F361599

General Info

Members Datasets Scaffolds Average Seq Length
250 142 500 132

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10051483|Ga0213872_100514832
Length 141
Sequence MSPEPEITNPATQPQELAVQEKKELGGEEKTVPGRFFVPSTDVFETEDGLTLVIEMPGVSRENLEVSLEEGIVRIEGKLDFSKYAGIEPVYTEYNVGHYARSFSLSDKVDRDNIAARLEDGVLTLTLPKSPAARPRRIAIN

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300000305 Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly Metatranscriptome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
85 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
86 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
87 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
88 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
89 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.2
Metatranscriptomes 4.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 11.2
Rhizosphere 82.8
Stem 0
Stem Tuber 0
Unclassified 36.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10051483 3300021361 Bacteria 1869
2 bgg_mtDRAFT_1044070 3300000305 Unclassified 575
3 Ga0065704_10285041 3300005289 Unclassified 908
4 Ga0070670_100541662 3300005331 Unclassified 1038
5 Ga0070682_101276194 3300005337 Bacteria 623
6 Ga0070687_100672475 3300005343 Bacteria 720
7 Ga0070668_100005359 3300005347 Bacteria 9522
8 Ga0070668_102186619 3300005347 Unclassified 511
9 Ga0070671_100305895 3300005355 Unclassified 1354
10 Ga0070671_101212170 3300005355 Bacteria 664
11 Ga0070688_101378901 3300005365 Bacteria 571
12 Ga0070667_100013860 3300005367 Bacteria 6664
13 Ga0070709_10316419 3300005434 Unclassified 1144
14 Ga0070714_100119393 3300005435 Bacteria 2343
15 Ga0070714_100176447 3300005435 Unclassified 1942
16 Ga0070714_101502644 3300005435 Unclassified 658
17 Ga0070713_100075406 3300005436 Bacteria 2860
18 Ga0070713_100108047 3300005436 Unclassified 2421
19 Ga0070713_100295763 3300005436 Bacteria 1489
20 Ga0070710_10141768 3300005437 Bacteria 1474
21 Ga0070711_100952884 3300005439 Unclassified 734
22 Ga0070706_100220024 3300005467 Bacteria 1772
23 Ga0070698_100242604 3300005471 Unclassified 1735
24 Ga0070697_100025407 3300005536 Bacteria 4725
25 Ga0068853_102073381 3300005539 Unclassified 551
26 Ga0070704_102098564 3300005549 Bacteria 525
27 Ga0068859_100506280 3300005617 Unclassified 1303
28 Ga0068861_100332396 3300005719 Unclassified 1327
29 Ga0068861_101426602 3300005719 Bacteria 677
30 Ga0068863_100178048 3300005841 Bacteria 2041
31 Ga0068860_100392605 3300005843 Unclassified 1371
32 Ga0068862_100050673 3300005844 Unclassified 3549
33 Ga0068862_100605031 3300005844 Bacteria 1053
34 Ga0081455_10008888 3300005937 Bacteria 10385
35 Ga0081540_1081587 3300005983 Bacteria 1454
36 Ga0081539_10030074 3300005985 Bacteria 3380
37 Ga0070717_10120459 3300006028 Bacteria 2247
38 Ga0070717_10789013 3300006028 Unclassified 864
39 Ga0070717_10850346 3300006028 Bacteria 830
40 Ga0070717_10930350 3300006028 Bacteria 791
41 Ga0075365_10089391 3300006038 Unclassified 2097
42 Ga0075365_10259806 3300006038 Bacteria 1221
43 Ga0075364_10471663 3300006051 Bacteria 858
44 Ga0075432_10087418 3300006058 Bacteria 1137
45 Ga0070715_10015452 3300006163 Bacteria 2847
46 Ga0070712_100038710 3300006175 Bacteria 3260
47 Ga0070712_100094905 3300006175 Bacteria 2193
48 Ga0070712_100205100 3300006175 Bacteria 1551
49 Ga0075428_100049084 3300006844 Bacteria 4631
50 Ga0075428_100087126 3300006844 Bacteria 3406
51 Ga0075428_100107329 3300006844 Bacteria 3043
52 Ga0075428_100171578 3300006844 Bacteria 2351
53 Ga0075428_100403379 3300006844 Unclassified 1465
54 Ga0075428_101100625 3300006844 Unclassified 839
55 Ga0075428_101211705 3300006844 Bacteria 796
56 Ga0075428_101349766 3300006844 Bacteria 749
57 Ga0075430_100002883 3300006846 Bacteria 14398
58 Ga0075430_100206319 3300006846 Bacteria 1631
59 Ga0075430_100241403 3300006846 Bacteria 1497
60 Ga0075430_100378353 3300006846 Unclassified 1169
61 Ga0075431_100013435 3300006847 Bacteria 8272
62 Ga0075431_100015147 3300006847 Bacteria 7811
63 Ga0075431_100107248 3300006847 Bacteria 2882
64 Ga0075431_100695386 3300006847 Bacteria 995
65 Ga0075431_101103960 3300006847 Bacteria 758
66 Ga0075431_101181815 3300006847 Unclassified 728
67 Ga0075433_10209532 3300006852 Bacteria 1732
68 Ga0075433_10791972 3300006852 Bacteria 828
69 Ga0075434_100223464 3300006871 Bacteria 1903
70 Ga0075434_100268833 3300006871 Bacteria 1724
71 Ga0075434_101236116 3300006871 Bacteria 758
72 Ga0075429_100024206 3300006880 Bacteria 5266
73 Ga0075429_100147782 3300006880 Bacteria 2057
74 Ga0075429_101250941 3300006880 Bacteria 648
75 Ga0075436_100507097 3300006914 Unclassified 883
76 Ga0097620_100506231 3300006931 Unclassified 1303
77 Ga0075435_100097890 3300007076 Bacteria 2428
78 Ga0075435_100218828 3300007076 Unclassified 1617
79 Ga0075435_100338013 3300007076 Bacteria 1290
80 Ga0075435_100634395 3300007076 Unclassified 927
81 Ga0075435_101111799 3300007076 Unclassified 691
82 Ga0111539_10075895 3300009094 Unclassified 3959
83 Ga0111539_10711765 3300009094 Bacteria 1169
84 Ga0111539_10840129 3300009094 Unclassified 1068
85 Ga0111539_12101309 3300009094 Unclassified 655
86 Ga0105245_11819194 3300009098 Bacteria 662
87 Ga0105247_10379253 3300009101 Bacteria 1002
88 Ga0114129_10009649 3300009147 Bacteria 13775
89 Ga0114129_10054307 3300009147 Bacteria 5616
90 Ga0114129_10113178 3300009147 Bacteria 3742
91 Ga0114129_10510575 3300009147 Bacteria 1568
92 Ga0114129_10520569 3300009147 Bacteria 1551
93 Ga0114129_10531452 3300009147 Bacteria 1532
94 Ga0105242_10788863 3300009176 Unclassified 939
95 Ga0105248_10873702 3300009177 Unclassified 1015
96 Ga0105237_10821106 3300009545 Bacteria 936
97 Ga0105249_10116852 3300009553 Unclassified 2529
98 Ga0105239_10513396 3300010375 Bacteria 1363
99 Ga0105239_11124513 3300010375 Unclassified 904
100 Ga0105246_11030989 3300011119 Unclassified 747
101 Ga0157378_10464600 3300013297 Bacteria 1258
102 Ga0163162_10543933 3300013306 Bacteria 1290
103 Ga0163162_11341950 3300013306 Unclassified 813
104 Ga0157372_10949640 3300013307 Bacteria 997
105 Ga0157380_11652804 3300014326 Unclassified 697
106 Ga0157380_12795831 3300014326 Bacteria 555
107 Ga0182008_10139488 3300014497 Bacteria 1212
108 Ga0157379_10378748 3300014968 Bacteria 1298
109 Ga0157376_12847291 3300014969 Unclassified 523
110 Ga0206351_10103389 3300020077 Unclassified 950
111 Ga0206350_11543828 3300020080 Bacteria 929
112 Ga0206350_11561678 3300020080 Unclassified 610
113 Ga0213872_10023759 3300021361 Bacteria 2820
114 Ga0213874_10002603 3300021377 Bacteria 3906
115 Ga0213874_10162212 3300021377 Unclassified 786
116 Ga0213875_10284555 3300021388 Bacteria 781
117 Ga0224712_10457257 3300022467 Unclassified 613
118 Ga0224712_10657986 3300022467 Unclassified 514
119 Ga0207710_10441351 3300025900 Bacteria 671
120 Ga0207647_10641992 3300025904 Bacteria 583
121 Ga0207685_10005503 3300025905 Bacteria 3350
122 Ga0207684_10378966 3300025910 Unclassified 1217
123 Ga0207663_10701387 3300025916 Unclassified 801
124 Ga0207663_11627695 3300025916 Unclassified 520
125 Ga0207650_10246090 3300025925 Unclassified 1446
126 Ga0207659_11800141 3300025926 Bacteria 520
127 Ga0207700_10481666 3300025928 Bacteria 1096
128 Ga0207700_10585552 3300025928 Bacteria 992
129 Ga0207700_10633742 3300025928 Unclassified 953
130 Ga0207700_10788558 3300025928 Bacteria 850
131 Ga0207700_11711680 3300025928 Bacteria 554
132 Ga0207664_10119115 3300025929 Bacteria 2207
133 Ga0207644_10242737 3300025931 Unclassified 1435
134 Ga0207644_11266484 3300025931 Bacteria 620
135 Ga0207665_10101728 3300025939 Bacteria 2007
136 Ga0207712_11106674 3300025961 Bacteria 705
137 Ga0207668_10011075 3300025972 Bacteria 5469
138 Ga0207658_10032502 3300025986 Unclassified 3714
139 Ga0207675_101727830 3300026118 Bacteria 645
140 Ga0207428_10068443 3300027907 Archaea 2793
141 Ga0207428_10307226 3300027907 Bacteria 1173
142 Ga0207428_10959139 3300027907 Unclassified 602
143 Ga0268265_10013161 3300028380 Bacteria 5621
144 Ga0268264_10080349 3300028381 Bacteria 2784
145 Ga0316579_10304462 3300031691 Unclassified 770
146 Ga0316577_10331194 3300031733 Unclassified 863
147 Ga0316583_10026758 3300032133 Bacteria 2059
148 Ga0316585_10127950 3300032137 Unclassified 836
149 Ga0316585_10180069 3300032137 Bacteria 698
150 Ga0316580_10058109 3300032139 Bacteria 1188
151 Ga0316593_10100594 3300032168 Unclassified 1025
152 Ga0316592_1022312 3300033524 Unclassified 1353
153 Ga0316586_1028678 3300033527 Unclassified 947
154 Ga0316588_1024554 3300033528 Unclassified 1387
155 Ga0316587_1012703 3300033529 Unclassified 1371
156 Ga0316596_1016962 3300033541 Unclassified 1827
157 Ga0316574_0195453 3300035398 Bacteria 1300
158 Ga0316574_0502737 3300035398 Bacteria 756
159 Ga0316574_0786289 3300035398 Unclassified 580
160 Ga0373931_0530288 3300035691 Bacteria 763
161 Ga0316582_0091590 3300036647 Bacteria 2002
162 Ga0316582_0548359 3300036647 Unclassified 796
163 Ga0316584_0146192 3300036712 Bacteria 1761
164 Ga0316584_0195842 3300036712 Unclassified 1492
165 Ga0316581_0135734 3300037588 Unclassified 758
166 Ga0436364_1231336 3300037853 Unclassified 1134
167 Ga0436364_1310065 3300037853 Bacteria 965
168 Ga0436360_0232039 3300039438 Bacteria 859
169 Ga0436360_1007522 3300039438 Bacteria 1470
170 Ga0436361_0699230 3300039447 Unclassified 882
171 Ga0436361_1122798 3300039447 Bacteria 14323
172 Ga0436363_0164375 3300039450 Unclassified 915
173 Ga0436363_0634176 3300039450 Unclassified 599
174 Ga0436363_0960696 3300039450 Bacteria 2237
175 Ga0436363_1115021 3300039450 Bacteria 1145
176 Ga0436363_1602160 3300039450 Bacteria 4864
177 Ga0439440_0287459 3300042993 Bacteria 509
178 Ga0466957_0986556 3300044842 Unclassified 605
179 Ga0495629_0162228 3300046459 Bacteria 1553
180 Ga0495629_0501384 3300046459 Unclassified 819
181 Ga0495665_0204212 3300046531 Unclassified 1024
182 Ga0495676_0645484 3300047321 Unclassified 687
183 Ga0496100_0235886 3300048903 Bacteria 1348
184 Ga0496101_0230375 3300048904 Bacteria 1440
185 Ga0496101_0342874 3300048904 Bacteria 1174
186 Ga0496102_0846293 3300048905 Unclassified 837
187 Ga0496104_0050468 3300048907 Bacteria 3925
188 Ga0496104_0549340 3300048907 Bacteria 1066
189 Ga0496105_0177795 3300048908 Bacteria 1743
190 Ga0496105_0272120 3300048908 Bacteria 1367
191 Ga0496105_0965120 3300048908 Bacteria 639
192 Ga0496106_0341225 3300048909 Bacteria 1203
193 Ga0496106_0347503 3300048909 Bacteria 1191
194 Ga0496107_0601477 3300048910 Bacteria 813
195 Ga0496108_0117097 3300048911 Bacteria 2283
196 Ga0496108_0334192 3300048911 Bacteria 1321
197 Ga0496108_1750917 3300048911 Unclassified 510
198 Ga0496109_0070491 3300048912 Bacteria 3208
199 Ga0496109_0439861 3300048912 Bacteria 1232
200 Ga0496110_0065778 3300048913 Bacteria 3205
201 Ga0496110_0241073 3300048913 Bacteria 1645
202 Ga0496110_0296879 3300048913 Bacteria 1472
203 Ga0496111_0090426 3300048914 Bacteria 2242
204 Ga0496111_0300942 3300048914 Bacteria 1189
205 Ga0496112_0129251 3300048915 Bacteria 2497
206 Ga0496113_0374254 3300048916 Bacteria 1143
207 Ga0496115_0028857 3300048918 Bacteria 4351
208 Ga0496115_0101767 3300048918 Unclassified 2356
209 Ga0496115_0112667 3300048918 Bacteria 2235
210 Ga0496115_0665436 3300048918 Bacteria 822
211 Ga0501070_0153539 3300049586 Unclassified 1899
212 Ga0501071_0456978 3300049587 Bacteria 978
213 Ga0501072_0538574 3300049588 Unclassified 923
214 Ga0501075_1041153 3300049591 Unclassified 622
215 Ga0501076_0162312 3300049592 Bacteria 1821
216 Ga0501076_0180726 3300049592 Bacteria 1720
217 Ga0501079_0577674 3300049741 Unclassified 884
218 nmdc:mga00v17_167748_c1 3300050491 Unclassified 1415
219 nmdc:mga0yw44_123477_c1 3300050492 Unclassified 1670
220 nmdc:mga05p37_1528287_c1 3300050507 Unclassified 663
221 nmdc:mga05p37_1910835_c1 3300050507 Unclassified 566
222 nmdc:mga05p37_20520_c1 3300050507 Bacteria 7994
223 nmdc:mga05p37_235279_c1 3300050507 Bacteria 2205
224 nmdc:mga05p37_510728_c1 3300050507 Bacteria 1377
225 nmdc:mga05p37_843631_c1 3300050507 Bacteria 996
226 nmdc:mga09592_100749_c1 3300050508 Unclassified 2474
227 nmdc:mga09592_170394_c1 3300050508 Bacteria 1882
228 nmdc:mga0qj67_333233_c1 3300050509 Unclassified 1228
229 nmdc:mga06r32_101722_c1 3300050510 Bacteria 2820
230 nmdc:mga06r32_10850_c1 3300050510 Bacteria 8204
231 nmdc:mga06r32_59387_c1 3300050510 Bacteria 3677
232 nmdc:mga06r32_676077_c1 3300050510 Bacteria 999
233 nmdc:mga06r32_88798_c1 3300050510 Bacteria 3017
234 nmdc:mga06r32_973892_c1 3300050510 Bacteria 802
235 nmdc:mga08y16_23533_c1 3300050511 Bacteria 6508
236 nmdc:mga08y16_618603_c1 3300050511 Unclassified 1090
237 nmdc:mga0n895_1223378_c1 3300050512 Unclassified 724
238 nmdc:mga0n895_250854_c1 3300050512 Bacteria 1796
239 nmdc:mga0n895_258377_c1 3300050512 Bacteria 1768
240 nmdc:mga0n895_70686_c1 3300050512 Bacteria 3459
241 nmdc:mga0rr50_1299247_c1 3300050513 Unclassified 617
242 nmdc:mga0rr50_46896_c1 3300050513 Bacteria 3183
243 nmdc:mga0rr50_511223_c1 3300050513 Bacteria 1022
244 nmdc:mga0rr50_91692_c1 3300050513 Bacteria 2367
245 nmdc:mga08x19_473087_c1 3300050514 Unclassified 883
246 nmdc:mga0a205_364748_c1 3300050515 Bacteria 1311
247 Ga0495619_0265016 3300053085 Unclassified 1191
248 Ga0495619_0462483 3300053085 Bacteria 874
249 Ga0501084_1402863 3300054114 Unclassified 585
250 Ga0530510_0278290 3300061734 Bacteria 1250
251 Ga0213872_10051483
252 bgg_mtDRAFT_1044070
253 Ga0065704_10285041
254 Ga0070670_100541662
255 Ga0070682_101276194
256 Ga0070687_100672475
257 Ga0070668_100005359
258 Ga0070668_102186619
259 Ga0070671_100305895
260 Ga0070671_101212170
261 Ga0070688_101378901
262 Ga0070667_100013860
263 Ga0070709_10316419
264 Ga0070714_100119393
265 Ga0070714_100176447
266 Ga0070714_101502644
267 Ga0070713_100075406
268 Ga0070713_100108047
269 Ga0070713_100295763
270 Ga0070710_10141768
271 Ga0070711_100952884
272 Ga0070706_100220024
273 Ga0070698_100242604
274 Ga0070697_100025407
275 Ga0068853_102073381
276 Ga0070704_102098564
277 Ga0068859_100506280
278 Ga0068861_100332396
279 Ga0068861_101426602
280 Ga0068863_100178048
281 Ga0068860_100392605
282 Ga0068862_100050673
283 Ga0068862_100605031
284 Ga0081455_10008888
285 Ga0081540_1081587
286 Ga0081539_10030074
287 Ga0070717_10120459
288 Ga0070717_10789013
289 Ga0070717_10850346
290 Ga0070717_10930350
291 Ga0075365_10089391
292 Ga0075365_10259806
293 Ga0075364_10471663
294 Ga0075432_10087418
295 Ga0070715_10015452
296 Ga0070712_100038710
297 Ga0070712_100094905
298 Ga0070712_100205100
299 Ga0075428_100049084
300 Ga0075428_100087126
301 Ga0075428_100107329
302 Ga0075428_100171578
303 Ga0075428_100403379
304 Ga0075428_101100625
305 Ga0075428_101211705
306 Ga0075428_101349766
307 Ga0075430_100002883
308 Ga0075430_100206319
309 Ga0075430_100241403
310 Ga0075430_100378353
311 Ga0075431_100013435
312 Ga0075431_100015147
313 Ga0075431_100107248
314 Ga0075431_100695386
315 Ga0075431_101103960
316 Ga0075431_101181815
317 Ga0075433_10209532
318 Ga0075433_10791972
319 Ga0075434_100223464
320 Ga0075434_100268833
321 Ga0075434_101236116
322 Ga0075429_100024206
323 Ga0075429_100147782
324 Ga0075429_101250941
325 Ga0075436_100507097
326 Ga0097620_100506231
327 Ga0075435_100097890
328 Ga0075435_100218828
329 Ga0075435_100338013
330 Ga0075435_100634395
331 Ga0075435_101111799
332 Ga0111539_10075895
333 Ga0111539_10711765
334 Ga0111539_10840129
335 Ga0111539_12101309
336 Ga0105245_11819194
337 Ga0105247_10379253
338 Ga0114129_10009649
339 Ga0114129_10054307
340 Ga0114129_10113178
341 Ga0114129_10510575
342 Ga0114129_10520569
343 Ga0114129_10531452
344 Ga0105242_10788863
345 Ga0105248_10873702
346 Ga0105237_10821106
347 Ga0105249_10116852
348 Ga0105239_10513396
349 Ga0105239_11124513
350 Ga0105246_11030989
351 Ga0157378_10464600
352 Ga0163162_10543933
353 Ga0163162_11341950
354 Ga0157372_10949640
355 Ga0157380_11652804
356 Ga0157380_12795831
357 Ga0182008_10139488
358 Ga0157379_10378748
359 Ga0157376_12847291
360 Ga0206351_10103389
361 Ga0206350_11543828
362 Ga0206350_11561678
363 Ga0213872_10023759
364 Ga0213874_10002603
365 Ga0213874_10162212
366 Ga0213875_10284555
367 Ga0224712_10457257
368 Ga0224712_10657986
369 Ga0207710_10441351
370 Ga0207647_10641992
371 Ga0207685_10005503
372 Ga0207684_10378966
373 Ga0207663_10701387
374 Ga0207663_11627695
375 Ga0207650_10246090
376 Ga0207659_11800141
377 Ga0207700_10481666
378 Ga0207700_10585552
379 Ga0207700_10633742
380 Ga0207700_10788558
381 Ga0207700_11711680
382 Ga0207664_10119115
383 Ga0207644_10242737
384 Ga0207644_11266484
385 Ga0207665_10101728
386 Ga0207712_11106674
387 Ga0207668_10011075
388 Ga0207658_10032502
389 Ga0207675_101727830
390 Ga0207428_10068443
391 Ga0207428_10307226
392 Ga0207428_10959139
393 Ga0268265_10013161
394 Ga0268264_10080349
395 Ga0316579_10304462
396 Ga0316577_10331194
397 Ga0316583_10026758
398 Ga0316585_10127950
399 Ga0316585_10180069
400 Ga0316580_10058109
401 Ga0316593_10100594
402 Ga0316592_1022312
403 Ga0316586_1028678
404 Ga0316588_1024554
405 Ga0316587_1012703
406 Ga0316596_1016962
407 Ga0316574_0195453
408 Ga0316574_0502737
409 Ga0316574_0786289
410 Ga0373931_0530288
411 Ga0316582_0091590
412 Ga0316582_0548359
413 Ga0316584_0146192
414 Ga0316584_0195842
415 Ga0316581_0135734
416 Ga0436364_1231336
417 Ga0436364_1310065
418 Ga0436360_0232039
419 Ga0436360_1007522
420 Ga0436361_0699230
421 Ga0436361_1122798
422 Ga0436363_0164375
423 Ga0436363_0634176
424 Ga0436363_0960696
425 Ga0436363_1115021
426 Ga0436363_1602160
427 Ga0439440_0287459
428 Ga0466957_0986556
429 Ga0495629_0162228
430 Ga0495629_0501384
431 Ga0495665_0204212
432 Ga0495676_0645484
433 Ga0496100_0235886
434 Ga0496101_0230375
435 Ga0496101_0342874
436 Ga0496102_0846293
437 Ga0496104_0050468
438 Ga0496104_0549340
439 Ga0496105_0177795
440 Ga0496105_0272120
441 Ga0496105_0965120
442 Ga0496106_0341225
443 Ga0496106_0347503
444 Ga0496107_0601477
445 Ga0496108_0117097
446 Ga0496108_0334192
447 Ga0496108_1750917
448 Ga0496109_0070491
449 Ga0496109_0439861
450 Ga0496110_0065778
451 Ga0496110_0241073
452 Ga0496110_0296879
453 Ga0496111_0090426
454 Ga0496111_0300942
455 Ga0496112_0129251
456 Ga0496113_0374254
457 Ga0496115_0028857
458 Ga0496115_0101767
459 Ga0496115_0112667
460 Ga0496115_0665436
461 Ga0501070_0153539
462 Ga0501071_0456978
463 Ga0501072_0538574
464 Ga0501075_1041153
465 Ga0501076_0162312
466 Ga0501076_0180726
467 Ga0501079_0577674
468 nmdc:mga00v17_167748_c1
469 nmdc:mga0yw44_123477_c1
470 nmdc:mga05p37_1528287_c1
471 nmdc:mga05p37_1910835_c1
472 nmdc:mga05p37_20520_c1
473 nmdc:mga05p37_235279_c1
474 nmdc:mga05p37_510728_c1
475 nmdc:mga05p37_843631_c1
476 nmdc:mga09592_100749_c1
477 nmdc:mga09592_170394_c1
478 nmdc:mga0qj67_333233_c1
479 nmdc:mga06r32_101722_c1
480 nmdc:mga06r32_10850_c1
481 nmdc:mga06r32_59387_c1
482 nmdc:mga06r32_676077_c1
483 nmdc:mga06r32_88798_c1
484 nmdc:mga06r32_973892_c1
485 nmdc:mga08y16_23533_c1
486 nmdc:mga08y16_618603_c1
487 nmdc:mga0n895_1223378_c1
488 nmdc:mga0n895_250854_c1
489 nmdc:mga0n895_258377_c1
490 nmdc:mga0n895_70686_c1
491 nmdc:mga0rr50_1299247_c1
492 nmdc:mga0rr50_46896_c1
493 nmdc:mga0rr50_511223_c1
494 nmdc:mga0rr50_91692_c1
495 nmdc:mga08x19_473087_c1
496 nmdc:mga0a205_364748_c1
497 Ga0495619_0265016
498 Ga0495619_0462483
499 Ga0501084_1402863
500 Ga0530510_0278290

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

42

141

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8588 19 108
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.8545 12 107
2cg9-assembly1.cif.gz_Y crystal structure of an hsp90-sba1 closed chaperone complex 0.8531 16 109
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.8375 12 107
5zul-assembly1.cif.gz_A-2 small heat shock protein from mycobacterium marinum m : form-3 0.8352 12 107
ID Description Score Start End Superfamily
af_Q8S1F2_1_96_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9082 15 108 2.60.40.790
af_Q208N7_181_285_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8565 14 109 2.60.40.790
2cg9Y01 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8531 16 109 2.60.40.790
af_Q9VHT3_1_91_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8518 16 108 2.60.40.790
af_P83868_1_125_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8498 17 108 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A1F6GLU0-F1-model_v4 SHSP domain-containing protein 0.9211 11 120
AF-A0A7C3GUG4-F1-model_v4 Hsp20/alpha crystallin family protein 0.9062 16 120
AF-A0A6H0J076-F1-model_v4 Hsp20/alpha crystallin family protein 0.9046 11 120
AF-A0A7C3E8E3-F1-model_v4 Hsp20/alpha crystallin family protein 0.9039 15 120
AF-A0A3M1V4Z6-F1-model_v4 Hsp20/alpha crystallin family protein 0.9016 16 120

Map