F361665
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 156 | 243 | 331 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10026978|Ga0265338_100269783 |
| Length | 358 |
| Sequence | MSASERLTLTVKAETIPLKEPFYISGYTFEAVNLAVVELRQGPFLGRGEASGIYYFKEDAQRMGVAIEAVRAEIEAGITREALAALMPPGGARNAVDCALWELEAQRAGWPVWMLAGVGEPVPKITTFTLSAEAPERMAKAARGFGQAKALKLKLTGEDPALDAERVRVVRAVRPDVWMGVDGNQGFTPDRLEKLTPALLDAKVELVEQPFPRGCDAWMAGLDYPIATAADESVQGLEELEGLTDFDVVNIKLDKCGGLTEALAMARLARRMGLGVMVGNMVGTSWAMAPAFVVGQLCDIVDLDGPVVLRRDRKPHIAYRGGRICCDDAVWGAPAAPKPRRPRPFASRWGSYAPDQKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 2 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 3 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 4 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 5 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 6 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 64 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 102 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 103 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 105 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 106 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 108 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 109 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 110 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 136 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 137 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 138 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 139 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 140 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 141 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 142 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 143 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 149 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 150 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 151 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 152 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 153 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 154 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 155 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 156 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.2 |
| Metatranscriptomes | 0 |
| Isolates | 2.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4 |
| Nodule | 0 |
| Rhizoplane | 3.6 |
| Rhizosphere | 85.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10086130 | 3300003316 | Bacteria | 3727 |
| 2 | rootL2_10055226 | 3300003322 | Bacteria | 7737 |
| 3 | Ga0055536_1008543 | 3300003781 | Bacteria | 4387 |
| 4 | Ga0065715_10000654 | 3300005293 | Bacteria | 13208 |
| 5 | Ga0070676_10000723 | 3300005328 | Bacteria | 16161 |
| 6 | Ga0070690_100010672 | 3300005330 | Bacteria | 5353 |
| 7 | Ga0070670_100011761 | 3300005331 | Bacteria | 7486 |
| 8 | Ga0070670_100072092 | 3300005331 | Bacteria | 2966 |
| 9 | Ga0070677_10000558 | 3300005333 | Bacteria | 12706 |
| 10 | Ga0070677_10005201 | 3300005333 | Bacteria | 4280 |
| 11 | Ga0068869_100014714 | 3300005334 | Bacteria | 5232 |
| 12 | Ga0070682_100024135 | 3300005337 | Bacteria | 3616 |
| 13 | Ga0070689_100006274 | 3300005340 | Bacteria | 8206 |
| 14 | Ga0070689_100052513 | 3300005340 | Bacteria | 3153 |
| 15 | Ga0070661_100090818 | 3300005344 | Bacteria | 2262 |
| 16 | Ga0070668_100005952 | 3300005347 | Bacteria | 9042 |
| 17 | Ga0070668_100008871 | 3300005347 | Bacteria | 7466 |
| 18 | Ga0070675_100002886 | 3300005354 | Bacteria | 12958 |
| 19 | Ga0070675_100007653 | 3300005354 | Bacteria | 8359 |
| 20 | Ga0070675_100099388 | 3300005354 | Bacteria | 2449 |
| 21 | Ga0070675_100435092 | 3300005354 | Bacteria | 1175 |
| 22 | Ga0070671_100005845 | 3300005355 | Bacteria | 9801 |
| 23 | Ga0070671_100050036 | 3300005355 | Bacteria | 3476 |
| 24 | Ga0070674_100003058 | 3300005356 | Bacteria | 9310 |
| 25 | Ga0070674_100107157 | 3300005356 | Bacteria | 2046 |
| 26 | Ga0070673_100000794 | 3300005364 | Bacteria | 17571 |
| 27 | Ga0070667_100220278 | 3300005367 | Bacteria | 1689 |
| 28 | Ga0070700_100307498 | 3300005441 | Bacteria | 1159 |
| 29 | Ga0070694_100007921 | 3300005444 | Bacteria | 6488 |
| 30 | Ga0070678_100007147 | 3300005456 | Bacteria | 6602 |
| 31 | Ga0070678_100167711 | 3300005456 | Bacteria | 1785 |
| 32 | Ga0070662_100006018 | 3300005457 | Bacteria | 7782 |
| 33 | Ga0070662_100042186 | 3300005457 | Bacteria | 3258 |
| 34 | Ga0070681_10101709 | 3300005458 | Bacteria | 2819 |
| 35 | Ga0068867_100005745 | 3300005459 | Bacteria | 8801 |
| 36 | Ga0068867_100028315 | 3300005459 | Bacteria | 4034 |
| 37 | Ga0068867_100155035 | 3300005459 | Bacteria | 1802 |
| 38 | Ga0068867_100220606 | 3300005459 | Bacteria | 1528 |
| 39 | Ga0070685_10019632 | 3300005466 | Bacteria | 3650 |
| 40 | Ga0068853_100461417 | 3300005539 | Bacteria | 1196 |
| 41 | Ga0070672_100005293 | 3300005543 | Bacteria | 8539 |
| 42 | Ga0070672_100055461 | 3300005543 | Bacteria | 3105 |
| 43 | Ga0070686_100030709 | 3300005544 | Bacteria | 3279 |
| 44 | Ga0070665_100028567 | 3300005548 | Bacteria | 5617 |
| 45 | Ga0070665_100137587 | 3300005548 | Bacteria | 2445 |
| 46 | Ga0070665_100306508 | 3300005548 | Bacteria | 1591 |
| 47 | Ga0070664_100455688 | 3300005564 | Bacteria | 1175 |
| 48 | Ga0068854_100032214 | 3300005578 | Bacteria | 3645 |
| 49 | Ga0068859_100005561 | 3300005617 | Bacteria | 12836 |
| 50 | Ga0068859_100240184 | 3300005617 | Bacteria | 1901 |
| 51 | Ga0068861_100016127 | 3300005719 | Bacteria | 5279 |
| 52 | Ga0068861_100108902 | 3300005719 | Bacteria | 2217 |
| 53 | Ga0068861_100120691 | 3300005719 | Bacteria | 2114 |
| 54 | Ga0068861_100183548 | 3300005719 | Bacteria | 1743 |
| 55 | Ga0068870_10003651 | 3300005840 | Bacteria | 6535 |
| 56 | Ga0068870_10037657 | 3300005840 | Bacteria | 2494 |
| 57 | Ga0068863_100043399 | 3300005841 | Bacteria | 4269 |
| 58 | Ga0068860_100025901 | 3300005843 | Bacteria | 5658 |
| 59 | Ga0068860_100079162 | 3300005843 | Bacteria | 3125 |
| 60 | Ga0068862_100000074 | 3300005844 | Bacteria | 118036 |
| 61 | Ga0068862_100007472 | 3300005844 | Bacteria | 9058 |
| 62 | Ga0068862_100022420 | 3300005844 | Bacteria | 5282 |
| 63 | Ga0068862_100182837 | 3300005844 | Bacteria | 1882 |
| 64 | Ga0068871_100012634 | 3300006358 | Bacteria | 6236 |
| 65 | Ga0068865_100037610 | 3300006881 | Bacteria | 3269 |
| 66 | Ga0097620_100005561 | 3300006931 | Bacteria | 12836 |
| 67 | Ga0097620_100240192 | 3300006931 | Bacteria | 1901 |
| 68 | Ga0105244_10020329 | 3300009036 | Bacteria | 3691 |
| 69 | Ga0105240_10073126 | 3300009093 | Bacteria | 4234 |
| 70 | Ga0111539_10487069 | 3300009094 | Bacteria | 1436 |
| 71 | Ga0105247_10099522 | 3300009101 | Bacteria | 1857 |
| 72 | Ga0105241_10280401 | 3300009174 | Bacteria | 1423 |
| 73 | Ga0105248_10016395 | 3300009177 | Bacteria | 8154 |
| 74 | Ga0105248_10067943 | 3300009177 | Bacteria | 4002 |
| 75 | Ga0105248_10236541 | 3300009177 | Bacteria | 2056 |
| 76 | Ga0105248_10296553 | 3300009177 | Bacteria | 1820 |
| 77 | Ga0105237_10139097 | 3300009545 | Bacteria | 2422 |
| 78 | Ga0105249_10000286 | 3300009553 | Bacteria | 52146 |
| 79 | Ga0105249_10009858 | 3300009553 | Bacteria | 8374 |
| 80 | Ga0105239_10019629 | 3300010375 | Bacteria | 7461 |
| 81 | Ga0157371_10196536 | 3300013102 | Bacteria | 1445 |
| 82 | Ga0157374_10017499 | 3300013296 | Bacteria | 6312 |
| 83 | Ga0163162_10044527 | 3300013306 | Bacteria | 4446 |
| 84 | Ga0157375_10028412 | 3300013308 | Bacteria | 5242 |
| 85 | Ga0157375_10033996 | 3300013308 | Bacteria | 4852 |
| 86 | Ga0157380_10001331 | 3300014326 | Bacteria | 16060 |
| 87 | Ga0157380_10002361 | 3300014326 | Bacteria | 12689 |
| 88 | Ga0157380_10017594 | 3300014326 | Bacteria | 5290 |
| 89 | Ga0157380_10040003 | 3300014326 | Bacteria | 3649 |
| 90 | Ga0157380_10040125 | 3300014326 | Bacteria | 3644 |
| 91 | Ga0157380_10215593 | 3300014326 | Bacteria | 1714 |
| 92 | Ga0157380_10236911 | 3300014326 | Bacteria | 1643 |
| 93 | Ga0157376_10037687 | 3300014969 | Bacteria | 3928 |
| 94 | Ga0163161_10026331 | 3300017792 | Bacteria | 4119 |
| 95 | Ga0163161_10082309 | 3300017792 | Bacteria | 2371 |
| 96 | Ga0163161_10169237 | 3300017792 | Bacteria | 1670 |
| 97 | Ga0213876_10107601 | 3300021384 | Bacteria | 1479 |
| 98 | Ga0207697_10010489 | 3300025315 | Bacteria | 3958 |
| 99 | Ga0207682_10000574 | 3300025893 | Bacteria | 17003 |
| 100 | Ga0207682_10007642 | 3300025893 | Bacteria | 4302 |
| 101 | Ga0207710_10064565 | 3300025900 | Bacteria | 1667 |
| 102 | Ga0207680_10053945 | 3300025903 | Bacteria | 2416 |
| 103 | Ga0207645_10023363 | 3300025907 | Bacteria | 4019 |
| 104 | Ga0207643_10047885 | 3300025908 | Bacteria | 2420 |
| 105 | Ga0207707_10054933 | 3300025912 | Bacteria | 3466 |
| 106 | Ga0207671_10144263 | 3300025914 | Bacteria | 1836 |
| 107 | Ga0207660_10059161 | 3300025917 | Bacteria | 2750 |
| 108 | Ga0207649_10094683 | 3300025920 | Bacteria | 1963 |
| 109 | Ga0207650_10013121 | 3300025925 | Bacteria | 5733 |
| 110 | Ga0207650_10078182 | 3300025925 | Bacteria | 2502 |
| 111 | Ga0207650_10135636 | 3300025925 | Bacteria | 1930 |
| 112 | Ga0207659_10004459 | 3300025926 | Bacteria | 8474 |
| 113 | Ga0207659_10006073 | 3300025926 | Bacteria | 7375 |
| 114 | Ga0207659_10009904 | 3300025926 | Bacteria | 5963 |
| 115 | Ga0207659_10149248 | 3300025926 | Bacteria | 1824 |
| 116 | Ga0207644_10001235 | 3300025931 | Bacteria | 16426 |
| 117 | Ga0207706_10003718 | 3300025933 | Bacteria | 14556 |
| 118 | Ga0207706_10013134 | 3300025933 | Bacteria | 7534 |
| 119 | Ga0207670_10019603 | 3300025936 | Bacteria | 4134 |
| 120 | Ga0207669_10005540 | 3300025937 | Bacteria | 5675 |
| 121 | Ga0207704_10032831 | 3300025938 | Bacteria | 2944 |
| 122 | Ga0207704_10290634 | 3300025938 | Bacteria | 1247 |
| 123 | Ga0207691_10001749 | 3300025940 | Bacteria | 21391 |
| 124 | Ga0207691_10004641 | 3300025940 | Bacteria | 13301 |
| 125 | Ga0207691_10042854 | 3300025940 | Bacteria | 4172 |
| 126 | Ga0207691_10049057 | 3300025940 | Bacteria | 3869 |
| 127 | Ga0207711_10070472 | 3300025941 | Bacteria | 3032 |
| 128 | Ga0207689_10040600 | 3300025942 | Bacteria | 3851 |
| 129 | Ga0207689_10237559 | 3300025942 | Bacteria | 1506 |
| 130 | Ga0207689_10391485 | 3300025942 | Bacteria | 1158 |
| 131 | Ga0207679_10042846 | 3300025945 | Bacteria | 3255 |
| 132 | Ga0207651_10248518 | 3300025960 | Bacteria | 1454 |
| 133 | Ga0207712_10000049 | 3300025961 | Bacteria | 160026 |
| 134 | Ga0207712_10005211 | 3300025961 | Bacteria | 8226 |
| 135 | Ga0207668_10007337 | 3300025972 | Bacteria | 6552 |
| 136 | Ga0207668_10039553 | 3300025972 | Bacteria | 3176 |
| 137 | Ga0207668_10076551 | 3300025972 | Bacteria | 2409 |
| 138 | Ga0207640_10024118 | 3300025981 | Bacteria | 3665 |
| 139 | Ga0207678_10021710 | 3300026067 | Bacteria | 5630 |
| 140 | Ga0207678_10300784 | 3300026067 | Bacteria | 1379 |
| 141 | Ga0207708_10102814 | 3300026075 | Bacteria | 2212 |
| 142 | Ga0207708_10258409 | 3300026075 | Bacteria | 1405 |
| 143 | Ga0207641_10006171 | 3300026088 | Bacteria | 10141 |
| 144 | Ga0207641_10011493 | 3300026088 | Bacteria | 7268 |
| 145 | Ga0207648_10010075 | 3300026089 | Bacteria | 8988 |
| 146 | Ga0207648_10052385 | 3300026089 | Bacteria | 3568 |
| 147 | Ga0207648_10083132 | 3300026089 | Bacteria | 2792 |
| 148 | Ga0207676_10012167 | 3300026095 | Bacteria | 6161 |
| 149 | Ga0207674_10113659 | 3300026116 | Bacteria | 2680 |
| 150 | Ga0207674_10137736 | 3300026116 | Bacteria | 2402 |
| 151 | Ga0207675_100013911 | 3300026118 | Bacteria | 7502 |
| 152 | Ga0207675_100019139 | 3300026118 | Bacteria | 6390 |
| 153 | Ga0207675_100022432 | 3300026118 | Bacteria | 5879 |
| 154 | Ga0207675_100033152 | 3300026118 | Bacteria | 4812 |
| 155 | Ga0207675_100136312 | 3300026118 | Bacteria | 2329 |
| 156 | Ga0207683_10015646 | 3300026121 | Bacteria | 6457 |
| 157 | Ga0207683_10017059 | 3300026121 | Bacteria | 6180 |
| 158 | Ga0207683_10083903 | 3300026121 | Bacteria | 2832 |
| 159 | Ga0268266_10020561 | 3300028379 | Bacteria | 5624 |
| 160 | Ga0268265_10000847 | 3300028380 | Bacteria | 28741 |
| 161 | Ga0268265_10081850 | 3300028380 | Bacteria | 2551 |
| 162 | Ga0268264_10001314 | 3300028381 | Bacteria | 23417 |
| 163 | Ga0268264_10011183 | 3300028381 | Bacteria | 7411 |
| 164 | Ga0265338_10026978 | 3300028800 | Bacteria | 5777 |
| 165 | Ga0265340_10038120 | 3300031247 | Bacteria | 2379 |
| 166 | Ga0307513_10048363 | 3300031456 | Bacteria | 4617 |
| 167 | Ga0307513_10077113 | 3300031456 | Bacteria | 3453 |
| 168 | Ga0265314_10049438 | 3300031711 | Bacteria | 2944 |
| 169 | Ga0307413_10108644 | 3300031824 | Bacteria | 1852 |
| 170 | Ga0307410_10019881 | 3300031852 | Bacteria | 4095 |
| 171 | Ga0373937_0105899 | 3300036401 | Bacteria | 2614 |
| 172 | Ga0395905_0179451 | 3300037471 | Bacteria | 1988 |
| 173 | Ga0237819_00404 | 3300038705 | Bacteria | 15027 |
| 174 | Ga0237816_00099 | 3300039145 | Bacteria | 6466 |
| 175 | Ga0495617_001643 | 3300046452 | Bacteria | 9617 |
| 176 | Ga0495638_0000123 | 3300046460 | Bacteria | 125420 |
| 177 | Ga0495638_0027112 | 3300046460 | Bacteria | 3710 |
| 178 | Ga0495650_0000408 | 3300046471 | Bacteria | 70787 |
| 179 | Ga0495596_0000543 | 3300046500 | Bacteria | 23656 |
| 180 | Ga0495583_0008092 | 3300046506 | Bacteria | 6479 |
| 181 | Ga0495606_0000001 | 3300046507 | Bacteria | 592123 |
| 182 | Ga0495606_0000440 | 3300046507 | Bacteria | 68395 |
| 183 | Ga0495606_0001596 | 3300046507 | Bacteria | 29575 |
| 184 | Ga0495606_0011146 | 3300046507 | Bacteria | 7365 |
| 185 | Ga0495610_0001044 | 3300046512 | Bacteria | 25446 |
| 186 | Ga0495610_0005286 | 3300046512 | Bacteria | 9233 |
| 187 | Ga0495637_0006548 | 3300046520 | Bacteria | 5832 |
| 188 | Ga0495643_0000240 | 3300046522 | Bacteria | 82228 |
| 189 | Ga0495643_0022492 | 3300046522 | Bacteria | 3597 |
| 190 | Ga0495663_0011895 | 3300046525 | Bacteria | 2424 |
| 191 | Ga0495663_0020866 | 3300046525 | Bacteria | 1883 |
| 192 | Ga0495663_0035346 | 3300046525 | Bacteria | 1500 |
| 193 | Ga0495642_0010688 | 3300046528 | Bacteria | 3516 |
| 194 | Ga0495642_0039010 | 3300046528 | Bacteria | 1926 |
| 195 | Ga0495654_0025142 | 3300046530 | Bacteria | 3070 |
| 196 | Ga0495609_0003273 | 3300046538 | Bacteria | 9354 |
| 197 | Ga0495621_0002167 | 3300046539 | Bacteria | 5224 |
| 198 | Ga0495622_0000044 | 3300046557 | Bacteria | 115528 |
| 199 | Ga0495633_0002796 | 3300046558 | Bacteria | 12067 |
| 200 | Ga0495633_0015202 | 3300046558 | Bacteria | 3999 |
| 201 | Ga0495668_0000095 | 3300046616 | Bacteria | 141321 |
| 202 | Ga0495668_0063564 | 3300046616 | Bacteria | 2033 |
| 203 | Ga0495625_0002287 | 3300046660 | Bacteria | 20999 |
| 204 | Ga0495625_0008134 | 3300046660 | Bacteria | 8986 |
| 205 | Ga0495625_0105255 | 3300046660 | Bacteria | 1933 |
| 206 | Ga0495670_0000272 | 3300046691 | Bacteria | 24314 |
| 207 | Ga0495670_0035805 | 3300046691 | Bacteria | 2473 |
| 208 | Ga0495670_0051710 | 3300046691 | Bacteria | 2056 |
| 209 | Ga0495670_0112343 | 3300046691 | Bacteria | 1411 |
| 210 | Ga0495670_0177894 | 3300046691 | Bacteria | 1122 |
| 211 | Ga0495649_0010613 | 3300046694 | Bacteria | 5426 |
| 212 | Ga0495672_0000366 | 3300047320 | Bacteria | 57469 |
| 213 | Ga0495677_0077056 | 3300047445 | Bacteria | 1247 |
| 214 | Ga0495673_0000113 | 3300047469 | Bacteria | 163495 |
| 215 | Ga0495686_0005621 | 3300047472 | Bacteria | 9836 |
| 216 | Ga0496101_0219169 | 3300048904 | Bacteria | 1476 |
| 217 | Ga0496101_0220148 | 3300048904 | Bacteria | 1473 |
| 218 | Ga0496102_0000477 | 3300048905 | Bacteria | 44404 |
| 219 | Ga0496103_0075053 | 3300048906 | Bacteria | 2120 |
| 220 | Ga0496106_0001734 | 3300048909 | Bacteria | 16286 |
| 221 | Ga0496106_0005873 | 3300048909 | Bacteria | 9077 |
| 222 | Ga0496107_0000030 | 3300048910 | Bacteria | 101737 |
| 223 | Ga0496107_0000068 | 3300048910 | Bacteria | 51683 |
| 224 | Ga0496111_0302914 | 3300048914 | Bacteria | 1185 |
| 225 | Ga0496121_0000147 | 3300048924 | Bacteria | 154342 |
| 226 | Ga0496121_0010865 | 3300048924 | Bacteria | 10178 |
| 227 | Ga0496124_0140111 | 3300048927 | Bacteria | 1910 |
| 228 | Ga0496126_0006858 | 3300048929 | Bacteria | 12625 |
| 229 | Ga0496126_0119631 | 3300048929 | Bacteria | 2285 |
| 230 | Ga0495678_000636 | 3300049459 | Bacteria | 32495 |
| 231 | Ga0501074_0091267 | 3300049590 | Bacteria | 2181 |
| 232 | Ga0501076_0147304 | 3300049592 | Bacteria | 1915 |
| 233 | Ga0501077_0248329 | 3300049593 | Bacteria | 1131 |
| 234 | Ga0501044_0003729 | 3300049823 | Bacteria | 17113 |
| 235 | Ga0500643_002688 | 3300053087 | Bacteria | 8950 |
| 236 | Ga0500643_013811 | 3300053087 | Bacteria | 2832 |
| 237 | Ga0500641_0008438 | 3300053096 | Bacteria | 3677 |
| 238 | Ga0500595_028784 | 3300053119 | Bacteria | 1892 |
| 239 | Ga0500658_0000598 | 3300053134 | Bacteria | 14978 |
| 240 | Ga0500568_0027969 | 3300053139 | Bacteria | 2354 |
| 241 | Ga0500586_000051 | 3300053145 | Bacteria | 20590 |
| 242 | Ga0500627_0000010 | 3300053158 | Bacteria | 152372 |
| 243 | Ga0500637_0009316 | 3300053178 | Bacteria | 4994 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048914 | Ga0496111_0302914 | Ga0496111_0302914_29_847 | 259 |
| 2 | 3300037471 | Ga0395905_0179451 | Ga0395905_0179451_1119_1949 | 263 |
| 3 | 3300009093 | Ga0105240_10073126 | Ga0105240_100731262 | 264 |
| 4 | 3300046691 | Ga0495670_0177894 | Ga0495670_0177894_34_867 | 264 |
| 5 | 3300026075 | Ga0207708_10258409 | Ga0207708_102584092 | 270 |
| 6 | 3300053119 | Ga0500595_028784 | Ga0500595_028784_736_1740 | 277 |
| 7 | 3300048929 | Ga0496126_0006858 | Ga0496126_0006858_7205_8137 | 278 |
| 8 | 3300010375 | Ga0105239_10019629 | Ga0105239_100196295 | 282 |
| 9 | 3300046460 | Ga0495638_0000123 | Ga0495638_0000123_49985_50998 | 294 |
| 10 | 3300053134 | Ga0500658_0000598 | Ga0500658_0000598_3383_4396 | 294 |
| 11 | 3300046530 | Ga0495654_0025142 | Ga0495654_0025142_686_1690 | 295 |
| 12 | 3300048927 | Ga0496124_0140111 | Ga0496124_0140111_146_1168 | 295 |
| 13 | 3300053158 | Ga0500627_0000010 | Ga0500627_0000010_90475_91479 | 295 |
| 14 | 3300046522 | Ga0495643_0022492 | Ga0495643_0022492_1466_2467 | 297 |
| 15 | 3300038705 | Ga0237819_00404 | Ga0237819_00404_7501_8505 | 298 |
| 16 | 3300049590 | Ga0501074_0091267 | Ga0501074_0091267_727_1737 | 312 |
| 17 | iso_pu_bacteria | 8057101203 | 8057102451 | 312 |
| 18 | 3300047469 | Ga0495673_0000113 | Ga0495673_0000113_128936_129916 | 313 |
| 19 | iso_pu_bacteria | 2643221545 | 2643749939 | 313 |
| 20 | iso_pu_bacteria | 2643221691 | 2644510907 | 313 |
| 21 | iso_pu_bacteria | 2852680915 | 2852684841 | 314 |
| 22 | 3300003781 | Ga0055536_1008543 | Ga0055536_10085432 | 316 |
| 23 | 3300005548 | Ga0070665_100306508 | Ga0070665_1003065081 | 316 |
| 24 | 3300009545 | Ga0105237_10139097 | Ga0105237_101390971 | 316 |
| 25 | 3300025914 | Ga0207671_10144263 | Ga0207671_101442632 | 316 |
| 26 | 3300039145 | Ga0237816_00099 | Ga0237816_00099_2021_3019 | 316 |
| 27 | 3300053096 | Ga0500641_0008438 | Ga0500641_0008438_844_1833 | 316 |
| 28 | 3300053178 | Ga0500637_0009316 | Ga0500637_0009316_2485_3474 | 316 |
| 29 | 3300009174 | Ga0105241_10280401 | Ga0105241_102804012 | 317 |
| 30 | 3300046500 | Ga0495596_0000543 | Ga0495596_0000543_13146_14138 | 317 |
| 31 | 3300046507 | Ga0495606_0011146 | Ga0495606_0011146_2809_3801 | 317 |
| 32 | 3300046525 | Ga0495663_0035346 | Ga0495663_0035346_449_1444 | 317 |
| 33 | 3300046538 | Ga0495609_0003273 | Ga0495609_0003273_4660_5652 | 317 |
| 34 | 3300046660 | Ga0495625_0008134 | Ga0495625_0008134_875_1867 | 317 |
| 35 | 3300009094 | Ga0111539_10487069 | Ga0111539_104870691 | 319 |
| 36 | 3300048909 | Ga0496106_0001734 | Ga0496106_0001734_7240_8244 | 319 |
| 37 | 3300048910 | Ga0496107_0000030 | Ga0496107_0000030_57517_58521 | 319 |
| 38 | 3300048924 | Ga0496121_0010865 | Ga0496121_0010865_3552_4556 | 319 |
| 39 | iso_pu_bacteria | 2857558681 | 2857559251 | 319 |
| 40 | iso_pu_bacteria | 2857564685 | 2857566867 | 319 |
| 41 | 3300005458 | Ga0070681_10101709 | Ga0070681_101017093 | 320 |
| 42 | 3300005719 | Ga0068861_100183548 | Ga0068861_1001835482 | 320 |
| 43 | 3300009553 | Ga0105249_10009858 | Ga0105249_100098585 | 320 |
| 44 | 3300025912 | Ga0207707_10054933 | Ga0207707_100549332 | 320 |
| 45 | 3300025961 | Ga0207712_10005211 | Ga0207712_100052115 | 320 |
| 46 | 3300026118 | Ga0207675_100136312 | Ga0207675_1001363122 | 320 |
| 47 | 3300048924 | Ga0496121_0000147 | Ga0496121_0000147_16236_17237 | 320 |
| 48 | 3300049592 | Ga0501076_0147304 | Ga0501076_0147304_895_1896 | 320 |
| 49 | 3300049823 | Ga0501044_0003729 | Ga0501044_0003729_14071_15168 | 320 |
| 50 | iso_pu_bacteria | 2524023250 | 2524613406 | 320 |
| 51 | 3300005354 | Ga0070675_100099388 | Ga0070675_1000993882 | 321 |
| 52 | 3300005355 | Ga0070671_100005845 | Ga0070671_1000058453 | 321 |
| 53 | 3300005364 | Ga0070673_100000794 | Ga0070673_1000007949 | 321 |
| 54 | 3300005367 | Ga0070667_100220278 | Ga0070667_1002202781 | 321 |
| 55 | 3300005456 | Ga0070678_100007147 | Ga0070678_1000071473 | 321 |
| 56 | 3300005457 | Ga0070662_100042186 | Ga0070662_1000421862 | 321 |
| 57 | 3300005543 | Ga0070672_100055461 | Ga0070672_1000554612 | 321 |
| 58 | 3300005564 | Ga0070664_100455688 | Ga0070664_1004556882 | 321 |
| 59 | 3300009177 | Ga0105248_10067943 | Ga0105248_100679432 | 321 |
| 60 | 3300009177 | Ga0105248_10236541 | Ga0105248_102365412 | 321 |
| 61 | 3300013296 | Ga0157374_10017499 | Ga0157374_100174994 | 321 |
| 62 | 3300013306 | Ga0163162_10044527 | Ga0163162_100445272 | 321 |
| 63 | 3300013308 | Ga0157375_10033996 | Ga0157375_100339962 | 321 |
| 64 | 3300021384 | Ga0213876_10107601 | Ga0213876_101076012 | 321 |
| 65 | 3300025903 | Ga0207680_10053945 | Ga0207680_100539452 | 321 |
| 66 | 3300025926 | Ga0207659_10009904 | Ga0207659_100099042 | 321 |
| 67 | 3300025931 | Ga0207644_10001235 | Ga0207644_100012358 | 321 |
| 68 | 3300025933 | Ga0207706_10013134 | Ga0207706_100131342 | 321 |
| 69 | 3300025940 | Ga0207691_10042854 | Ga0207691_100428543 | 321 |
| 70 | 3300025941 | Ga0207711_10070472 | Ga0207711_100704722 | 321 |
| 71 | 3300025960 | Ga0207651_10248518 | Ga0207651_102485182 | 321 |
| 72 | 3300026121 | Ga0207683_10015646 | Ga0207683_100156463 | 321 |
| 73 | 3300028379 | Ga0268266_10020561 | Ga0268266_100205614 | 321 |
| 74 | 3300046557 | Ga0495622_0000044 | Ga0495622_0000044_24066_25115 | 321 |
| 75 | 3300046691 | Ga0495670_0000272 | Ga0495670_0000272_18542_19546 | 321 |
| 76 | 3300048904 | Ga0496101_0220148 | Ga0496101_0220148_441_1445 | 321 |
| 77 | 3300005330 | Ga0070690_100010672 | Ga0070690_1000106722 | 322 |
| 78 | 3300005331 | Ga0070670_100072092 | Ga0070670_1000720922 | 322 |
| 79 | 3300005333 | Ga0070677_10005201 | Ga0070677_100052012 | 322 |
| 80 | 3300005340 | Ga0070689_100006274 | Ga0070689_10000627410 | 322 |
| 81 | 3300005356 | Ga0070674_100107157 | Ga0070674_1001071572 | 322 |
| 82 | 3300005444 | Ga0070694_100007921 | Ga0070694_1000079212 | 322 |
| 83 | 3300005456 | Ga0070678_100167711 | Ga0070678_1001677112 | 322 |
| 84 | 3300005459 | Ga0068867_100220606 | Ga0068867_1002206062 | 322 |
| 85 | 3300005466 | Ga0070685_10019632 | Ga0070685_100196323 | 322 |
| 86 | 3300005539 | Ga0068853_100461417 | Ga0068853_1004614172 | 322 |
| 87 | 3300005617 | Ga0068859_100240184 | Ga0068859_1002401842 | 322 |
| 88 | 3300005840 | Ga0068870_10003651 | Ga0068870_100036513 | 322 |
| 89 | 3300005843 | Ga0068860_100025901 | Ga0068860_1000259012 | 322 |
| 90 | 3300005844 | Ga0068862_100007472 | Ga0068862_1000074722 | 322 |
| 91 | 3300006881 | Ga0068865_100037610 | Ga0068865_1000376102 | 322 |
| 92 | 3300006931 | Ga0097620_100240192 | Ga0097620_1002401922 | 322 |
| 93 | 3300014326 | Ga0157380_10017594 | Ga0157380_100175942 | 322 |
| 94 | 3300025893 | Ga0207682_10007642 | Ga0207682_100076423 | 322 |
| 95 | 3300025925 | Ga0207650_10013121 | Ga0207650_100131214 | 322 |
| 96 | 3300025926 | Ga0207659_10006073 | Ga0207659_100060736 | 322 |
| 97 | 3300025936 | Ga0207670_10019603 | Ga0207670_100196032 | 322 |
| 98 | 3300025937 | Ga0207669_10005540 | Ga0207669_100055404 | 322 |
| 99 | 3300025940 | Ga0207691_10001749 | Ga0207691_100017492 | 322 |
| 100 | 3300025972 | Ga0207668_10039553 | Ga0207668_100395532 | 322 |
| 101 | 3300026089 | Ga0207648_10052385 | Ga0207648_100523853 | 322 |
| 102 | 3300026095 | Ga0207676_10012167 | Ga0207676_100121673 | 322 |
| 103 | 3300026121 | Ga0207683_10017059 | Ga0207683_100170595 | 322 |
| 104 | 3300028381 | Ga0268264_10011183 | Ga0268264_100111835 | 322 |
| 105 | 3300005293 | Ga0065715_10000654 | Ga0065715_100006543 | 323 |
| 106 | 3300005328 | Ga0070676_10000723 | Ga0070676_100007233 | 323 |
| 107 | 3300005331 | Ga0070670_100011761 | Ga0070670_1000117617 | 323 |
| 108 | 3300005333 | Ga0070677_10000558 | Ga0070677_100005585 | 323 |
| 109 | 3300005334 | Ga0068869_100014714 | Ga0068869_1000147142 | 323 |
| 110 | 3300005337 | Ga0070682_100024135 | Ga0070682_1000241352 | 323 |
| 111 | 3300005340 | Ga0070689_100052513 | Ga0070689_1000525132 | 323 |
| 112 | 3300005344 | Ga0070661_100090818 | Ga0070661_1000908182 | 323 |
| 113 | 3300005347 | Ga0070668_100005952 | Ga0070668_1000059528 | 323 |
| 114 | 3300005347 | Ga0070668_100008871 | Ga0070668_1000088714 | 323 |
| 115 | 3300005354 | Ga0070675_100002886 | Ga0070675_1000028863 | 323 |
| 116 | 3300005354 | Ga0070675_100007653 | Ga0070675_1000076535 | 323 |
| 117 | 3300005354 | Ga0070675_100435092 | Ga0070675_1004350921 | 323 |
| 118 | 3300005355 | Ga0070671_100050036 | Ga0070671_1000500362 | 323 |
| 119 | 3300005356 | Ga0070674_100003058 | Ga0070674_1000030582 | 323 |
| 120 | 3300005441 | Ga0070700_100307498 | Ga0070700_1003074981 | 323 |
| 121 | 3300005457 | Ga0070662_100006018 | Ga0070662_1000060187 | 323 |
| 122 | 3300005459 | Ga0068867_100005745 | Ga0068867_1000057457 | 323 |
| 123 | 3300005459 | Ga0068867_100028315 | Ga0068867_1000283151 | 323 |
| 124 | 3300005459 | Ga0068867_100155035 | Ga0068867_1001550352 | 323 |
| 125 | 3300005543 | Ga0070672_100005293 | Ga0070672_1000052933 | 323 |
| 126 | 3300005544 | Ga0070686_100030709 | Ga0070686_1000307092 | 323 |
| 127 | 3300005548 | Ga0070665_100028567 | Ga0070665_1000285674 | 323 |
| 128 | 3300005548 | Ga0070665_100137587 | Ga0070665_1001375872 | 323 |
| 129 | 3300005578 | Ga0068854_100032214 | Ga0068854_1000322142 | 323 |
| 130 | 3300005617 | Ga0068859_100005561 | Ga0068859_10000556113 | 323 |
| 131 | 3300005719 | Ga0068861_100016127 | Ga0068861_1000161273 | 323 |
| 132 | 3300005719 | Ga0068861_100108902 | Ga0068861_1001089022 | 323 |
| 133 | 3300005719 | Ga0068861_100120691 | Ga0068861_1001206912 | 323 |
| 134 | 3300005840 | Ga0068870_10037657 | Ga0068870_100376572 | 323 |
| 135 | 3300005841 | Ga0068863_100043399 | Ga0068863_1000433993 | 323 |
| 136 | 3300005843 | Ga0068860_100079162 | Ga0068860_1000791622 | 323 |
| 137 | 3300005844 | Ga0068862_100000074 | Ga0068862_100000074102 | 323 |
| 138 | 3300005844 | Ga0068862_100022420 | Ga0068862_1000224202 | 323 |
| 139 | 3300005844 | Ga0068862_100182837 | Ga0068862_1001828372 | 323 |
| 140 | 3300006358 | Ga0068871_100012634 | Ga0068871_1000126342 | 323 |
| 141 | 3300006931 | Ga0097620_100005561 | Ga0097620_10000556113 | 323 |
| 142 | 3300009036 | Ga0105244_10020329 | Ga0105244_100203292 | 323 |
| 143 | 3300009101 | Ga0105247_10099522 | Ga0105247_100995222 | 323 |
| 144 | 3300009177 | Ga0105248_10016395 | Ga0105248_100163954 | 323 |
| 145 | 3300009177 | Ga0105248_10296553 | Ga0105248_102965532 | 323 |
| 146 | 3300009553 | Ga0105249_10000286 | Ga0105249_1000028637 | 323 |
| 147 | 3300013102 | Ga0157371_10196536 | Ga0157371_101965362 | 323 |
| 148 | 3300013308 | Ga0157375_10028412 | Ga0157375_100284123 | 323 |
| 149 | 3300014326 | Ga0157380_10001331 | Ga0157380_100013319 | 323 |
| 150 | 3300014326 | Ga0157380_10002361 | Ga0157380_1000236112 | 323 |
| 151 | 3300014326 | Ga0157380_10040003 | Ga0157380_100400032 | 323 |
| 152 | 3300014326 | Ga0157380_10040125 | Ga0157380_100401253 | 323 |
| 153 | 3300014326 | Ga0157380_10215593 | Ga0157380_102155932 | 323 |
| 154 | 3300014326 | Ga0157380_10236911 | Ga0157380_102369112 | 323 |
| 155 | 3300014969 | Ga0157376_10037687 | Ga0157376_100376872 | 323 |
| 156 | 3300017792 | Ga0163161_10026331 | Ga0163161_100263313 | 323 |
| 157 | 3300017792 | Ga0163161_10082309 | Ga0163161_100823092 | 323 |
| 158 | 3300017792 | Ga0163161_10169237 | Ga0163161_101692372 | 323 |
| 159 | 3300025315 | Ga0207697_10010489 | Ga0207697_100104892 | 323 |
| 160 | 3300025893 | Ga0207682_10000574 | Ga0207682_100005748 | 323 |
| 161 | 3300025900 | Ga0207710_10064565 | Ga0207710_100645652 | 323 |
| 162 | 3300025907 | Ga0207645_10023363 | Ga0207645_100233632 | 323 |
| 163 | 3300025908 | Ga0207643_10047885 | Ga0207643_100478852 | 323 |
| 164 | 3300025917 | Ga0207660_10059161 | Ga0207660_100591612 | 323 |
| 165 | 3300025920 | Ga0207649_10094683 | Ga0207649_100946832 | 323 |
| 166 | 3300025925 | Ga0207650_10078182 | Ga0207650_100781822 | 323 |
| 167 | 3300025925 | Ga0207650_10135636 | Ga0207650_101356362 | 323 |
| 168 | 3300025926 | Ga0207659_10004459 | Ga0207659_100044592 | 323 |
| 169 | 3300025926 | Ga0207659_10149248 | Ga0207659_101492482 | 323 |
| 170 | 3300025933 | Ga0207706_10003718 | Ga0207706_1000371815 | 323 |
| 171 | 3300025938 | Ga0207704_10032831 | Ga0207704_100328313 | 323 |
| 172 | 3300025938 | Ga0207704_10290634 | Ga0207704_102906342 | 323 |
| 173 | 3300025940 | Ga0207691_10004641 | Ga0207691_1000464113 | 323 |
| 174 | 3300025940 | Ga0207691_10049057 | Ga0207691_100490573 | 323 |
| 175 | 3300025942 | Ga0207689_10040600 | Ga0207689_100406003 | 323 |
| 176 | 3300025942 | Ga0207689_10237559 | Ga0207689_102375592 | 323 |
| 177 | 3300025942 | Ga0207689_10391485 | Ga0207689_103914851 | 323 |
| 178 | 3300025945 | Ga0207679_10042846 | Ga0207679_100428463 | 323 |
| 179 | 3300025961 | Ga0207712_10000049 | Ga0207712_1000004916 | 323 |
| 180 | 3300025972 | Ga0207668_10007337 | Ga0207668_100073372 | 323 |
| 181 | 3300025972 | Ga0207668_10076551 | Ga0207668_100765512 | 323 |
| 182 | 3300025981 | Ga0207640_10024118 | Ga0207640_100241182 | 323 |
| 183 | 3300026067 | Ga0207678_10021710 | Ga0207678_100217102 | 323 |
| 184 | 3300026067 | Ga0207678_10300784 | Ga0207678_103007842 | 323 |
| 185 | 3300026075 | Ga0207708_10102814 | Ga0207708_101028142 | 323 |
| 186 | 3300026088 | Ga0207641_10006171 | Ga0207641_100061713 | 323 |
| 187 | 3300026088 | Ga0207641_10011493 | Ga0207641_100114933 | 323 |
| 188 | 3300026089 | Ga0207648_10010075 | Ga0207648_100100757 | 323 |
| 189 | 3300026089 | Ga0207648_10083132 | Ga0207648_100831322 | 323 |
| 190 | 3300026116 | Ga0207674_10113659 | Ga0207674_101136592 | 323 |
| 191 | 3300026116 | Ga0207674_10137736 | Ga0207674_101377362 | 323 |
| 192 | 3300026118 | Ga0207675_100013911 | Ga0207675_1000139115 | 323 |
| 193 | 3300026118 | Ga0207675_100019139 | Ga0207675_1000191392 | 323 |
| 194 | 3300026118 | Ga0207675_100022432 | Ga0207675_1000224323 | 323 |
| 195 | 3300026118 | Ga0207675_100033152 | Ga0207675_1000331523 | 323 |
| 196 | 3300026121 | Ga0207683_10083903 | Ga0207683_100839033 | 323 |
| 197 | 3300028380 | Ga0268265_10000847 | Ga0268265_1000084712 | 323 |
| 198 | 3300028380 | Ga0268265_10081850 | Ga0268265_100818502 | 323 |
| 199 | 3300028381 | Ga0268264_10001314 | Ga0268264_1000131420 | 323 |
| 200 | 3300028800 | Ga0265338_10026978 | Ga0265338_100269783 | 323 |
| 201 | 3300031247 | Ga0265340_10038120 | Ga0265340_100381202 | 323 |
| 202 | 3300031456 | Ga0307513_10048363 | Ga0307513_100483632 | 323 |
| 203 | 3300031456 | Ga0307513_10077113 | Ga0307513_100771133 | 323 |
| 204 | 3300031711 | Ga0265314_10049438 | Ga0265314_100494382 | 323 |
| 205 | 3300031824 | Ga0307413_10108644 | Ga0307413_101086442 | 323 |
| 206 | 3300031852 | Ga0307410_10019881 | Ga0307410_100198811 | 323 |
| 207 | 3300036401 | Ga0373937_0105899 | Ga0373937_0105899_921_1931 | 323 |
| 208 | 3300046452 | Ga0495617_001643 | Ga0495617_001643_6670_7680 | 323 |
| 209 | 3300046506 | Ga0495583_0008092 | Ga0495583_0008092_1530_2540 | 323 |
| 210 | 3300046507 | Ga0495606_0000001 | Ga0495606_0000001_113755_114765 | 323 |
| 211 | 3300046507 | Ga0495606_0000440 | Ga0495606_0000440_63211_64221 | 323 |
| 212 | 3300046507 | Ga0495606_0001596 | Ga0495606_0001596_16097_17107 | 323 |
| 213 | 3300046512 | Ga0495610_0001044 | Ga0495610_0001044_14088_15098 | 323 |
| 214 | 3300046512 | Ga0495610_0005286 | Ga0495610_0005286_839_1849 | 323 |
| 215 | 3300046520 | Ga0495637_0006548 | Ga0495637_0006548_1127_2137 | 323 |
| 216 | 3300046522 | Ga0495643_0000240 | Ga0495643_0000240_52740_53750 | 323 |
| 217 | 3300046525 | Ga0495663_0011895 | Ga0495663_0011895_632_1642 | 323 |
| 218 | 3300046525 | Ga0495663_0020866 | Ga0495663_0020866_722_1732 | 323 |
| 219 | 3300046528 | Ga0495642_0010688 | Ga0495642_0010688_2461_3471 | 323 |
| 220 | 3300046528 | Ga0495642_0039010 | Ga0495642_0039010_501_1511 | 323 |
| 221 | 3300046539 | Ga0495621_0002167 | Ga0495621_0002167_583_1593 | 323 |
| 222 | 3300046558 | Ga0495633_0002796 | Ga0495633_0002796_1949_2959 | 323 |
| 223 | 3300046558 | Ga0495633_0015202 | Ga0495633_0015202_2771_3781 | 323 |
| 224 | 3300046616 | Ga0495668_0000095 | Ga0495668_0000095_36907_37917 | 323 |
| 225 | 3300046616 | Ga0495668_0063564 | Ga0495668_0063564_418_1428 | 323 |
| 226 | 3300046660 | Ga0495625_0105255 | Ga0495625_0105255_895_1905 | 323 |
| 227 | 3300046691 | Ga0495670_0035805 | Ga0495670_0035805_925_1935 | 323 |
| 228 | 3300046691 | Ga0495670_0051710 | Ga0495670_0051710_39_1049 | 323 |
| 229 | 3300046691 | Ga0495670_0112343 | Ga0495670_0112343_175_1188 | 323 |
| 230 | 3300046694 | Ga0495649_0010613 | Ga0495649_0010613_467_1477 | 323 |
| 231 | 3300047320 | Ga0495672_0000366 | Ga0495672_0000366_7780_8790 | 323 |
| 232 | 3300047445 | Ga0495677_0077056 | Ga0495677_0077056_114_1124 | 323 |
| 233 | 3300047472 | Ga0495686_0005621 | Ga0495686_0005621_767_1777 | 323 |
| 234 | 3300048905 | Ga0496102_0000477 | Ga0496102_0000477_2089_3099 | 323 |
| 235 | 3300048906 | Ga0496103_0075053 | Ga0496103_0075053_19_1029 | 323 |
| 236 | 3300048929 | Ga0496126_0119631 | Ga0496126_0119631_1106_2116 | 323 |
| 237 | 3300049459 | Ga0495678_000636 | Ga0495678_000636_8051_9061 | 323 |
| 238 | 3300049593 | Ga0501077_0248329 | Ga0501077_0248329_103_1113 | 323 |
| 239 | 3300053087 | Ga0500643_002688 | Ga0500643_002688_3566_4576 | 323 |
| 240 | 3300053087 | Ga0500643_013811 | Ga0500643_013811_1731_2780 | 323 |
| 241 | 3300053139 | Ga0500568_0027969 | Ga0500568_0027969_1092_2105 | 323 |
| 242 | 3300053145 | Ga0500586_000051 | Ga0500586_000051_17707_18717 | 323 |
| 243 | 3300003316 | rootH1_10086130 | rootH1_100861303 | 324 |
| 244 | 3300003322 | rootL2_10055226 | rootL2_100552265 | 324 |
| 245 | 3300046460 | Ga0495638_0027112 | Ga0495638_0027112_23_1039 | 324 |
| 246 | 3300046471 | Ga0495650_0000408 | Ga0495650_0000408_17294_18310 | 324 |
| 247 | 3300046660 | Ga0495625_0002287 | Ga0495625_0002287_15575_16597 | 324 |
| 248 | 3300048904 | Ga0496101_0219169 | Ga0496101_0219169_399_1412 | 324 |
| 249 | 3300048909 | Ga0496106_0005873 | Ga0496106_0005873_6733_7746 | 324 |
| 250 | 3300048910 | Ga0496107_0000068 | Ga0496107_0000068_24819_25832 | 324 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gfi-assembly4.cif.gz_D | crystal structure of efi-502318, an enolase family member from agrobacterium tumefaciens with homology to dipeptide epimerases (bound sodium, l-ala-l-glu with ordered loop) | 0.9217 | 4 | 309 |
| 1jpd-assembly1.cif.gz_X | l-ala-d/l-glu epimerase | 0.9039 | 2 | 310 |
| 1nu5-assembly1.cif.gz_A | crystal structure of pseudomonas sp. p51 chloromuconate lactonizing enzyme | 0.8944 | 1 | 315 |
| 2p88-assembly1.cif.gz_D | crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 | 0.8899 | 3 | 316 |
| 1jpm-assembly1.cif.gz_B | l-ala-d/l-glu epimerase | 0.8795 | 1 | 313 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4gfiD01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9459 | 4 | 105 | 3.30.390.10 |
| 1jpdX01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9432 | 1 | 102 | 3.30.390.10 |
| 4gfiD01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.92 | 4 | 105 | 3.30.390.10 |
| 3q45A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9115 | 108 | 308 | 3.20.20.120 |
| 1jpdX02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.908 | 118 | 310 | 3.20.20.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6GTA7-F1-model_v4 | Dipeptide epimerase | 0.9752 | 136 | 267 |
GO:0016854
|
| AF-A0A523FKF8-F1-model_v4 | Dipeptide epimerase (EC 5.1.1.-) | 0.9731 | 6 | 263 |
GO:0000287
GO:0009063 GO:0016855 |
| AF-A0A2V5SAW7-F1-model_v4 | Dipeptide epimerase (EC 5.1.1.-) | 0.9724 | 4 | 271 |
GO:0016855
GO:0046872 |
| AF-A0A062VGQ1-F1-model_v4 | Dipeptide epimerase (EC 5.1.1.-) | 0.9718 | 5 | 315 |
GO:0000287
GO:0009063 GO:0016855 |
| AF-X0UYL6-F1-model_v4 | Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein | 0.9664 | 100 | 274 |
GO:0016854
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar