126517 3300006051 Bacteria 1713
37 Ga0075362_10297123 3300006177 Bacteria 801
38 Ga0075362_10321954 3300006177 Bacteria 770
39 Ga0075367_10003483 3300006178 Bacteria 7510
40 Ga0075367_10015203 3300006178 Bacteria 4178
41 Ga0075367_10077562 3300006178 Bacteria 2006
42 Ga0097621_100118143 3300006237 Bacteria 2247
43 Ga0075370_10005532 3300006353 Bacteria 6294
44 Ga0075370_10019414 3300006353 Bacteria 3702
45 Ga0068871_100039123 3300006358 Bacteria 3793
46 Ga0075431_100001856 3300006847 Bacteria 20011
47 Ga0105245_10027014 3300009098 Bacteria 5055
48 Ga0105243_10719650 3300009148 Bacteria 975
49 Ga0105248_10102938 3300009177 Bacteria 3218
50 Ga0105248_10535180 3300009177 Bacteria 1321
51 Ga0105249_10499484 3300009553 Bacteria 1261
52 Ga0105239_10522891 3300010375 Bacteria 1350
53 Ga0157369_10512174 3300013105 Bacteria 1241
54 Ga0157374_10193040 3300013296 Bacteria 1992
55 Ga0163162_10025781 3300013306 Bacteria 5811
56 Ga0163162_10566119 3300013306 Bacteria 1264
57 Ga0157375_10094685 3300013308 Bacteria 3056
58 Ga0157380_10629716 3300014326 Bacteria 1066
59 Ga0157377_10053158 3300014745 Bacteria 2289
60 Ga0163161_10112755 3300017792 Bacteria 2034
61 Ga0224572_1001731 3300024225 Bacteria 3328
62 Ga0207643_10575271 3300025908 Bacteria 724
63 Ga0207660_10648858 3300025917 Bacteria 860
64 Ga0207650_10010848 3300025925 Bacteria 6262
65 Ga0207659_10041044 3300025926 Bacteria 3240
66 Ga0207690_10752708 3300025932 Bacteria 803
67 Ga0207669_10147851 3300025937 Bacteria 1641
68 Ga0207691_10053970 3300025940 Bacteria 3667
69 Ga0207679_10040887 3300025945 Bacteria 3321
70 Ga0207679_10885791 3300025945 Bacteria 816
71 Ga0207651_10040373 3300025960 Bacteria 3087
72 Ga0207677_10312217 3300026023 Bacteria 1303
73 Ga0207677_10762360 3300026023 Bacteria 863
74 Ga0207639_10120490 3300026041 Bacteria 2155
75 Ga0207641_10315846 3300026088 Bacteria 1480
76 Ga0207676_10113565 3300026095 Bacteria 2271
77 Ga0207683_10000630 3300026121 Bacteria 32208
78 Ga0209813_10063950 3300027866 Bacteria 1181
79 Ga0209813_10069657 3300027866 Bacteria 1141
80 Ga0268266_10488924 3300028379 Bacteria 1174
81 Ga0268264_10497675 3300028381 Bacteria 1188
82 Ga0307509_10043062 3300031507 Bacteria 4887
83 Ga0307514_10034465 3300031649 Bacteria 4034
84 Ga0316575_10176387 3300031665 Bacteria 887
85 Ga0316579_10128405 3300031691 Bacteria 1220
86 Ga0316576_10013731 3300031727 Bacteria 5393
87 Ga0316578_10006327 3300031728 Bacteria 5834
88 Ga0316578_10102076 3300031728 Bacteria 1720
89 Ga0316577_10017999 3300031733 Bacteria 3906
90 Ga0307413_10654886 3300031824 Bacteria 867
91 Ga0307407_10303949 3300031903 Bacteria 1113
92 Ga0307416_100697493 3300032002 Bacteria 1104
93 Ga0316583_10083899 3300032133 Bacteria 1113
94 Ga0316580_10079980 3300032139 Bacteria 1000
95 Ga0316574_0006666 3300035398 Bacteria 6265
96 Ga0316574_0043193 3300035398 Bacteria 2785
97 Ga0316574_0116674 3300035398 Bacteria 1713
98 Ga0316574_0222270 3300035398 Bacteria 1210
99 Ga0316582_0006238 3300036647 Bacteria 6236
100 Ga0316584_0042600 3300036712 Bacteria 3384
101 Ga0395900_0059545 3300037418 Bacteria 3932
102 Ga0395901_0080817 3300038443 Bacteria 3394
103 Ga0451833_1347686 3300041491 Bacteria 11468
104 Ga0451837_0497619 3300041494 Bacteria 708
105 Ga0451841_0089000 3300041498 Bacteria 837
106 Ga0451853_0545423 3300041512 Bacteria 6584
107 Ga0466969_0000333 3300044656 Bacteria 26115
108 Ga0466969_0002360 3300044656 Bacteria 10094
109 Ga0466969_0355747 3300044656 Bacteria 663
110 Ga0466972_0100393 3300044658 Bacteria 1370
111 Ga0466966_0002170 3300044684 Bacteria 12742
112 Ga0466966_0360423 3300044684 Bacteria 873
113 Ga0466961_0010893 3300044693 Bacteria 5808
114 Ga0466961_0117838 3300044693 Bacteria 1668
115 Ga0466963_0101783 3300044694 Bacteria 1967
116 Ga0466971_0000154 3300044719 Bacteria 25646
117 Ga0466971_0107476 3300044719 Bacteria 1286
118 Ga0466970_0045016 3300044765 Bacteria 2350
119 Ga0466970_0321497 3300044765 Bacteria 875
120 Ga0466960_0095839 3300044901 Bacteria 1520
121 Ga0466960_0618959 3300044901 Bacteria 644
122 Ga0466960_0779943 3300044901 Bacteria 578
123 Ga0466959_0001555 3300045049 Bacteria 14115
124 Ga0466959_0343914 3300045049 Bacteria 1017
125 Ga0466959_0434588 3300045049 Bacteria 890
126 Ga0466959_0472314 3300045049 Bacteria 849
127 Ga0466958_0004946 3300045836 Bacteria 7110
128 Ga0466967_0006279 3300045976 Bacteria 8383
129 Ga0466967_0014370 3300045976 Bacteria 6165
130 Ga0466967_0143565 3300045976 Bacteria 2225
131 Ga0466967_0193811 3300045976 Bacteria 1922
132 Ga0495592_0000709 3300046454 Bacteria 23319
133 Ga0495592_0078679 3300046454 Bacteria 2388
134 Ga0495651_0000405 3300046462 Bacteria 33331
135 Ga0495653_0013864 3300046463 Bacteria 6569
136 Ga0495653_0098014 3300046463 Bacteria 2129
137 Ga0495662_0000294 3300046476 Bacteria 21633
138 Ga0495664_0004741 3300046477 Bacteria 7431
139 Ga0495608_0000431 3300046511 Bacteria 29189
140 Ga0495618_0132361 3300046514 Bacteria 1596
141 Ga0495628_0009855 3300046516 Bacteria 8138
142 Ga0495628_0507050 3300046516 Bacteria 870
143 Ga0495630_0010374 3300046517 Bacteria 6722
144 Ga0495630_0073834 3300046517 Bacteria 2569
145 Ga0495666_0004651 3300046526 Bacteria 6944
146 Ga0495652_0001107 3300046529 Bacteria 30520
147 Ga0495652_0058921 3300046529 Bacteria 3250
148 Ga0495652_1045445 3300046529 Bacteria 532
149 Ga0495665_0004577 3300046531 Bacteria 7466
150 Ga0495640_0008836 3300046533 Bacteria 7874
151 Ga0495586_0005619 3300046535 Bacteria 6710
152 Ga0495587_0009093 3300046536 Bacteria 6374
153 Ga0495645_0002607 3300046543 Bacteria 12257
154 Ga0495667_0026184 3300046559 Bacteria 3928
155 Ga0495634_0010046 3300046642 Bacteria 6946
156 Ga0495634_0077130 3300046642 Bacteria 2186
157 Ga0495635_0008934 3300046663 Bacteria 6993
158 Ga0495635_0057721 3300046663 Bacteria 2670
159 Ga0495657_0001154 3300046675 Bacteria 23164
160 Ga0495599_0006179 3300046678 Bacteria 7218
161 Ga0495623_0001747 3300046679 Bacteria 14598
162 Ga0495623_0266281 3300046679 Bacteria 958
163 Ga0495646_0019594 3300046680 Bacteria 4279
164 Ga0495646_0042537 3300046680 Bacteria 2787
165 Ga0495613_0003259 3300046689 Bacteria 12139
166 Ga0495624_0466343 3300046690 Bacteria 756
167 Ga0495600_0007711 3300046809 Bacteria 6592
168 Ga0495600_0033115 3300046809 Bacteria 3354
169 Ga0495581_0006276 3300047315 Bacteria 6892
170 Ga0495604_0000492 3300047317 Bacteria 34661
171 Ga0495604_0577110 3300047317 Bacteria 723
172 Ga0495674_0030655 3300047319 Bacteria 4888
173 Ga0495675_0005722 3300047444 Bacteria 7601
174 Ga0495675_0329835 3300047444 Bacteria 901
175 Ga0495675_0387963 3300047444 Bacteria 816
176 Ga0495684_0000919 3300047471 Bacteria 23894
177 Ga0495684_0051181 3300047471 Bacteria 3153
178 Ga0495593_0008733 3300047673 Bacteria 5885
179 Ga0495602_0037553 3300048088 Bacteria 4492
180 Ga0495602_0109554 3300048088 Bacteria 2246
181 Ga0496102_0413227 3300048905 Bacteria 1268
182 Ga0496104_0493176 3300048907 Bacteria 1136
183 Ga0496104_0606710 3300048907 Bacteria 1005
184 Ga0496108_0066949 3300048911 Bacteria 3029
185 Ga0496109_0124692 3300048912 Bacteria 2401
186 Ga0496110_0180561 3300048913 Bacteria 1916
187 Ga0496113_0461148 3300048916 Bacteria 1021
188 Ga0496114_0456312 3300048917 Bacteria 1132
189 Ga0496126_0416520 3300048929 Bacteria 1087
190 Ga0501323_005137 3300049539 Bacteria 1419
191 Ga0501039_0006128 3300049575 Bacteria 9130
192 Ga0501039_0148477 3300049575 Bacteria 1842
193 Ga0501039_0861760 3300049575 Bacteria 706
194 Ga0501042_0136577 3300049578 Bacteria 1768
195 Ga0501071_0203481 3300049587 Bacteria 1488
196 Ga0501072_0753117 3300049588 Bacteria 764
197 Ga0501073_0177245 3300049589 Bacteria 1475
198 Ga0501075_0309167 3300049591 Bacteria 1204
199 Ga0501075_0316102 3300049591 Bacteria 1190
200 Ga0501076_0078461 3300049592 Bacteria 2650
201 Ga0501079_0446379 3300049741 Bacteria 1016
202 Ga0501079_0671217 3300049741 Bacteria 816
203 Ga0501080_0141965 3300049742 Bacteria 2220
204 Ga0501081_0593894 3300049743 Bacteria 829
205 Ga0501035_0334163 3300049822 Bacteria 1271
206 Ga0501045_0075938 3300049824 Bacteria 2475
207 nmdc:mga03n38_57919_c1 3300050490 Bacteria 1754
208 nmdc:mga00v17_181378_c1 3300050491 Bacteria 1358
209 nmdc:mga00v17_40613_c1 3300050491 Bacteria 2791
210 nmdc:mga00v17_50790_c1 3300050491 Bacteria 2521
211 nmdc:mga0yw44_128553_c1 3300050492 Bacteria 1638
212 nmdc:mga0yw44_174596_c1 3300050492 Bacteria 1412
213 nmdc:mga0yw44_3061_c1 3300050492 Bacteria 7322
214 nmdc:mga0yw44_44831_c1 3300050492 Bacteria 2647
215 nmdc:mga0yw44_68343_c1 3300050492 Bacteria 2198
216 nmdc:mga0yw44_710147_c1 3300050492 Bacteria 683
217 nmdc:mga06z11_193962_c1 3300050494 Bacteria 1177
218 nmdc:mga06z11_39734_c1 3300050494 Bacteria 2343
219 nmdc:mga04h51_52749_c1 3300050495 Bacteria 1370
220 nmdc:mga04h51_7992_c1 3300050495 Bacteria 2815
221 nmdc:mga07m45_20977_c1 3300050496 Bacteria 3553
222 nmdc:mga07m45_7697_c1 3300050496 Bacteria 5513
223 nmdc:mga09592_662945_c1 3300050508 Bacteria 890
224 Ga0495601_0002057 3300053077 Bacteria 11279
225 Ga0495601_0098065 3300053077 Bacteria 1891
226 Ga0495601_0118316 3300053077 Bacteria 1719
227 Ga0495612_0004589 3300053078 Bacteria 5727
228 Ga0495612_0055315 3300053078 Bacteria 1636
229 Ga0495612_0105184 3300053078 Bacteria 1204
230 Ga0495619_0057594 3300053085 Bacteria 2579
231 Ga0500608_074504 3300053122 Bacteria 1610
232 Ga0500573_0116783 3300053140 Bacteria 1489
233 Ga0501084_0283124 3300054114 Bacteria 1400
234 Ga0466962_0000909 3300061719 Bacteria 13428
235 Ga0466962_0231635 3300061719 Bacteria 906
236 2644016140 2643221601 Bacteria 7493239
237 2644179624 2643221631 Bacteria 8168043
238 2644232290 2643221641 Bacteria 4490190
239 2740169290 2739367898 Bacteria 4367674
240 2812365187 2811994880 Bacteria 4147780
241 2819746433 2818991472 Bacteria 10089953
242 2867369739 2867369537 Bacteria 6501581
243 2867478584 2867475112 Bacteria 6909112
244 2912758780 2912757875 Bacteria 7940295
245 2984594893 2984592036 Bacteria 3670284
246 2995467841 2995463766 Bacteria 8577691
247 2995469622 2995463766 Bacteria 8577691
248 8025535381 8025530807 Bacteria 8495698
249 8033690406 8033684223 Bacteria 6906479
250 8054613004 8054609563 Bacteria 5170090
251 Ga0265327_10136502
252 JGI25160J50197_1009716
253 Ga0070683_100172747
254 Ga0070683_101005235
255 Ga0070670_100185668
256 Ga0070666_10100150
257 Ga0070682_100897958
258 Ga0068868_100120945
259 Ga0070661_100014634
260 Ga0070675_100023337
261 Ga0070671_100003040
262 Ga0070674_100088667
263 Ga0070662_100234913
264 Ga0070707_100435043
265 Ga0070699_100000222
266 Ga0070684_100268980
267 Ga0068853_100032660
268 Ga0068853_100123492
269 Ga0070665_100246729
270 Ga0070664_100169458
271 Ga0070664_100828212
272 Ga0068852_100146539
273 Ga0068864_100131361
274 Ga0068861_100736947
275 Ga0068870_10064377
276 Ga0075365_10275052
277 Ga0075365_10421239
278 Ga0075368_10009225
279 Ga0075368_10018174
280 Ga0075363_100044731
281 Ga0075363_100303680
282 Ga0075363_100492111
283 Ga0075364_10018096
284 Ga0075364_10112783
285 Ga0075364_10116030
286 Ga0075364_10126517
287 Ga0075362_10297123
288 Ga0075362_10321954
289 Ga0075367_10003483
290 Ga0075367_10015203
291 Ga0075367_10077562
292 Ga0097621_100118143
293 Ga0075370_10005532
294 Ga0075370_10019414
295 Ga0068871_100039123
296 Ga0075431_100001856
297 Ga0105245_10027014
298 Ga0105243_10719650
299 Ga0105248_10102938
300 Ga0105248_10535180
301 Ga0105249_10499484
302 Ga0105239_10522891
303 Ga0157369_10512174
304 Ga0157374_10193040
305 Ga0163162_10025781
306 Ga0163162_10566119
307 Ga0157375_10094685
308 Ga0157380_10629716
309 Ga0157377_10053158
310 Ga0163161_10112755
311 Ga0224572_1001731
312 Ga0207643_10575271
313 Ga0207660_10648858
314 Ga0207650_10010848
315 Ga0207659_10041044
316 Ga0207690_10752708
317 Ga0207669_10147851
318 Ga0207691_10053970
319 Ga0207679_10040887
320 Ga0207679_10885791
321 Ga0207651_10040373
322 Ga0207677_10312217
323 Ga0207677_10762360
324 Ga0207639_10120490
325 Ga0207641_10315846
326 Ga0207676_10113565
327 Ga0207683_10000630
328 Ga0209813_10063950
329 Ga0209813_10069657
330 Ga0268266_10488924
331 Ga0268264_10497675
332 Ga0307509_10043062
333 Ga0307514_10034465
334 Ga0316575_10176387
335 Ga0316579_10128405
336 Ga0316576_10013731
337 Ga0316578_10006327
338 Ga0316578_10102076
339 Ga0316577_10017999
340 Ga0307413_10654886
341 Ga0307407_10303949
342 Ga0307416_100697493
343 Ga0316583_10083899
344 Ga0316580_10079980
345 Ga0316574_0006666
346 Ga0316574_0043193
347 Ga0316574_0116674
348 Ga0316574_0222270
349 Ga0316582_0006238
350 Ga0316584_0042600
351 Ga0395900_0059545
352 Ga0395901_0080817
353 Ga0451833_1347686
354 Ga0451837_0497619
355 Ga0451841_0089000
356 Ga0451853_0545423
357 Ga0466969_0000333
358 Ga0466969_0002360
359 Ga0466969_0355747
360 Ga0466972_0100393
361 Ga0466966_0002170
362 Ga0466966_0360423
363 Ga0466961_0010893
364 Ga0466961_0117838
365 Ga0466963_0101783
366 Ga0466971_0000154
367 Ga0466971_0107476
368 Ga0466970_0045016
369 Ga0466970_0321497
370 Ga0466960_0095839
371 Ga0466960_0618959
372 Ga0466960_0779943
373 Ga0466959_0001555
374 Ga0466959_0343914
375 Ga0466959_0434588
376 Ga0466959_0472314
377 Ga0466958_0004946
378 Ga0466967_0006279
379 Ga0466967_0014370
380 Ga0466967_0143565
381 Ga0466967_0193811
382 Ga0495592_0000709
383 Ga0495592_0078679
384 Ga0495651_0000405
385 Ga0495653_0013864
386 Ga0495653_0098014
387 Ga0495662_0000294
388 Ga0495664_0004741
389 Ga0495608_0000431
390 Ga0495618_0132361
391 Ga0495628_0009855
392 Ga0495628_0507050
393 Ga0495630_0010374
394 Ga0495630_0073834
395 Ga0495666_0004651
396 Ga0495652_0001107
397 Ga0495652_0058921
398 Ga0495652_1045445
399 Ga0495665_0004577
400 Ga0495640_0008836
401 Ga0495586_0005619
402 Ga0495587_0009093
403 Ga0495645_0002607
404 Ga0495667_0026184
405 Ga0495634_0010046
406 Ga0495634_0077130
407 Ga0495635_0008934
408 Ga0495635_0057721
409 Ga0495657_0001154
410 Ga0495599_0006179
411 Ga0495623_0001747
412 Ga0495623_0266281
413 Ga0495646_0019594
414 Ga0495646_0042537
415 Ga0495613_0003259
416 Ga0495624_0466343
417 Ga0495600_0007711
418 Ga0495600_0033115
419 Ga0495581_0006276
420 Ga0495604_0000492
421 Ga0495604_0577110
422 Ga0495674_0030655
423 Ga0495675_0005722
424 Ga0495675_0329835
425 Ga0495675_0387963
426 Ga0495684_0000919
427 Ga0495684_0051181
428 Ga0495593_0008733
429 Ga0495602_0037553
430 Ga0495602_0109554
431 Ga0496102_0413227
432 Ga0496104_0493176
433 Ga0496104_0606710
434 Ga0496108_0066949
435 Ga0496109_0124692
436 Ga0496110_0180561
437 Ga0496113_0461148
438 Ga0496114_0456312
439 Ga0496126_0416520
440 Ga0501323_005137
441 Ga0501039_0006128
442 Ga0501039_0148477
443 Ga0501039_0861760
444 Ga0501042_0136577
445 Ga0501071_0203481
446 Ga0501072_0753117
447 Ga0501073_0177245
448 Ga0501075_0309167
449 Ga0501075_0316102
450 Ga0501076_0078461
451 Ga0501079_0446379
452 Ga0501079_0671217
453 Ga0501080_0141965
454 Ga0501081_0593894
455 Ga0501035_0334163
456 Ga0501045_0075938
457 nmdc:mga03n38_57919_c1
458 nmdc:mga00v17_181378_c1
459 nmdc:mga00v17_40613_c1
460 nmdc:mga00v17_50790_c1
461 nmdc:mga0yw44_128553_c1
462 nmdc:mga0yw44_174596_c1
463 nmdc:mga0yw44_3061_c1
464 nmdc:mga0yw44_44831_c1
465 nmdc:mga0yw44_68343_c1
466 nmdc:mga0yw44_710147_c1
467 nmdc:mga06z11_193962_c1
468 nmdc:mga06z11_39734_c1
469 nmdc:mga04h51_52749_c1
470 nmdc:mga04h51_7992_c1
471 nmdc:mga07m45_20977_c1
472 nmdc:mga07m45_7697_c1
473 nmdc:mga09592_662945_c1
474 Ga0495601_0002057
475 Ga0495601_0098065
476 Ga0495601_0118316
477 Ga0495612_0004589
478 Ga0495612_0055315
479 Ga0495612_0105184
480 Ga0495619_0057594
481 Ga0500608_074504
482 Ga0500573_0116783
483 Ga0501084_0283124
484 Ga0466962_0000909
485 Ga0466962_0231635
486 2644016140
487 2644179624
488 2644232290
489 2740169290
490 2812365187
491 2819746433
492 2867369739
493 2867478584
494 2912758780
495 2984594893
496 2995467841
497 2995469622
498 8025535381
499 8033690406
500 8054613004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00885

DMRL_synthase

6,7-dimethyl-8-ribityllumazine synthase

33

172

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j07-assembly1.cif.gz_B crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae 0.9716 11 156
2c9b-assembly2.cif.gz_G lumazine synthase from mycobacterium tuberculosus bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl) 0.9713 13 155
8f25-assembly1.cif.gz_A cryo-em structure of lumazine synthase nanoparticle linked to vp8* antigen 0.9495 14 156
1c2y-assembly1.cif.gz_A crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly 0.9468 15 154
1hqk-assembly1.cif.gz_A crystal structure analysis of lumazine synthase from aquifex aeolicus 0.9459 14 155
ID Description Score Start End Superfamily
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9606 7 156 3.40.50.960
1nqwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9458 14 156 3.40.50.960
af_B4FBV7_62_217_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9449 10 154 3.40.50.960
af_Q57751_4_141_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9391 17 156 3.40.50.960
4kq6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9331 12 152 3.40.50.960
ID Description Score Start End GO Terms
AF-A0A521XRH1-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9851 19 158 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A0K2RD09-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9798 31 156 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A7W5T3Z0-F1-model_v4 deleted 0.9785 14 159
AF-A0A543PVP4-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9783 5 156 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A6A9UXY3-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9766 5 158 GO:0000906
GO:0005829
GO:0009231
GO:0009349

Map