F361665

General Info

Members Datasets Scaffolds Average Seq Length
250 156 243 331

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10026978|Ga0265338_100269783
Length 358
Sequence MSASERLTLTVKAETIPLKEPFYISGYTFEAVNLAVVELRQGPFLGRGEASGIYYFKEDAQRMGVAIEAVRAEIEAGITREALAALMPPGGARNAVDCALWELEAQRAGWPVWMLAGVGEPVPKITTFTLSAEAPERMAKAARGFGQAKALKLKLTGEDPALDAERVRVVRAVRPDVWMGVDGNQGFTPDRLEKLTPALLDAKVELVEQPFPRGCDAWMAGLDYPIATAADESVQGLEELEGLTDFDVVNIKLDKCGGLTEALAMARLARRMGLGVMVGNMVGTSWAMAPAFVVGQLCDIVDLDGPVVLRRDRKPHIAYRGGRICCDDAVWGAPAAPKPRRPRPFASRWGSYAPDQKI

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
3 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
4 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
5 2857558681 Duganella sp. R-74565 Isolate Unclassified
6 2857564685 Duganella sp. R-74599 Isolate Unclassified
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
109 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
110 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
120 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
151 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
154 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
155 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
156 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.2
Metatranscriptomes 0
Isolates 2.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0
Rhizoplane 3.6
Rhizosphere 85.6
Stem 0
Stem Tuber 0
Unclassified 6.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10086130 3300003316 Bacteria 3727
2 rootL2_10055226 3300003322 Bacteria 7737
3 Ga0055536_1008543 3300003781 Bacteria 4387
4 Ga0065715_10000654 3300005293 Bacteria 13208
5 Ga0070676_10000723 3300005328 Bacteria 16161
6 Ga0070690_100010672 3300005330 Bacteria 5353
7 Ga0070670_100011761 3300005331 Bacteria 7486
8 Ga0070670_100072092 3300005331 Bacteria 2966
9 Ga0070677_10000558 3300005333 Bacteria 12706
10 Ga0070677_10005201 3300005333 Bacteria 4280
11 Ga0068869_100014714 3300005334 Bacteria 5232
12 Ga0070682_100024135 3300005337 Bacteria 3616
13 Ga0070689_100006274 3300005340 Bacteria 8206
14 Ga0070689_100052513 3300005340 Bacteria 3153
15 Ga0070661_100090818 3300005344 Bacteria 2262
16 Ga0070668_100005952 3300005347 Bacteria 9042
17 Ga0070668_100008871 3300005347 Bacteria 7466
18 Ga0070675_100002886 3300005354 Bacteria 12958
19 Ga0070675_100007653 3300005354 Bacteria 8359
20 Ga0070675_100099388 3300005354 Bacteria 2449
21 Ga0070675_100435092 3300005354 Bacteria 1175
22 Ga0070671_100005845 3300005355 Bacteria 9801
23 Ga0070671_100050036 3300005355 Bacteria 3476
24 Ga0070674_100003058 3300005356 Bacteria 9310
25 Ga0070674_100107157 3300005356 Bacteria 2046
26 Ga0070673_100000794 3300005364 Bacteria 17571
27 Ga0070667_100220278 3300005367 Bacteria 1689
28 Ga0070700_100307498 3300005441 Bacteria 1159
29 Ga0070694_100007921 3300005444 Bacteria 6488
30 Ga0070678_100007147 3300005456 Bacteria 6602
31 Ga0070678_100167711 3300005456 Bacteria 1785
32 Ga0070662_100006018 3300005457 Bacteria 7782
33 Ga0070662_100042186 3300005457 Bacteria 3258
34 Ga0070681_10101709 3300005458 Bacteria 2819
35 Ga0068867_100005745 3300005459 Bacteria 8801
36 Ga0068867_100028315 3300005459 Bacteria 4034
37 Ga0068867_100155035 3300005459 Bacteria 1802
38 Ga0068867_100220606 3300005459 Bacteria 1528
39 Ga0070685_10019632 3300005466 Bacteria 3650
40 Ga0068853_100461417 3300005539 Bacteria 1196
41 Ga0070672_100005293 3300005543 Bacteria 8539
42 Ga0070672_100055461 3300005543 Bacteria 3105
43 Ga0070686_100030709 3300005544 Bacteria 3279
44 Ga0070665_100028567 3300005548 Bacteria 5617
45 Ga0070665_100137587 3300005548 Bacteria 2445
46 Ga0070665_100306508 3300005548 Bacteria 1591
47 Ga0070664_100455688 3300005564 Bacteria 1175
48 Ga0068854_100032214 3300005578 Bacteria 3645
49 Ga0068859_100005561 3300005617 Bacteria 12836
50 Ga0068859_100240184 3300005617 Bacteria 1901
51 Ga0068861_100016127 3300005719 Bacteria 5279
52 Ga0068861_100108902 3300005719 Bacteria 2217
53 Ga0068861_100120691 3300005719 Bacteria 2114
54 Ga0068861_100183548 3300005719 Bacteria 1743
55 Ga0068870_10003651 3300005840 Bacteria 6535
56 Ga0068870_10037657 3300005840 Bacteria 2494
57 Ga0068863_100043399 3300005841 Bacteria 4269
58 Ga0068860_100025901 3300005843 Bacteria 5658
59 Ga0068860_100079162 3300005843 Bacteria 3125
60 Ga0068862_100000074 3300005844 Bacteria 118036
61 Ga0068862_100007472 3300005844 Bacteria 9058
62 Ga0068862_100022420 3300005844 Bacteria 5282
63 Ga0068862_100182837 3300005844 Bacteria 1882
64 Ga0068871_100012634 3300006358 Bacteria 6236
65 Ga0068865_100037610 3300006881 Bacteria 3269
66 Ga0097620_100005561 3300006931 Bacteria 12836
67 Ga0097620_100240192 3300006931 Bacteria 1901
68 Ga0105244_10020329 3300009036 Bacteria 3691
69 Ga0105240_10073126 3300009093 Bacteria 4234
70 Ga0111539_10487069 3300009094 Bacteria 1436
71 Ga0105247_10099522 3300009101 Bacteria 1857
72 Ga0105241_10280401 3300009174 Bacteria 1423
73 Ga0105248_10016395 3300009177 Bacteria 8154
74 Ga0105248_10067943 3300009177 Bacteria 4002
75 Ga0105248_10236541 3300009177 Bacteria 2056
76 Ga0105248_10296553 3300009177 Bacteria 1820
77 Ga0105237_10139097 3300009545 Bacteria 2422
78 Ga0105249_10000286 3300009553 Bacteria 52146
79 Ga0105249_10009858 3300009553 Bacteria 8374
80 Ga0105239_10019629 3300010375 Bacteria 7461
81 Ga0157371_10196536 3300013102 Bacteria 1445
82 Ga0157374_10017499 3300013296 Bacteria 6312
83 Ga0163162_10044527 3300013306 Bacteria 4446
84 Ga0157375_10028412 3300013308 Bacteria 5242
85 Ga0157375_10033996 3300013308 Bacteria 4852
86 Ga0157380_10001331 3300014326 Bacteria 16060
87 Ga0157380_10002361 3300014326 Bacteria 12689
88 Ga0157380_10017594 3300014326 Bacteria 5290
89 Ga0157380_10040003 3300014326 Bacteria 3649
90 Ga0157380_10040125 3300014326 Bacteria 3644
91 Ga0157380_10215593 3300014326 Bacteria 1714
92 Ga0157380_10236911 3300014326 Bacteria 1643
93 Ga0157376_10037687 3300014969 Bacteria 3928
94 Ga0163161_10026331 3300017792 Bacteria 4119
95 Ga0163161_10082309 3300017792 Bacteria 2371
96 Ga0163161_10169237 3300017792 Bacteria 1670
97 Ga0213876_10107601 3300021384 Bacteria 1479
98 Ga0207697_10010489 3300025315 Bacteria 3958
99 Ga0207682_10000574 3300025893 Bacteria 17003
100 Ga0207682_10007642 3300025893 Bacteria 4302
101 Ga0207710_10064565 3300025900 Bacteria 1667
102 Ga0207680_10053945 3300025903 Bacteria 2416
103 Ga0207645_10023363 3300025907 Bacteria 4019
104 Ga0207643_10047885 3300025908 Bacteria 2420
105 Ga0207707_10054933 3300025912 Bacteria 3466
106 Ga0207671_10144263 3300025914 Bacteria 1836
107 Ga0207660_10059161 3300025917 Bacteria 2750
108 Ga0207649_10094683 3300025920 Bacteria 1963
109 Ga0207650_10013121 3300025925 Bacteria 5733
110 Ga0207650_10078182 3300025925 Bacteria 2502
111 Ga0207650_10135636 3300025925 Bacteria 1930
112 Ga0207659_10004459 3300025926 Bacteria 8474
113 Ga0207659_10006073 3300025926 Bacteria 7375
114 Ga0207659_10009904 3300025926 Bacteria 5963
115 Ga0207659_10149248 3300025926 Bacteria 1824
116 Ga0207644_10001235 3300025931 Bacteria 16426
117 Ga0207706_10003718 3300025933 Bacteria 14556
118 Ga0207706_10013134 3300025933 Bacteria 7534
119 Ga0207670_10019603 3300025936 Bacteria 4134
120 Ga0207669_10005540 3300025937 Bacteria 5675
121 Ga0207704_10032831 3300025938 Bacteria 2944
122 Ga0207704_10290634 3300025938 Bacteria 1247
123 Ga0207691_10001749 3300025940 Bacteria 21391
124 Ga0207691_10004641 3300025940 Bacteria 13301
125 Ga0207691_10042854 3300025940 Bacteria 4172
126 Ga0207691_10049057 3300025940 Bacteria 3869
127 Ga0207711_10070472 3300025941 Bacteria 3032
128 Ga0207689_10040600 3300025942 Bacteria 3851
129 Ga0207689_10237559 3300025942 Bacteria 1506
130 Ga0207689_10391485 3300025942 Bacteria 1158
131 Ga0207679_10042846 3300025945 Bacteria 3255
132 Ga0207651_10248518 3300025960 Bacteria 1454
133 Ga0207712_10000049 3300025961 Bacteria 160026
134 Ga0207712_10005211 3300025961 Bacteria 8226
135 Ga0207668_10007337 3300025972 Bacteria 6552
136 Ga0207668_10039553 3300025972 Bacteria 3176
137 Ga0207668_10076551 3300025972 Bacteria 2409
138 Ga0207640_10024118 3300025981 Bacteria 3665
139 Ga0207678_10021710 3300026067 Bacteria 5630
140 Ga0207678_10300784 3300026067 Bacteria 1379
141 Ga0207708_10102814 3300026075 Bacteria 2212
142 Ga0207708_10258409 3300026075 Bacteria 1405
143 Ga0207641_10006171 3300026088 Bacteria 10141
144 Ga0207641_10011493 3300026088 Bacteria 7268
145 Ga0207648_10010075 3300026089 Bacteria 8988
146 Ga0207648_10052385 3300026089 Bacteria 3568
147 Ga0207648_10083132 3300026089 Bacteria 2792
148 Ga0207676_10012167 3300026095 Bacteria 6161
149 Ga0207674_10113659 3300026116 Bacteria 2680
150 Ga0207674_10137736 3300026116 Bacteria 2402
151 Ga0207675_100013911 3300026118 Bacteria 7502
152 Ga0207675_100019139 3300026118 Bacteria 6390
153 Ga0207675_100022432 3300026118 Bacteria 5879
154 Ga0207675_100033152 3300026118 Bacteria 4812
155 Ga0207675_100136312 3300026118 Bacteria 2329
156 Ga0207683_10015646 3300026121 Bacteria 6457
157 Ga0207683_10017059 3300026121 Bacteria 6180
158 Ga0207683_10083903 3300026121 Bacteria 2832
159 Ga0268266_10020561 3300028379 Bacteria 5624
160 Ga0268265_10000847 3300028380 Bacteria 28741
161 Ga0268265_10081850 3300028380 Bacteria 2551
162 Ga0268264_10001314 3300028381 Bacteria 23417
163 Ga0268264_10011183 3300028381 Bacteria 7411
164 Ga0265338_10026978 3300028800 Bacteria 5777
165 Ga0265340_10038120 3300031247 Bacteria 2379
166 Ga0307513_10048363 3300031456 Bacteria 4617
167 Ga0307513_10077113 3300031456 Bacteria 3453
168 Ga0265314_10049438 3300031711 Bacteria 2944
169 Ga0307413_10108644 3300031824 Bacteria 1852
170 Ga0307410_10019881 3300031852 Bacteria 4095
171 Ga0373937_0105899 3300036401 Bacteria 2614
172 Ga0395905_0179451 3300037471 Bacteria 1988
173 Ga0237819_00404 3300038705 Bacteria 15027
174 Ga0237816_00099 3300039145 Bacteria 6466
175 Ga0495617_001643 3300046452 Bacteria 9617
176 Ga0495638_0000123 3300046460 Bacteria 125420
177 Ga0495638_0027112 3300046460 Bacteria 3710
178 Ga0495650_0000408 3300046471 Bacteria 70787
179 Ga0495596_0000543 3300046500 Bacteria 23656
180 Ga0495583_0008092 3300046506 Bacteria 6479
181 Ga0495606_0000001 3300046507 Bacteria 592123
182 Ga0495606_0000440 3300046507 Bacteria 68395
183 Ga0495606_0001596 3300046507 Bacteria 29575
184 Ga0495606_0011146 3300046507 Bacteria 7365
185 Ga0495610_0001044 3300046512 Bacteria 25446
186 Ga0495610_0005286 3300046512 Bacteria 9233
187 Ga0495637_0006548 3300046520 Bacteria 5832
188 Ga0495643_0000240 3300046522 Bacteria 82228
189 Ga0495643_0022492 3300046522 Bacteria 3597
190 Ga0495663_0011895 3300046525 Bacteria 2424
191 Ga0495663_0020866 3300046525 Bacteria 1883
192 Ga0495663_0035346 3300046525 Bacteria 1500
193 Ga0495642_0010688 3300046528 Bacteria 3516
194 Ga0495642_0039010 3300046528 Bacteria 1926
195 Ga0495654_0025142 3300046530 Bacteria 3070
196 Ga0495609_0003273 3300046538 Bacteria 9354
197 Ga0495621_0002167 3300046539 Bacteria 5224
198 Ga0495622_0000044 3300046557 Bacteria 115528
199 Ga0495633_0002796 3300046558 Bacteria 12067
200 Ga0495633_0015202 3300046558 Bacteria 3999
201 Ga0495668_0000095 3300046616 Bacteria 141321
202 Ga0495668_0063564 3300046616 Bacteria 2033
203 Ga0495625_0002287 3300046660 Bacteria 20999
204 Ga0495625_0008134 3300046660 Bacteria 8986
205 Ga0495625_0105255 3300046660 Bacteria 1933
206 Ga0495670_0000272 3300046691 Bacteria 24314
207 Ga0495670_0035805 3300046691 Bacteria 2473
208 Ga0495670_0051710 3300046691 Bacteria 2056
209 Ga0495670_0112343 3300046691 Bacteria 1411
210 Ga0495670_0177894 3300046691 Bacteria 1122
211 Ga0495649_0010613 3300046694 Bacteria 5426
212 Ga0495672_0000366 3300047320 Bacteria 57469
213 Ga0495677_0077056 3300047445 Bacteria 1247
214 Ga0495673_0000113 3300047469 Bacteria 163495
215 Ga0495686_0005621 3300047472 Bacteria 9836
216 Ga0496101_0219169 3300048904 Bacteria 1476
217 Ga0496101_0220148 3300048904 Bacteria 1473
218 Ga0496102_0000477 3300048905 Bacteria 44404
219 Ga0496103_0075053 3300048906 Bacteria 2120
220 Ga0496106_0001734 3300048909 Bacteria 16286
221 Ga0496106_0005873 3300048909 Bacteria 9077
222 Ga0496107_0000030 3300048910 Bacteria 101737
223 Ga0496107_0000068 3300048910 Bacteria 51683
224 Ga0496111_0302914 3300048914 Bacteria 1185
225 Ga0496121_0000147 3300048924 Bacteria 154342
226 Ga0496121_0010865 3300048924 Bacteria 10178
227 Ga0496124_0140111 3300048927 Bacteria 1910
228 Ga0496126_0006858 3300048929 Bacteria 12625
229 Ga0496126_0119631 3300048929 Bacteria 2285
230 Ga0495678_000636 3300049459 Bacteria 32495
231 Ga0501074_0091267 3300049590 Bacteria 2181
232 Ga0501076_0147304 3300049592 Bacteria 1915
233 Ga0501077_0248329 3300049593 Bacteria 1131
234 Ga0501044_0003729 3300049823 Bacteria 17113
235 Ga0500643_002688 3300053087 Bacteria 8950
236 Ga0500643_013811 3300053087 Bacteria 2832
237 Ga0500641_0008438 3300053096 Bacteria 3677
238 Ga0500595_028784 3300053119 Bacteria 1892
239 Ga0500658_0000598 3300053134 Bacteria 14978
240 Ga0500568_0027969 3300053139 Bacteria 2354
241 Ga0500586_000051 3300053145 Bacteria 20590
242 Ga0500627_0000010 3300053158 Bacteria 152372
243 Ga0500637_0009316 3300053178 Bacteria 4994

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048914 Ga0496111_0302914 Ga0496111_0302914_29_847 259
2 3300037471 Ga0395905_0179451 Ga0395905_0179451_1119_1949 263
3 3300009093 Ga0105240_10073126 Ga0105240_100731262 264
4 3300046691 Ga0495670_0177894 Ga0495670_0177894_34_867 264
5 3300026075 Ga0207708_10258409 Ga0207708_102584092 270
6 3300053119 Ga0500595_028784 Ga0500595_028784_736_1740 277
7 3300048929 Ga0496126_0006858 Ga0496126_0006858_7205_8137 278
8 3300010375 Ga0105239_10019629 Ga0105239_100196295 282
9 3300046460 Ga0495638_0000123 Ga0495638_0000123_49985_50998 294
10 3300053134 Ga0500658_0000598 Ga0500658_0000598_3383_4396 294
11 3300046530 Ga0495654_0025142 Ga0495654_0025142_686_1690 295
12 3300048927 Ga0496124_0140111 Ga0496124_0140111_146_1168 295
13 3300053158 Ga0500627_0000010 Ga0500627_0000010_90475_91479 295
14 3300046522 Ga0495643_0022492 Ga0495643_0022492_1466_2467 297
15 3300038705 Ga0237819_00404 Ga0237819_00404_7501_8505 298
16 3300049590 Ga0501074_0091267 Ga0501074_0091267_727_1737 312
17 iso_pu_bacteria 8057101203 8057102451 312
18 3300047469 Ga0495673_0000113 Ga0495673_0000113_128936_129916 313
19 iso_pu_bacteria 2643221545 2643749939 313
20 iso_pu_bacteria 2643221691 2644510907 313
21 iso_pu_bacteria 2852680915 2852684841 314
22 3300003781 Ga0055536_1008543 Ga0055536_10085432 316
23 3300005548 Ga0070665_100306508 Ga0070665_1003065081 316
24 3300009545 Ga0105237_10139097 Ga0105237_101390971 316
25 3300025914 Ga0207671_10144263 Ga0207671_101442632 316
26 3300039145 Ga0237816_00099 Ga0237816_00099_2021_3019 316
27 3300053096 Ga0500641_0008438 Ga0500641_0008438_844_1833 316
28 3300053178 Ga0500637_0009316 Ga0500637_0009316_2485_3474 316
29 3300009174 Ga0105241_10280401 Ga0105241_102804012 317
30 3300046500 Ga0495596_0000543 Ga0495596_0000543_13146_14138 317
31 3300046507 Ga0495606_0011146 Ga0495606_0011146_2809_3801 317
32 3300046525 Ga0495663_0035346 Ga0495663_0035346_449_1444 317
33 3300046538 Ga0495609_0003273 Ga0495609_0003273_4660_5652 317
34 3300046660 Ga0495625_0008134 Ga0495625_0008134_875_1867 317
35 3300009094 Ga0111539_10487069 Ga0111539_104870691 319
36 3300048909 Ga0496106_0001734 Ga0496106_0001734_7240_8244 319
37 3300048910 Ga0496107_0000030 Ga0496107_0000030_57517_58521 319
38 3300048924 Ga0496121_0010865 Ga0496121_0010865_3552_4556 319
39 iso_pu_bacteria 2857558681 2857559251 319
40 iso_pu_bacteria 2857564685 2857566867 319
41 3300005458 Ga0070681_10101709 Ga0070681_101017093 320
42 3300005719 Ga0068861_100183548 Ga0068861_1001835482 320
43 3300009553 Ga0105249_10009858 Ga0105249_100098585 320
44 3300025912 Ga0207707_10054933 Ga0207707_100549332 320
45 3300025961 Ga0207712_10005211 Ga0207712_100052115 320
46 3300026118 Ga0207675_100136312 Ga0207675_1001363122 320
47 3300048924 Ga0496121_0000147 Ga0496121_0000147_16236_17237 320
48 3300049592 Ga0501076_0147304 Ga0501076_0147304_895_1896 320
49 3300049823 Ga0501044_0003729 Ga0501044_0003729_14071_15168 320
50 iso_pu_bacteria 2524023250 2524613406 320
51 3300005354 Ga0070675_100099388 Ga0070675_1000993882 321
52 3300005355 Ga0070671_100005845 Ga0070671_1000058453 321
53 3300005364 Ga0070673_100000794 Ga0070673_1000007949 321
54 3300005367 Ga0070667_100220278 Ga0070667_1002202781 321
55 3300005456 Ga0070678_100007147 Ga0070678_1000071473 321
56 3300005457 Ga0070662_100042186 Ga0070662_1000421862 321
57 3300005543 Ga0070672_100055461 Ga0070672_1000554612 321
58 3300005564 Ga0070664_100455688 Ga0070664_1004556882 321
59 3300009177 Ga0105248_10067943 Ga0105248_100679432 321
60 3300009177 Ga0105248_10236541 Ga0105248_102365412 321
61 3300013296 Ga0157374_10017499 Ga0157374_100174994 321
62 3300013306 Ga0163162_10044527 Ga0163162_100445272 321
63 3300013308 Ga0157375_10033996 Ga0157375_100339962 321
64 3300021384 Ga0213876_10107601 Ga0213876_101076012 321
65 3300025903 Ga0207680_10053945 Ga0207680_100539452 321
66 3300025926 Ga0207659_10009904 Ga0207659_100099042 321
67 3300025931 Ga0207644_10001235 Ga0207644_100012358 321
68 3300025933 Ga0207706_10013134 Ga0207706_100131342 321
69 3300025940 Ga0207691_10042854 Ga0207691_100428543 321
70 3300025941 Ga0207711_10070472 Ga0207711_100704722 321
71 3300025960 Ga0207651_10248518 Ga0207651_102485182 321
72 3300026121 Ga0207683_10015646 Ga0207683_100156463 321
73 3300028379 Ga0268266_10020561 Ga0268266_100205614 321
74 3300046557 Ga0495622_0000044 Ga0495622_0000044_24066_25115 321
75 3300046691 Ga0495670_0000272 Ga0495670_0000272_18542_19546 321
76 3300048904 Ga0496101_0220148 Ga0496101_0220148_441_1445 321
77 3300005330 Ga0070690_100010672 Ga0070690_1000106722 322
78 3300005331 Ga0070670_100072092 Ga0070670_1000720922 322
79 3300005333 Ga0070677_10005201 Ga0070677_100052012 322
80 3300005340 Ga0070689_100006274 Ga0070689_10000627410 322
81 3300005356 Ga0070674_100107157 Ga0070674_1001071572 322
82 3300005444 Ga0070694_100007921 Ga0070694_1000079212 322
83 3300005456 Ga0070678_100167711 Ga0070678_1001677112 322
84 3300005459 Ga0068867_100220606 Ga0068867_1002206062 322
85 3300005466 Ga0070685_10019632 Ga0070685_100196323 322
86 3300005539 Ga0068853_100461417 Ga0068853_1004614172 322
87 3300005617 Ga0068859_100240184 Ga0068859_1002401842 322
88 3300005840 Ga0068870_10003651 Ga0068870_100036513 322
89 3300005843 Ga0068860_100025901 Ga0068860_1000259012 322
90 3300005844 Ga0068862_100007472 Ga0068862_1000074722 322
91 3300006881 Ga0068865_100037610 Ga0068865_1000376102 322
92 3300006931 Ga0097620_100240192 Ga0097620_1002401922 322
93 3300014326 Ga0157380_10017594 Ga0157380_100175942 322
94 3300025893 Ga0207682_10007642 Ga0207682_100076423 322
95 3300025925 Ga0207650_10013121 Ga0207650_100131214 322
96 3300025926 Ga0207659_10006073 Ga0207659_100060736 322
97 3300025936 Ga0207670_10019603 Ga0207670_100196032 322
98 3300025937 Ga0207669_10005540 Ga0207669_100055404 322
99 3300025940 Ga0207691_10001749 Ga0207691_100017492 322
100 3300025972 Ga0207668_10039553 Ga0207668_100395532 322
101 3300026089 Ga0207648_10052385 Ga0207648_100523853 322
102 3300026095 Ga0207676_10012167 Ga0207676_100121673 322
103 3300026121 Ga0207683_10017059 Ga0207683_100170595 322
104 3300028381 Ga0268264_10011183 Ga0268264_100111835 322
105 3300005293 Ga0065715_10000654 Ga0065715_100006543 323
106 3300005328 Ga0070676_10000723 Ga0070676_100007233 323
107 3300005331 Ga0070670_100011761 Ga0070670_1000117617 323
108 3300005333 Ga0070677_10000558 Ga0070677_100005585 323
109 3300005334 Ga0068869_100014714 Ga0068869_1000147142 323
110 3300005337 Ga0070682_100024135 Ga0070682_1000241352 323
111 3300005340 Ga0070689_100052513 Ga0070689_1000525132 323
112 3300005344 Ga0070661_100090818 Ga0070661_1000908182 323
113 3300005347 Ga0070668_100005952 Ga0070668_1000059528 323
114 3300005347 Ga0070668_100008871 Ga0070668_1000088714 323
115 3300005354 Ga0070675_100002886 Ga0070675_1000028863 323
116 3300005354 Ga0070675_100007653 Ga0070675_1000076535 323
117 3300005354 Ga0070675_100435092 Ga0070675_1004350921 323
118 3300005355 Ga0070671_100050036 Ga0070671_1000500362 323
119 3300005356 Ga0070674_100003058 Ga0070674_1000030582 323
120 3300005441 Ga0070700_100307498 Ga0070700_1003074981 323
121 3300005457 Ga0070662_100006018 Ga0070662_1000060187 323
122 3300005459 Ga0068867_100005745 Ga0068867_1000057457 323
123 3300005459 Ga0068867_100028315 Ga0068867_1000283151 323
124 3300005459 Ga0068867_100155035 Ga0068867_1001550352 323
125 3300005543 Ga0070672_100005293 Ga0070672_1000052933 323
126 3300005544 Ga0070686_100030709 Ga0070686_1000307092 323
127 3300005548 Ga0070665_100028567 Ga0070665_1000285674 323
128 3300005548 Ga0070665_100137587 Ga0070665_1001375872 323
129 3300005578 Ga0068854_100032214 Ga0068854_1000322142 323
130 3300005617 Ga0068859_100005561 Ga0068859_10000556113 323
131 3300005719 Ga0068861_100016127 Ga0068861_1000161273 323
132 3300005719 Ga0068861_100108902 Ga0068861_1001089022 323
133 3300005719 Ga0068861_100120691 Ga0068861_1001206912 323
134 3300005840 Ga0068870_10037657 Ga0068870_100376572 323
135 3300005841 Ga0068863_100043399 Ga0068863_1000433993 323
136 3300005843 Ga0068860_100079162 Ga0068860_1000791622 323
137 3300005844 Ga0068862_100000074 Ga0068862_100000074102 323
138 3300005844 Ga0068862_100022420 Ga0068862_1000224202 323
139 3300005844 Ga0068862_100182837 Ga0068862_1001828372 323
140 3300006358 Ga0068871_100012634 Ga0068871_1000126342 323
141 3300006931 Ga0097620_100005561 Ga0097620_10000556113 323
142 3300009036 Ga0105244_10020329 Ga0105244_100203292 323
143 3300009101 Ga0105247_10099522 Ga0105247_100995222 323
144 3300009177 Ga0105248_10016395 Ga0105248_100163954 323
145 3300009177 Ga0105248_10296553 Ga0105248_102965532 323
146 3300009553 Ga0105249_10000286 Ga0105249_1000028637 323
147 3300013102 Ga0157371_10196536 Ga0157371_101965362 323
148 3300013308 Ga0157375_10028412 Ga0157375_100284123 323
149 3300014326 Ga0157380_10001331 Ga0157380_100013319 323
150 3300014326 Ga0157380_10002361 Ga0157380_1000236112 323
151 3300014326 Ga0157380_10040003 Ga0157380_100400032 323
152 3300014326 Ga0157380_10040125 Ga0157380_100401253 323
153 3300014326 Ga0157380_10215593 Ga0157380_102155932 323
154 3300014326 Ga0157380_10236911 Ga0157380_102369112 323
155 3300014969 Ga0157376_10037687 Ga0157376_100376872 323
156 3300017792 Ga0163161_10026331 Ga0163161_100263313 323
157 3300017792 Ga0163161_10082309 Ga0163161_100823092 323
158 3300017792 Ga0163161_10169237 Ga0163161_101692372 323
159 3300025315 Ga0207697_10010489 Ga0207697_100104892 323
160 3300025893 Ga0207682_10000574 Ga0207682_100005748 323
161 3300025900 Ga0207710_10064565 Ga0207710_100645652 323
162 3300025907 Ga0207645_10023363 Ga0207645_100233632 323
163 3300025908 Ga0207643_10047885 Ga0207643_100478852 323
164 3300025917 Ga0207660_10059161 Ga0207660_100591612 323
165 3300025920 Ga0207649_10094683 Ga0207649_100946832 323
166 3300025925 Ga0207650_10078182 Ga0207650_100781822 323
167 3300025925 Ga0207650_10135636 Ga0207650_101356362 323
168 3300025926 Ga0207659_10004459 Ga0207659_100044592 323
169 3300025926 Ga0207659_10149248 Ga0207659_101492482 323
170 3300025933 Ga0207706_10003718 Ga0207706_1000371815 323
171 3300025938 Ga0207704_10032831 Ga0207704_100328313 323
172 3300025938 Ga0207704_10290634 Ga0207704_102906342 323
173 3300025940 Ga0207691_10004641 Ga0207691_1000464113 323
174 3300025940 Ga0207691_10049057 Ga0207691_100490573 323
175 3300025942 Ga0207689_10040600 Ga0207689_100406003 323
176 3300025942 Ga0207689_10237559 Ga0207689_102375592 323
177 3300025942 Ga0207689_10391485 Ga0207689_103914851 323
178 3300025945 Ga0207679_10042846 Ga0207679_100428463 323
179 3300025961 Ga0207712_10000049 Ga0207712_1000004916 323
180 3300025972 Ga0207668_10007337 Ga0207668_100073372 323
181 3300025972 Ga0207668_10076551 Ga0207668_100765512 323
182 3300025981 Ga0207640_10024118 Ga0207640_100241182 323
183 3300026067 Ga0207678_10021710 Ga0207678_100217102 323
184 3300026067 Ga0207678_10300784 Ga0207678_103007842 323
185 3300026075 Ga0207708_10102814 Ga0207708_101028142 323
186 3300026088 Ga0207641_10006171 Ga0207641_100061713 323
187 3300026088 Ga0207641_10011493 Ga0207641_100114933 323
188 3300026089 Ga0207648_10010075 Ga0207648_100100757 323
189 3300026089 Ga0207648_10083132 Ga0207648_100831322 323
190 3300026116 Ga0207674_10113659 Ga0207674_101136592 323
191 3300026116 Ga0207674_10137736 Ga0207674_101377362 323
192 3300026118 Ga0207675_100013911 Ga0207675_1000139115 323
193 3300026118 Ga0207675_100019139 Ga0207675_1000191392 323
194 3300026118 Ga0207675_100022432 Ga0207675_1000224323 323
195 3300026118 Ga0207675_100033152 Ga0207675_1000331523 323
196 3300026121 Ga0207683_10083903 Ga0207683_100839033 323
197 3300028380 Ga0268265_10000847 Ga0268265_1000084712 323
198 3300028380 Ga0268265_10081850 Ga0268265_100818502 323
199 3300028381 Ga0268264_10001314 Ga0268264_1000131420 323
200 3300028800 Ga0265338_10026978 Ga0265338_100269783 323
201 3300031247 Ga0265340_10038120 Ga0265340_100381202 323
202 3300031456 Ga0307513_10048363 Ga0307513_100483632 323
203 3300031456 Ga0307513_10077113 Ga0307513_100771133 323
204 3300031711 Ga0265314_10049438 Ga0265314_100494382 323
205 3300031824 Ga0307413_10108644 Ga0307413_101086442 323
206 3300031852 Ga0307410_10019881 Ga0307410_100198811 323
207 3300036401 Ga0373937_0105899 Ga0373937_0105899_921_1931 323
208 3300046452 Ga0495617_001643 Ga0495617_001643_6670_7680 323
209 3300046506 Ga0495583_0008092 Ga0495583_0008092_1530_2540 323
210 3300046507 Ga0495606_0000001 Ga0495606_0000001_113755_114765 323
211 3300046507 Ga0495606_0000440 Ga0495606_0000440_63211_64221 323
212 3300046507 Ga0495606_0001596 Ga0495606_0001596_16097_17107 323
213 3300046512 Ga0495610_0001044 Ga0495610_0001044_14088_15098 323
214 3300046512 Ga0495610_0005286 Ga0495610_0005286_839_1849 323
215 3300046520 Ga0495637_0006548 Ga0495637_0006548_1127_2137 323
216 3300046522 Ga0495643_0000240 Ga0495643_0000240_52740_53750 323
217 3300046525 Ga0495663_0011895 Ga0495663_0011895_632_1642 323
218 3300046525 Ga0495663_0020866 Ga0495663_0020866_722_1732 323
219 3300046528 Ga0495642_0010688 Ga0495642_0010688_2461_3471 323
220 3300046528 Ga0495642_0039010 Ga0495642_0039010_501_1511 323
221 3300046539 Ga0495621_0002167 Ga0495621_0002167_583_1593 323
222 3300046558 Ga0495633_0002796 Ga0495633_0002796_1949_2959 323
223 3300046558 Ga0495633_0015202 Ga0495633_0015202_2771_3781 323
224 3300046616 Ga0495668_0000095 Ga0495668_0000095_36907_37917 323
225 3300046616 Ga0495668_0063564 Ga0495668_0063564_418_1428 323
226 3300046660 Ga0495625_0105255 Ga0495625_0105255_895_1905 323
227 3300046691 Ga0495670_0035805 Ga0495670_0035805_925_1935 323
228 3300046691 Ga0495670_0051710 Ga0495670_0051710_39_1049 323
229 3300046691 Ga0495670_0112343 Ga0495670_0112343_175_1188 323
230 3300046694 Ga0495649_0010613 Ga0495649_0010613_467_1477 323
231 3300047320 Ga0495672_0000366 Ga0495672_0000366_7780_8790 323
232 3300047445 Ga0495677_0077056 Ga0495677_0077056_114_1124 323
233 3300047472 Ga0495686_0005621 Ga0495686_0005621_767_1777 323
234 3300048905 Ga0496102_0000477 Ga0496102_0000477_2089_3099 323
235 3300048906 Ga0496103_0075053 Ga0496103_0075053_19_1029 323
236 3300048929 Ga0496126_0119631 Ga0496126_0119631_1106_2116 323
237 3300049459 Ga0495678_000636 Ga0495678_000636_8051_9061 323
238 3300049593 Ga0501077_0248329 Ga0501077_0248329_103_1113 323
239 3300053087 Ga0500643_002688 Ga0500643_002688_3566_4576 323
240 3300053087 Ga0500643_013811 Ga0500643_013811_1731_2780 323
241 3300053139 Ga0500568_0027969 Ga0500568_0027969_1092_2105 323
242 3300053145 Ga0500586_000051 Ga0500586_000051_17707_18717 323
243 3300003316 rootH1_10086130 rootH1_100861303 324
244 3300003322 rootL2_10055226 rootL2_100552265 324
245 3300046460 Ga0495638_0027112 Ga0495638_0027112_23_1039 324
246 3300046471 Ga0495650_0000408 Ga0495650_0000408_17294_18310 324
247 3300046660 Ga0495625_0002287 Ga0495625_0002287_15575_16597 324
248 3300048904 Ga0496101_0219169 Ga0496101_0219169_399_1412 324
249 3300048909 Ga0496106_0005873 Ga0496106_0005873_6733_7746 324
250 3300048910 Ga0496107_0000068 Ga0496107_0000068_24819_25832 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

6

117

0.87

PF13378

MR_MLE_C

Enolase C-terminal domain-like

131

328

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gfi-assembly4.cif.gz_D crystal structure of efi-502318, an enolase family member from agrobacterium tumefaciens with homology to dipeptide epimerases (bound sodium, l-ala-l-glu with ordered loop) 0.9217 4 309
1jpd-assembly1.cif.gz_X l-ala-d/l-glu epimerase 0.9039 2 310
1nu5-assembly1.cif.gz_A crystal structure of pseudomonas sp. p51 chloromuconate lactonizing enzyme 0.8944 1 315
2p88-assembly1.cif.gz_D crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 0.8899 3 316
1jpm-assembly1.cif.gz_B l-ala-d/l-glu epimerase 0.8795 1 313
ID Description Score Start End Superfamily
4gfiD01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9459 4 105 3.30.390.10
1jpdX01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9432 1 102 3.30.390.10
4gfiD01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.92 4 105 3.30.390.10
3q45A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9115 108 308 3.20.20.120
1jpdX02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.908 118 310 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A2V6GTA7-F1-model_v4 Dipeptide epimerase 0.9752 136 267 GO:0016854
AF-A0A523FKF8-F1-model_v4 Dipeptide epimerase (EC 5.1.1.-) 0.9731 6 263 GO:0000287
GO:0009063
GO:0016855
AF-A0A2V5SAW7-F1-model_v4 Dipeptide epimerase (EC 5.1.1.-) 0.9724 4 271 GO:0016855
GO:0046872
AF-A0A062VGQ1-F1-model_v4 Dipeptide epimerase (EC 5.1.1.-) 0.9718 5 315 GO:0000287
GO:0009063
GO:0016855
AF-X0UYL6-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein 0.9664 100 274 GO:0016854

Feature Viewer

pLDDT pTM Quality
90.96 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map