F361532
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 250 | 151 | 134 | 72 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_11659567|Ga0105241_116595671 |
| Length | 79 |
| Sequence | MSKLIEMARQFHDDENGAAMVEYSILIGIIAGAAILAIVAIGGWVSGRFTGLCGILDGKGLTATAGTSGTCKATTGTGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 2 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 3 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 4 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 5 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 6 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 7 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 8 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 9 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 10 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 11 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 12 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 13 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 14 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 15 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 16 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 17 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 18 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 19 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 20 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 21 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 22 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 23 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 24 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 25 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 26 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 27 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 28 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 29 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 30 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 31 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 32 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 33 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 34 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 35 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 36 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 37 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 38 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 39 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 40 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 41 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 42 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 43 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 44 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 45 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 46 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 47 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 48 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 49 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 50 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 51 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 52 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 53 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 54 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 55 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 56 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 57 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 58 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 59 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 60 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 61 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 62 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 63 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 64 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 65 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 66 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 67 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 68 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 69 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 87 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 88 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 89 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 90 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 91 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 97 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 98 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 99 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 100 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 101 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 102 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 103 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 104 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 105 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 106 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 107 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 108 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 109 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 110 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 111 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 147 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 148 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 149 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 150 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 151 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 32.4 |
| Metatranscriptomes | 31.2 |
| Isolates | 36.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.2 |
| Nodule | 33.6 |
| Rhizoplane | 1.2 |
| Rhizosphere | 47.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1001580 | 3300002705 | Bacteria | 9377 |
| 2 | JGI25157J39369_1000744 | 3300002741 | Bacteria | 17229 |
| 3 | Ga0058859_11726275 | 3300004798 | Bacteria | 502 |
| 4 | Ga0070682_101947934 | 3300005337 | Bacteria | 516 |
| 5 | Ga0068855_100972465 | 3300005563 | Bacteria | 893 |
| 6 | Ga0075365_10004901 | 3300006038 | Bacteria | 7154 |
| 7 | Ga0075364_10170830 | 3300006051 | Bacteria | 1470 |
| 8 | Ga0075364_10463890 | 3300006051 | Bacteria | 865 |
| 9 | Ga0075364_11099069 | 3300006051 | Bacteria | 540 |
| 10 | Ga0075362_10021728 | 3300006177 | Bacteria | 2698 |
| 11 | Ga0075362_10173906 | 3300006177 | Bacteria | 1041 |
| 12 | Ga0075369_10013740 | 3300006186 | Bacteria | 3221 |
| 13 | Ga0075369_10205062 | 3300006186 | Bacteria | 910 |
| 14 | Ga0075366_10598116 | 3300006195 | Bacteria | 684 |
| 15 | Ga0075370_10389757 | 3300006353 | Bacteria | 835 |
| 16 | Ga0075370_10930744 | 3300006353 | Bacteria | 532 |
| 17 | Ga0105240_10324481 | 3300009093 | Bacteria | 1754 |
| 18 | Ga0105240_10327206 | 3300009093 | Bacteria | 1745 |
| 19 | Ga0105241_11659567 | 3300009174 | Bacteria | 620 |
| 20 | Ga0105237_10367353 | 3300009545 | Bacteria | 1444 |
| 21 | Ga0105239_10155931 | 3300010375 | Bacteria | 2550 |
| 22 | Ga0105239_10514964 | 3300010375 | Bacteria | 1361 |
| 23 | Ga0105239_13317479 | 3300010375 | Bacteria | 524 |
| 24 | Ga0206352_10562369 | 3300020078 | Bacteria | 594 |
| 25 | Ga0206353_10319156 | 3300020082 | Bacteria | 596 |
| 26 | Ga0209026_1000116 | 3300025250 | Bacteria | 133228 |
| 27 | Ga0209759_1000153 | 3300025256 | Bacteria | 119494 |
| 28 | Ga0207695_10332178 | 3300025913 | Bacteria | 1408 |
| 29 | Ga0207695_11104125 | 3300025913 | Bacteria | 673 |
| 30 | Ga0395899_0000295 | 3300037312 | Bacteria | 64132 |
| 31 | Ga0395900_0003677 | 3300037418 | Bacteria | 16485 |
| 32 | Ga0395900_0972968 | 3300037418 | Bacteria | 769 |
| 33 | Ga0395900_1007196 | 3300037418 | Unclassified | 753 |
| 34 | Ga0395898_0000634 | 3300037466 | Bacteria | 64132 |
| 35 | Ga0395898_1237502 | 3300037466 | Bacteria | 677 |
| 36 | Ga0395905_0000367 | 3300037471 | Bacteria | 64132 |
| 37 | Ga0395905_0742113 | 3300037471 | Bacteria | 884 |
| 38 | Ga0395905_1059510 | 3300037471 | Bacteria | 714 |
| 39 | Ga0395901_0000274 | 3300038443 | Bacteria | 64132 |
| 40 | Ga0395901_0145510 | 3300038443 | Bacteria | 2491 |
| 41 | Ga0395901_2025209 | 3300038443 | Bacteria | 522 |
| 42 | Ga0495638_0156477 | 3300046460 | Bacteria | 1318 |
| 43 | Ga0495638_0223890 | 3300046460 | Bacteria | 1050 |
| 44 | Ga0495620_0048847 | 3300046515 | Bacteria | 1814 |
| 45 | Ga0495620_0149241 | 3300046515 | Bacteria | 912 |
| 46 | Ga0495643_0512622 | 3300046522 | Unclassified | 515 |
| 47 | Ga0495625_0190979 | 3300046660 | Bacteria | 1357 |
| 48 | Ga0495686_0272275 | 3300047472 | Bacteria | 944 |
| 49 | Ga0496102_0087425 | 3300048905 | Bacteria | 2880 |
| 50 | Ga0496111_1092814 | 3300048914 | Bacteria | 569 |
| 51 | Ga0496115_0669348 | 3300048918 | Unclassified | 819 |
| 52 | nmdc:mga03683_167984_c1 | 3300050489 | Bacteria | 996 |
| 53 | nmdc:mga03683_34508_c1 | 3300050489 | Bacteria | 2047 |
| 54 | nmdc:mga03683_471492_c1 | 3300050489 | Bacteria | 606 |
| 55 | nmdc:mga00v17_217647_c1 | 3300050491 | Bacteria | 1236 |
| 56 | nmdc:mga00v17_254394_c1 | 3300050491 | Bacteria | 1139 |
| 57 | nmdc:mga00v17_86578_c1 | 3300050491 | Bacteria | 1963 |
| 58 | nmdc:mga00v17_911114_c1 | 3300050491 | Bacteria | 556 |
| 59 | nmdc:mga0yw44_3708_c1 | 3300050492 | Bacteria | 6839 |
| 60 | nmdc:mga0yw44_67870_c1 | 3300050492 | Bacteria | 2205 |
| 61 | nmdc:mga0k408_358463_c1 | 3300050493 | Bacteria | 869 |
| 62 | nmdc:mga0k408_92307_c1 | 3300050493 | Bacteria | 1779 |
| 63 | nmdc:mga06z11_70189_c1 | 3300050494 | Bacteria | 1851 |
| 64 | nmdc:mga07m45_49373_c1 | 3300050496 | Bacteria | 2368 |
| 65 | nmdc:mga0sz30_10481_c1 | 3300050516 | Bacteria | 3556 |
| 66 | nmdc:mga0sz30_114372_c1 | 3300050516 | Bacteria | 887 |
| 67 | nmdc:mga0sz30_494349_c1 | 3300050516 | Bacteria | 550 |
| 68 | Ga0500658_0101560 | 3300053134 | Bacteria | 1256 |
| 69 | Ga0500604_0049988 | 3300053151 | Bacteria | 1287 |
| 70 | Ga0500620_067109 | 3300053155 | Bacteria | 1229 |
| 71 | Ga0500627_0007883 | 3300053158 | Bacteria | 3744 |
| 72 | Ga0500627_0013813 | 3300053158 | Bacteria | 3076 |
| 73 | Ga0500611_132666 | 3300053727 | Bacteria | 672 |
| 74 | Ga0587084_006980 | 3300059477 | Bacteria | 1389 |
| 75 | Ga0587084_114008 | 3300059477 | Bacteria | 562 |
| 76 | Ga0587084_118507 | 3300059477 | Bacteria | 554 |
| 77 | Ga0587093_006039 | 3300059478 | Bacteria | 1303 |
| 78 | Ga0587093_071602 | 3300059478 | Bacteria | 583 |
| 79 | Ga0587066_008939 | 3300059490 | Bacteria | 1405 |
| 80 | Ga0587066_129342 | 3300059490 | Bacteria | 605 |
| 81 | Ga0587066_157053 | 3300059490 | Bacteria | 568 |
| 82 | Ga0587066_187908 | 3300059490 | Bacteria | 536 |
| 83 | Ga0587070_019330 | 3300059491 | Bacteria | 1127 |
| 84 | Ga0587073_0119970 | 3300059492 | Bacteria | 709 |
| 85 | Ga0587077_120813 | 3300059493 | Bacteria | 653 |
| 86 | Ga0587077_179227 | 3300059493 | Bacteria | 573 |
| 87 | Ga0587077_218737 | 3300059493 | Bacteria | 536 |
| 88 | Ga0587080_040539 | 3300059503 | Bacteria | 847 |
| 89 | Ga0587080_046691 | 3300059503 | Bacteria | 806 |
| 90 | Ga0587082_158215 | 3300059504 | Bacteria | 541 |
| 91 | Ga0587083_0013856 | 3300059505 | Bacteria | 1379 |
| 92 | Ga0587083_0251442 | 3300059505 | Bacteria | 527 |
| 93 | Ga0587085_006971 | 3300059506 | Bacteria | 1394 |
| 94 | Ga0587085_113924 | 3300059506 | Bacteria | 586 |
| 95 | Ga0587086_037491 | 3300059507 | Bacteria | 737 |
| 96 | Ga0587086_115705 | 3300059507 | Bacteria | 508 |
| 97 | Ga0587088_010269 | 3300059508 | Bacteria | 1367 |
| 98 | Ga0587090_089219 | 3300059510 | Bacteria | 629 |
| 99 | Ga0587091_055270 | 3300059511 | Bacteria | 827 |
| 100 | Ga0587091_210333 | 3300059511 | Bacteria | 527 |
| 101 | Ga0587092_014756 | 3300059512 | Bacteria | 1135 |
| 102 | Ga0587092_044603 | 3300059512 | Bacteria | 783 |
| 103 | Ga0587094_006349 | 3300059513 | Bacteria | 1414 |
| 104 | Ga0587094_079644 | 3300059513 | Bacteria | 604 |
| 105 | Ga0587095_006668 | 3300059514 | Bacteria | 901 |
| 106 | Ga0587129_030583 | 3300059608 | Bacteria | 516 |
| 107 | Ga0587109_006797 | 3300059624 | Bacteria | 1706 |
| 108 | Ga0587109_141201 | 3300059624 | Bacteria | 588 |
| 109 | Ga0587117_115458 | 3300059627 | Bacteria | 526 |
| 110 | Ga0587127_021176 | 3300059629 | Bacteria | 577 |
| 111 | Ga0587128_089827 | 3300059630 | Bacteria | 628 |
| 112 | Ga0587062_016809 | 3300059639 | Bacteria | 994 |
| 113 | Ga0587062_101542 | 3300059639 | Bacteria | 561 |
| 114 | Ga0587067_107885 | 3300059640 | Bacteria | 653 |
| 115 | Ga0587067_160287 | 3300059640 | Bacteria | 572 |
| 116 | Ga0587068_024576 | 3300059641 | Bacteria | 1010 |
| 117 | Ga0587068_138534 | 3300059641 | Bacteria | 542 |
| 118 | Ga0587069_074450 | 3300059642 | Bacteria | 651 |
| 119 | Ga0587069_152665 | 3300059642 | Bacteria | 514 |
| 120 | Ga0587072_013059 | 3300059643 | Bacteria | 1380 |
| 121 | Ga0587072_039282 | 3300059643 | Bacteria | 914 |
| 122 | Ga0587072_199915 | 3300059643 | Bacteria | 508 |
| 123 | Ga0587075_096787 | 3300059644 | Bacteria | 584 |
| 124 | Ga0587076_132013 | 3300059645 | Bacteria | 589 |
| 125 | Ga0587076_134259 | 3300059645 | Bacteria | 586 |
| 126 | Ga0587076_148533 | 3300059645 | Bacteria | 567 |
| 127 | Ga0587076_164549 | 3300059645 | Bacteria | 548 |
| 128 | Ga0587078_067925 | 3300059646 | Bacteria | 552 |
| 129 | Ga0587079_027814 | 3300059647 | Bacteria | 1066 |
| 130 | Ga0587104_022234 | 3300059650 | Bacteria | 534 |
| 131 | Ga0587107_104797 | 3300059652 | Bacteria | 564 |
| 132 | Ga0587071_065177 | 3300060344 | Bacteria | 782 |
| 133 | Ga0587071_133033 | 3300060344 | Bacteria | 605 |
| 134 | Ga0587111_0191199 | 3300060346 | Bacteria | 575 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2756170246 | 2756676307 | 60 |
| 2 | iso_pu_bacteria | 2958100919 | 2958106885 | 62 |
| 3 | iso_pu_bacteria | 2958172287 | 2958172974 | 62 |
| 4 | iso_pu_bacteria | 2979710463 | 2979712847 | 62 |
| 5 | 3300037418 | Ga0395900_1007196 | Ga0395900_1007196_243_494 | 63 |
| 6 | 3300006038 | Ga0075365_10004901 | Ga0075365_1000490110 | 64 |
| 7 | 3300006051 | Ga0075364_10170830 | Ga0075364_101708305 | 64 |
| 8 | 3300006051 | Ga0075364_10463890 | Ga0075364_104638901 | 64 |
| 9 | 3300006177 | Ga0075362_10021728 | Ga0075362_100217281 | 64 |
| 10 | 3300006177 | Ga0075362_10173906 | Ga0075362_101739062 | 64 |
| 11 | 3300006186 | Ga0075369_10013740 | Ga0075369_100137405 | 64 |
| 12 | 3300048905 | Ga0496102_0087425 | Ga0496102_0087425_1643_1858 | 64 |
| 13 | 3300050489 | nmdc:mga03683_167984_c1 | nmdc:mga03683_167984_c1_584_793 | 64 |
| 14 | 3300050489 | nmdc:mga03683_34508_c1 | nmdc:mga03683_34508_c1_52_261 | 64 |
| 15 | 3300050491 | nmdc:mga00v17_254394_c1 | nmdc:mga00v17_254394_c1_176_385 | 64 |
| 16 | 3300050491 | nmdc:mga00v17_86578_c1 | nmdc:mga00v17_86578_c1_1003_1212 | 64 |
| 17 | 3300050492 | nmdc:mga0yw44_3708_c1 | nmdc:mga0yw44_3708_c1_5658_5867 | 64 |
| 18 | 3300050493 | nmdc:mga0k408_92307_c1 | nmdc:mga0k408_92307_c1_1068_1277 | 64 |
| 19 | 3300050494 | nmdc:mga06z11_70189_c1 | nmdc:mga06z11_70189_c1_480_689 | 64 |
| 20 | 3300050516 | nmdc:mga0sz30_10481_c1 | nmdc:mga0sz30_10481_c1_1062_1271 | 64 |
| 21 | 3300050516 | nmdc:mga0sz30_494349_c1 | nmdc:mga0sz30_494349_c1_174_383 | 64 |
| 22 | 3300059645 | Ga0587076_132013 | Ga0587076_132013_357_572 | 64 |
| 23 | iso_pu_bacteria | 2906378014 | 2906380838 | 64 |
| 24 | 3300037466 | Ga0395898_1237502 | Ga0395898_1237502_139_378 | 65 |
| 25 | iso_pu_bacteria | 2937822353 | 2937828840 | 65 |
| 26 | iso_pu_bacteria | 2847686936 | 2847691772 | 66 |
| 27 | iso_pu_bacteria | 2871444079 | 2871446818 | 66 |
| 28 | iso_pu_bacteria | 2874102143 | 2874102520 | 66 |
| 29 | iso_pu_bacteria | 2874168670 | 2874171163 | 66 |
| 30 | iso_pu_bacteria | 2922158528 | 2922160751 | 66 |
| 31 | iso_pu_bacteria | 2924726620 | 2924726919 | 66 |
| 32 | iso_pu_bacteria | 2958115193 | 2958121408 | 66 |
| 33 | iso_pu_bacteria | 2968097103 | 2968101199 | 66 |
| 34 | iso_pu_bacteria | 2979779861 | 2979785811 | 66 |
| 35 | iso_pu_bacteria | 2996341866 | 2996347999 | 66 |
| 36 | iso_pu_bacteria | 8004703790 | 8004713141 | 66 |
| 37 | 3300006051 | Ga0075364_11099069 | Ga0075364_110990692 | 67 |
| 38 | 3300006186 | Ga0075369_10205062 | Ga0075369_102050622 | 67 |
| 39 | 3300006195 | Ga0075366_10598116 | Ga0075366_105981162 | 67 |
| 40 | 3300050491 | nmdc:mga00v17_217647_c1 | nmdc:mga00v17_217647_c1_138_356 | 67 |
| 41 | 3300050491 | nmdc:mga00v17_911114_c1 | nmdc:mga00v17_911114_c1_180_398 | 67 |
| 42 | 3300050492 | nmdc:mga0yw44_67870_c1 | nmdc:mga0yw44_67870_c1_692_910 | 67 |
| 43 | 3300050493 | nmdc:mga0k408_358463_c1 | nmdc:mga0k408_358463_c1_496_714 | 67 |
| 44 | 3300050516 | nmdc:mga0sz30_114372_c1 | nmdc:mga0sz30_114372_c1_62_280 | 67 |
| 45 | iso_pu_bacteria | 2881853255 | 2881855723 | 67 |
| 46 | iso_pu_bacteria | 2508501127 | 2509140799 | 68 |
| 47 | iso_pu_bacteria | 2513237305 | 2514417870 | 68 |
| 48 | iso_pu_bacteria | 2513237305 | 2514417871 | 68 |
| 49 | iso_pu_bacteria | 2597489875 | 2597811418 | 68 |
| 50 | iso_pu_bacteria | 2597489875 | 2597813479 | 68 |
| 51 | iso_pu_bacteria | 2721755686 | 2723578290 | 68 |
| 52 | iso_pu_bacteria | 2721755686 | 2723578291 | 68 |
| 53 | iso_pu_bacteria | 2847670302 | 2847672664 | 68 |
| 54 | iso_pu_bacteria | 2856342000 | 2856347331 | 68 |
| 55 | iso_pu_bacteria | 2856342000 | 2856348055 | 68 |
| 56 | iso_pu_bacteria | 2856364286 | 2856365886 | 68 |
| 57 | iso_pu_bacteria | 2869285874 | 2869286773 | 68 |
| 58 | iso_pu_bacteria | 2871429161 | 2871434036 | 68 |
| 59 | iso_pu_bacteria | 2871488783 | 2871490125 | 68 |
| 60 | iso_pu_bacteria | 2874146452 | 2874147694 | 68 |
| 61 | iso_pu_bacteria | 2874155637 | 2874156613 | 68 |
| 62 | iso_pu_bacteria | 2876377896 | 2876385378 | 68 |
| 63 | iso_pu_bacteria | 2876377896 | 2876385379 | 68 |
| 64 | iso_pu_bacteria | 2876413966 | 2876414814 | 68 |
| 65 | iso_pu_bacteria | 2878035449 | 2878042033 | 68 |
| 66 | iso_pu_bacteria | 2878745973 | 2878746746 | 68 |
| 67 | iso_pu_bacteria | 2878753008 | 2878753189 | 68 |
| 68 | iso_pu_bacteria | 2881845957 | 2881852424 | 68 |
| 69 | iso_pu_bacteria | 2882912400 | 2882918937 | 68 |
| 70 | iso_pu_bacteria | 2885305155 | 2885308774 | 68 |
| 71 | iso_pu_bacteria | 2885312484 | 2885318640 | 68 |
| 72 | iso_pu_bacteria | 2885318864 | 2885321625 | 68 |
| 73 | iso_pu_bacteria | 2885318864 | 2885321626 | 68 |
| 74 | iso_pu_bacteria | 2888343758 | 2888345219 | 68 |
| 75 | iso_pu_bacteria | 2888343758 | 2888347074 | 68 |
| 76 | iso_pu_bacteria | 2889010040 | 2889013833 | 68 |
| 77 | iso_pu_bacteria | 2889010040 | 2889013834 | 68 |
| 78 | iso_pu_bacteria | 2889016732 | 2889021472 | 68 |
| 79 | iso_pu_bacteria | 2889016732 | 2889021473 | 68 |
| 80 | iso_pu_bacteria | 2903492973 | 2903498046 | 68 |
| 81 | iso_pu_bacteria | 2903492973 | 2903498189 | 68 |
| 82 | iso_pu_bacteria | 2906308376 | 2906309127 | 68 |
| 83 | iso_pu_bacteria | 2906321335 | 2906326733 | 68 |
| 84 | iso_pu_bacteria | 2906414383 | 2906415106 | 68 |
| 85 | iso_pu_bacteria | 2924754689 | 2924759657 | 68 |
| 86 | iso_pu_bacteria | 2924754689 | 2924761170 | 68 |
| 87 | iso_pu_bacteria | 2937813078 | 2937814015 | 68 |
| 88 | iso_pu_bacteria | 2937822353 | 2937829019 | 68 |
| 89 | iso_pu_bacteria | 2937822353 | 2937829020 | 68 |
| 90 | iso_pu_bacteria | 2938014810 | 2938018054 | 68 |
| 91 | iso_pu_bacteria | 2938014810 | 2938018055 | 68 |
| 92 | iso_pu_bacteria | 2958064165 | 2958068342 | 68 |
| 93 | iso_pu_bacteria | 2958130278 | 2958131176 | 68 |
| 94 | iso_pu_bacteria | 2958179912 | 2958180575 | 68 |
| 95 | iso_pu_bacteria | 2961077736 | 2961078410 | 68 |
| 96 | iso_pu_bacteria | 2961127735 | 2961129996 | 68 |
| 97 | iso_pu_bacteria | 2965119406 | 2965124200 | 68 |
| 98 | iso_pu_bacteria | 2965119406 | 2965124201 | 68 |
| 99 | iso_pu_bacteria | 2967996073 | 2968002861 | 68 |
| 100 | iso_pu_bacteria | 2968003550 | 2968005258 | 68 |
| 101 | iso_pu_bacteria | 2970524798 | 2970526925 | 68 |
| 102 | iso_pu_bacteria | 2970524798 | 2970530593 | 68 |
| 103 | iso_pu_bacteria | 2970540015 | 2970543856 | 68 |
| 104 | iso_pu_bacteria | 2970540015 | 2970546655 | 68 |
| 105 | iso_pu_bacteria | 2977821940 | 2977822120 | 68 |
| 106 | iso_pu_bacteria | 2977828996 | 2977829516 | 68 |
| 107 | iso_pu_bacteria | 2977843712 | 2977845282 | 68 |
| 108 | iso_pu_bacteria | 2977858184 | 2977858670 | 68 |
| 109 | iso_pu_bacteria | 2987652177 | 2987658512 | 68 |
| 110 | iso_pu_bacteria | 2987652177 | 2987658513 | 68 |
| 111 | iso_pu_bacteria | 3000135777 | 3000142305 | 68 |
| 112 | iso_pu_bacteria | 3000135777 | 3000142306 | 68 |
| 113 | iso_pu_bacteria | 8004374579 | 8004374760 | 68 |
| 114 | iso_pu_bacteria | 8004387939 | 8004388056 | 68 |
| 115 | iso_pu_bacteria | 8004395343 | 8004396573 | 68 |
| 116 | iso_pu_bacteria | 8004395343 | 8004403398 | 68 |
| 117 | iso_pu_bacteria | 8004445564 | 8004448339 | 68 |
| 118 | iso_pu_bacteria | 8004714634 | 8004715384 | 68 |
| 119 | 3300005337 | Ga0070682_101947934 | Ga0070682_1019479341 | 69 |
| 120 | 3300005563 | Ga0068855_100972465 | Ga0068855_1009724652 | 69 |
| 121 | 3300006353 | Ga0075370_10389757 | Ga0075370_103897572 | 69 |
| 122 | 3300046460 | Ga0495638_0223890 | Ga0495638_0223890_760_969 | 69 |
| 123 | 3300046515 | Ga0495620_0048847 | Ga0495620_0048847_50_259 | 69 |
| 124 | 3300046660 | Ga0495625_0190979 | Ga0495625_0190979_680_889 | 69 |
| 125 | 3300047472 | Ga0495686_0272275 | Ga0495686_0272275_448_657 | 69 |
| 126 | 3300050496 | nmdc:mga07m45_49373_c1 | nmdc:mga07m45_49373_c1_1442_1651 | 69 |
| 127 | 3300053134 | Ga0500658_0101560 | Ga0500658_0101560_362_571 | 69 |
| 128 | 3300053151 | Ga0500604_0049988 | Ga0500604_0049988_150_359 | 69 |
| 129 | 3300053155 | Ga0500620_067109 | Ga0500620_067109_377_586 | 69 |
| 130 | 3300053158 | Ga0500627_0007883 | Ga0500627_0007883_1533_1742 | 69 |
| 131 | 3300053158 | Ga0500627_0013813 | Ga0500627_0013813_1729_1938 | 69 |
| 132 | 3300053727 | Ga0500611_132666 | Ga0500611_132666_377_586 | 69 |
| 133 | 3300006353 | Ga0075370_10930744 | Ga0075370_109307441 | 70 |
| 134 | 3300009093 | Ga0105240_10324481 | Ga0105240_103244811 | 70 |
| 135 | 3300010375 | Ga0105239_10155931 | Ga0105239_101559313 | 70 |
| 136 | 3300025913 | Ga0207695_11104125 | Ga0207695_111041252 | 70 |
| 137 | 3300046460 | Ga0495638_0156477 | Ga0495638_0156477_113_325 | 70 |
| 138 | 3300048918 | Ga0496115_0669348 | Ga0496115_0669348_480_692 | 70 |
| 139 | 3300050489 | nmdc:mga03683_471492_c1 | nmdc:mga03683_471492_c1_103_315 | 70 |
| 140 | 3300009093 | Ga0105240_10324481 | Ga0105240_103244812 | 71 |
| 141 | 3300010375 | Ga0105239_10155931 | Ga0105239_101559314 | 71 |
| 142 | 3300025913 | Ga0207695_11104125 | Ga0207695_111041251 | 71 |
| 143 | 3300048914 | Ga0496111_1092814 | Ga0496111_1092814_154_369 | 71 |
| 144 | 3300059477 | Ga0587084_114008 | Ga0587084_114008_48_281 | 71 |
| 145 | 3300002705 | JGI25156J39149_1001580 | JGI25156J39149_10015802 | 72 |
| 146 | 3300002741 | JGI25157J39369_1000744 | JGI25157J39369_10007444 | 72 |
| 147 | 3300004798 | Ga0058859_11726275 | Ga0058859_117262752 | 72 |
| 148 | 3300009093 | Ga0105240_10327206 | Ga0105240_103272062 | 72 |
| 149 | 3300009174 | Ga0105241_11659567 | Ga0105241_116595671 | 72 |
| 150 | 3300009545 | Ga0105237_10367353 | Ga0105237_103673532 | 72 |
| 151 | 3300010375 | Ga0105239_10514964 | Ga0105239_105149642 | 72 |
| 152 | 3300010375 | Ga0105239_10514964 | Ga0105239_105149643 | 72 |
| 153 | 3300010375 | Ga0105239_13317479 | Ga0105239_133174792 | 72 |
| 154 | 3300020078 | Ga0206352_10562369 | Ga0206352_105623691 | 72 |
| 155 | 3300020082 | Ga0206353_10319156 | Ga0206353_103191562 | 72 |
| 156 | 3300025250 | Ga0209026_1000116 | Ga0209026_100011629 | 72 |
| 157 | 3300025256 | Ga0209759_1000153 | Ga0209759_100015394 | 72 |
| 158 | 3300025913 | Ga0207695_10332178 | Ga0207695_103321782 | 72 |
| 159 | 3300037312 | Ga0395899_0000295 | Ga0395899_0000295_57997_58233 | 72 |
| 160 | 3300037312 | Ga0395899_0000295 | Ga0395899_0000295_58289_58525 | 72 |
| 161 | 3300037418 | Ga0395900_0003677 | Ga0395900_0003677_14569_14805 | 72 |
| 162 | 3300037418 | Ga0395900_0003677 | Ga0395900_0003677_14861_15097 | 72 |
| 163 | 3300037418 | Ga0395900_0972968 | Ga0395900_0972968_124_363 | 72 |
| 164 | 3300037418 | Ga0395900_0972968 | Ga0395900_0972968_417_653 | 72 |
| 165 | 3300037466 | Ga0395898_0000634 | Ga0395898_0000634_3478_3714 | 72 |
| 166 | 3300037466 | Ga0395898_0000634 | Ga0395898_0000634_3770_4006 | 72 |
| 167 | 3300037471 | Ga0395905_0000367 | Ga0395905_0000367_49445_49681 | 72 |
| 168 | 3300037471 | Ga0395905_0000367 | Ga0395905_0000367_49737_49973 | 72 |
| 169 | 3300037471 | Ga0395905_0742113 | Ga0395905_0742113_285_524 | 72 |
| 170 | 3300037471 | Ga0395905_0742113 | Ga0395905_0742113_578_814 | 72 |
| 171 | 3300037471 | Ga0395905_1059510 | Ga0395905_1059510_77_295 | 72 |
| 172 | 3300038443 | Ga0395901_0000274 | Ga0395901_0000274_21164_21400 | 72 |
| 173 | 3300038443 | Ga0395901_0000274 | Ga0395901_0000274_21456_21692 | 72 |
| 174 | 3300038443 | Ga0395901_0145510 | Ga0395901_0145510_2056_2295 | 72 |
| 175 | 3300038443 | Ga0395901_2025209 | Ga0395901_2025209_187_405 | 72 |
| 176 | 3300046515 | Ga0495620_0149241 | Ga0495620_0149241_456_674 | 72 |
| 177 | 3300046522 | Ga0495643_0512622 | Ga0495643_0512622_179_397 | 72 |
| 178 | 3300059477 | Ga0587084_006980 | Ga0587084_006980_826_1044 | 72 |
| 179 | 3300059477 | Ga0587084_118507 | Ga0587084_118507_169_405 | 72 |
| 180 | 3300059478 | Ga0587093_006039 | Ga0587093_006039_742_960 | 72 |
| 181 | 3300059478 | Ga0587093_071602 | Ga0587093_071602_67_303 | 72 |
| 182 | 3300059490 | Ga0587066_008939 | Ga0587066_008939_139_357 | 72 |
| 183 | 3300059490 | Ga0587066_008939 | Ga0587066_008939_418_636 | 72 |
| 184 | 3300059490 | Ga0587066_129342 | Ga0587066_129342_34_273 | 72 |
| 185 | 3300059490 | Ga0587066_157053 | Ga0587066_157053_14_232 | 72 |
| 186 | 3300059490 | Ga0587066_187908 | Ga0587066_187908_252_470 | 72 |
| 187 | 3300059491 | Ga0587070_019330 | Ga0587070_019330_566_784 | 72 |
| 188 | 3300059492 | Ga0587073_0119970 | Ga0587073_0119970_357_596 | 72 |
| 189 | 3300059492 | Ga0587073_0119970 | Ga0587073_0119970_67_303 | 72 |
| 190 | 3300059493 | Ga0587077_120813 | Ga0587077_120813_369_605 | 72 |
| 191 | 3300059493 | Ga0587077_120813 | Ga0587077_120813_76_315 | 72 |
| 192 | 3300059493 | Ga0587077_179227 | Ga0587077_179227_312_548 | 72 |
| 193 | 3300059493 | Ga0587077_218737 | Ga0587077_218737_12_230 | 72 |
| 194 | 3300059503 | Ga0587080_040539 | Ga0587080_040539_263_481 | 72 |
| 195 | 3300059503 | Ga0587080_040539 | Ga0587080_040539_542_760 | 72 |
| 196 | 3300059503 | Ga0587080_046691 | Ga0587080_046691_348_584 | 72 |
| 197 | 3300059504 | Ga0587082_158215 | Ga0587082_158215_67_303 | 72 |
| 198 | 3300059505 | Ga0587083_0013856 | Ga0587083_0013856_543_761 | 72 |
| 199 | 3300059505 | Ga0587083_0013856 | Ga0587083_0013856_822_1040 | 72 |
| 200 | 3300059505 | Ga0587083_0251442 | Ga0587083_0251442_225_461 | 72 |
| 201 | 3300059506 | Ga0587085_006971 | Ga0587085_006971_326_544 | 72 |
| 202 | 3300059506 | Ga0587085_113924 | Ga0587085_113924_284_520 | 72 |
| 203 | 3300059507 | Ga0587086_037491 | Ga0587086_037491_174_392 | 72 |
| 204 | 3300059507 | Ga0587086_115705 | Ga0587086_115705_225_461 | 72 |
| 205 | 3300059508 | Ga0587088_010269 | Ga0587088_010269_345_563 | 72 |
| 206 | 3300059510 | Ga0587090_089219 | Ga0587090_089219_327_563 | 72 |
| 207 | 3300059510 | Ga0587090_089219 | Ga0587090_089219_34_273 | 72 |
| 208 | 3300059511 | Ga0587091_055270 | Ga0587091_055270_262_480 | 72 |
| 209 | 3300059511 | Ga0587091_055270 | Ga0587091_055270_543_761 | 72 |
| 210 | 3300059511 | Ga0587091_210333 | Ga0587091_210333_225_461 | 72 |
| 211 | 3300059512 | Ga0587092_014756 | Ga0587092_014756_345_563 | 72 |
| 212 | 3300059512 | Ga0587092_044603 | Ga0587092_044603_307_525 | 72 |
| 213 | 3300059513 | Ga0587094_006349 | Ga0587094_006349_827_1045 | 72 |
| 214 | 3300059513 | Ga0587094_079644 | Ga0587094_079644_67_303 | 72 |
| 215 | 3300059514 | Ga0587095_006668 | Ga0587095_006668_328_546 | 72 |
| 216 | 3300059608 | Ga0587129_030583 | Ga0587129_030583_232_450 | 72 |
| 217 | 3300059624 | Ga0587109_006797 | Ga0587109_006797_378_596 | 72 |
| 218 | 3300059624 | Ga0587109_006797 | Ga0587109_006797_657_875 | 72 |
| 219 | 3300059624 | Ga0587109_141201 | Ga0587109_141201_134_370 | 72 |
| 220 | 3300059627 | Ga0587117_115458 | Ga0587117_115458_293_511 | 72 |
| 221 | 3300059629 | Ga0587127_021176 | Ga0587127_021176_234_452 | 72 |
| 222 | 3300059630 | Ga0587128_089827 | Ga0587128_089827_358_597 | 72 |
| 223 | 3300059630 | Ga0587128_089827 | Ga0587128_089827_68_304 | 72 |
| 224 | 3300059639 | Ga0587062_016809 | Ga0587062_016809_316_555 | 72 |
| 225 | 3300059639 | Ga0587062_101542 | Ga0587062_101542_48_266 | 72 |
| 226 | 3300059640 | Ga0587067_107885 | Ga0587067_107885_88_306 | 72 |
| 227 | 3300059640 | Ga0587067_160287 | Ga0587067_160287_288_506 | 72 |
| 228 | 3300059641 | Ga0587068_024576 | Ga0587068_024576_357_575 | 72 |
| 229 | 3300059641 | Ga0587068_024576 | Ga0587068_024576_78_296 | 72 |
| 230 | 3300059641 | Ga0587068_138534 | Ga0587068_138534_133_351 | 72 |
| 231 | 3300059642 | Ga0587069_074450 | Ga0587069_074450_88_306 | 72 |
| 232 | 3300059642 | Ga0587069_152665 | Ga0587069_152665_281_499 | 72 |
| 233 | 3300059643 | Ga0587072_013059 | Ga0587072_013059_827_1045 | 72 |
| 234 | 3300059643 | Ga0587072_039282 | Ga0587072_039282_348_566 | 72 |
| 235 | 3300059643 | Ga0587072_039282 | Ga0587072_039282_67_285 | 72 |
| 236 | 3300059643 | Ga0587072_199915 | Ga0587072_199915_225_461 | 72 |
| 237 | 3300059644 | Ga0587075_096787 | Ga0587075_096787_67_303 | 72 |
| 238 | 3300059645 | Ga0587076_132013 | Ga0587076_132013_67_303 | 72 |
| 239 | 3300059645 | Ga0587076_134259 | Ga0587076_134259_95_313 | 72 |
| 240 | 3300059645 | Ga0587076_148533 | Ga0587076_148533_12_230 | 72 |
| 241 | 3300059645 | Ga0587076_164549 | Ga0587076_164549_264_482 | 72 |
| 242 | 3300059646 | Ga0587078_067925 | Ga0587078_067925_267_485 | 72 |
| 243 | 3300059647 | Ga0587079_027814 | Ga0587079_027814_345_563 | 72 |
| 244 | 3300059650 | Ga0587104_022234 | Ga0587104_022234_253_471 | 72 |
| 245 | 3300059652 | Ga0587107_104797 | Ga0587107_104797_293_511 | 72 |
| 246 | 3300060344 | Ga0587071_065177 | Ga0587071_065177_507_725 | 72 |
| 247 | 3300060344 | Ga0587071_133033 | Ga0587071_133033_17_256 | 72 |
| 248 | 3300060344 | Ga0587071_133033 | Ga0587071_133033_310_546 | 72 |
| 249 | 3300060346 | Ga0587111_0191199 | Ga0587111_0191199_19_237 | 72 |
| 250 | 3300060346 | Ga0587111_0191199 | Ga0587111_0191199_300_518 | 72 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar