F361532

General Info

Members Datasets Scaffolds Average Seq Length
250 151 134 72

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_11659567|Ga0105241_116595671
Length 79
Sequence MSKLIEMARQFHDDENGAAMVEYSILIGIIAGAAILAIVAIGGWVSGRFTGLCGILDGKGLTATAGTSGTCKATTGTGT

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
3 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
4 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
5 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
6 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
7 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
8 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
9 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
10 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
11 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
12 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
13 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
14 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
15 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
16 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
17 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
18 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
19 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
20 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
21 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
22 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
23 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
24 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
25 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
26 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
27 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
28 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
29 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
30 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
31 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
32 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
33 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
34 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
35 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
36 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
37 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
38 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
39 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
40 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
41 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
42 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
43 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
44 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
45 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
46 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
47 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
48 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
49 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
50 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
51 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
52 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
53 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
54 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
55 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
56 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
57 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
58 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
59 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
60 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
61 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
62 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
63 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
64 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
65 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
66 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
67 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
68 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
69 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
100 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
101 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
102 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
103 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
104 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
105 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
106 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
107 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
108 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
109 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
110 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
111 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
147 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
148 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
149 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
150 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
151 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 32.4
Metatranscriptomes 31.2
Isolates 36.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.2
Nodule 33.6
Rhizoplane 1.2
Rhizosphere 47.2
Stem 0
Stem Tuber 0
Unclassified 4.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001580 3300002705 Bacteria 9377
2 JGI25157J39369_1000744 3300002741 Bacteria 17229
3 Ga0058859_11726275 3300004798 Bacteria 502
4 Ga0070682_101947934 3300005337 Bacteria 516
5 Ga0068855_100972465 3300005563 Bacteria 893
6 Ga0075365_10004901 3300006038 Bacteria 7154
7 Ga0075364_10170830 3300006051 Bacteria 1470
8 Ga0075364_10463890 3300006051 Bacteria 865
9 Ga0075364_11099069 3300006051 Bacteria 540
10 Ga0075362_10021728 3300006177 Bacteria 2698
11 Ga0075362_10173906 3300006177 Bacteria 1041
12 Ga0075369_10013740 3300006186 Bacteria 3221
13 Ga0075369_10205062 3300006186 Bacteria 910
14 Ga0075366_10598116 3300006195 Bacteria 684
15 Ga0075370_10389757 3300006353 Bacteria 835
16 Ga0075370_10930744 3300006353 Bacteria 532
17 Ga0105240_10324481 3300009093 Bacteria 1754
18 Ga0105240_10327206 3300009093 Bacteria 1745
19 Ga0105241_11659567 3300009174 Bacteria 620
20 Ga0105237_10367353 3300009545 Bacteria 1444
21 Ga0105239_10155931 3300010375 Bacteria 2550
22 Ga0105239_10514964 3300010375 Bacteria 1361
23 Ga0105239_13317479 3300010375 Bacteria 524
24 Ga0206352_10562369 3300020078 Bacteria 594
25 Ga0206353_10319156 3300020082 Bacteria 596
26 Ga0209026_1000116 3300025250 Bacteria 133228
27 Ga0209759_1000153 3300025256 Bacteria 119494
28 Ga0207695_10332178 3300025913 Bacteria 1408
29 Ga0207695_11104125 3300025913 Bacteria 673
30 Ga0395899_0000295 3300037312 Bacteria 64132
31 Ga0395900_0003677 3300037418 Bacteria 16485
32 Ga0395900_0972968 3300037418 Bacteria 769
33 Ga0395900_1007196 3300037418 Unclassified 753
34 Ga0395898_0000634 3300037466 Bacteria 64132
35 Ga0395898_1237502 3300037466 Bacteria 677
36 Ga0395905_0000367 3300037471 Bacteria 64132
37 Ga0395905_0742113 3300037471 Bacteria 884
38 Ga0395905_1059510 3300037471 Bacteria 714
39 Ga0395901_0000274 3300038443 Bacteria 64132
40 Ga0395901_0145510 3300038443 Bacteria 2491
41 Ga0395901_2025209 3300038443 Bacteria 522
42 Ga0495638_0156477 3300046460 Bacteria 1318
43 Ga0495638_0223890 3300046460 Bacteria 1050
44 Ga0495620_0048847 3300046515 Bacteria 1814
45 Ga0495620_0149241 3300046515 Bacteria 912
46 Ga0495643_0512622 3300046522 Unclassified 515
47 Ga0495625_0190979 3300046660 Bacteria 1357
48 Ga0495686_0272275 3300047472 Bacteria 944
49 Ga0496102_0087425 3300048905 Bacteria 2880
50 Ga0496111_1092814 3300048914 Bacteria 569
51 Ga0496115_0669348 3300048918 Unclassified 819
52 nmdc:mga03683_167984_c1 3300050489 Bacteria 996
53 nmdc:mga03683_34508_c1 3300050489 Bacteria 2047
54 nmdc:mga03683_471492_c1 3300050489 Bacteria 606
55 nmdc:mga00v17_217647_c1 3300050491 Bacteria 1236
56 nmdc:mga00v17_254394_c1 3300050491 Bacteria 1139
57 nmdc:mga00v17_86578_c1 3300050491 Bacteria 1963
58 nmdc:mga00v17_911114_c1 3300050491 Bacteria 556
59 nmdc:mga0yw44_3708_c1 3300050492 Bacteria 6839
60 nmdc:mga0yw44_67870_c1 3300050492 Bacteria 2205
61 nmdc:mga0k408_358463_c1 3300050493 Bacteria 869
62 nmdc:mga0k408_92307_c1 3300050493 Bacteria 1779
63 nmdc:mga06z11_70189_c1 3300050494 Bacteria 1851
64 nmdc:mga07m45_49373_c1 3300050496 Bacteria 2368
65 nmdc:mga0sz30_10481_c1 3300050516 Bacteria 3556
66 nmdc:mga0sz30_114372_c1 3300050516 Bacteria 887
67 nmdc:mga0sz30_494349_c1 3300050516 Bacteria 550
68 Ga0500658_0101560 3300053134 Bacteria 1256
69 Ga0500604_0049988 3300053151 Bacteria 1287
70 Ga0500620_067109 3300053155 Bacteria 1229
71 Ga0500627_0007883 3300053158 Bacteria 3744
72 Ga0500627_0013813 3300053158 Bacteria 3076
73 Ga0500611_132666 3300053727 Bacteria 672
74 Ga0587084_006980 3300059477 Bacteria 1389
75 Ga0587084_114008 3300059477 Bacteria 562
76 Ga0587084_118507 3300059477 Bacteria 554
77 Ga0587093_006039 3300059478 Bacteria 1303
78 Ga0587093_071602 3300059478 Bacteria 583
79 Ga0587066_008939 3300059490 Bacteria 1405
80 Ga0587066_129342 3300059490 Bacteria 605
81 Ga0587066_157053 3300059490 Bacteria 568
82 Ga0587066_187908 3300059490 Bacteria 536
83 Ga0587070_019330 3300059491 Bacteria 1127
84 Ga0587073_0119970 3300059492 Bacteria 709
85 Ga0587077_120813 3300059493 Bacteria 653
86 Ga0587077_179227 3300059493 Bacteria 573
87 Ga0587077_218737 3300059493 Bacteria 536
88 Ga0587080_040539 3300059503 Bacteria 847
89 Ga0587080_046691 3300059503 Bacteria 806
90 Ga0587082_158215 3300059504 Bacteria 541
91 Ga0587083_0013856 3300059505 Bacteria 1379
92 Ga0587083_0251442 3300059505 Bacteria 527
93 Ga0587085_006971 3300059506 Bacteria 1394
94 Ga0587085_113924 3300059506 Bacteria 586
95 Ga0587086_037491 3300059507 Bacteria 737
96 Ga0587086_115705 3300059507 Bacteria 508
97 Ga0587088_010269 3300059508 Bacteria 1367
98 Ga0587090_089219 3300059510 Bacteria 629
99 Ga0587091_055270 3300059511 Bacteria 827
100 Ga0587091_210333 3300059511 Bacteria 527
101 Ga0587092_014756 3300059512 Bacteria 1135
102 Ga0587092_044603 3300059512 Bacteria 783
103 Ga0587094_006349 3300059513 Bacteria 1414
104 Ga0587094_079644 3300059513 Bacteria 604
105 Ga0587095_006668 3300059514 Bacteria 901
106 Ga0587129_030583 3300059608 Bacteria 516
107 Ga0587109_006797 3300059624 Bacteria 1706
108 Ga0587109_141201 3300059624 Bacteria 588
109 Ga0587117_115458 3300059627 Bacteria 526
110 Ga0587127_021176 3300059629 Bacteria 577
111 Ga0587128_089827 3300059630 Bacteria 628
112 Ga0587062_016809 3300059639 Bacteria 994
113 Ga0587062_101542 3300059639 Bacteria 561
114 Ga0587067_107885 3300059640 Bacteria 653
115 Ga0587067_160287 3300059640 Bacteria 572
116 Ga0587068_024576 3300059641 Bacteria 1010
117 Ga0587068_138534 3300059641 Bacteria 542
118 Ga0587069_074450 3300059642 Bacteria 651
119 Ga0587069_152665 3300059642 Bacteria 514
120 Ga0587072_013059 3300059643 Bacteria 1380
121 Ga0587072_039282 3300059643 Bacteria 914
122 Ga0587072_199915 3300059643 Bacteria 508
123 Ga0587075_096787 3300059644 Bacteria 584
124 Ga0587076_132013 3300059645 Bacteria 589
125 Ga0587076_134259 3300059645 Bacteria 586
126 Ga0587076_148533 3300059645 Bacteria 567
127 Ga0587076_164549 3300059645 Bacteria 548
128 Ga0587078_067925 3300059646 Bacteria 552
129 Ga0587079_027814 3300059647 Bacteria 1066
130 Ga0587104_022234 3300059650 Bacteria 534
131 Ga0587107_104797 3300059652 Bacteria 564
132 Ga0587071_065177 3300060344 Bacteria 782
133 Ga0587071_133033 3300060344 Bacteria 605
134 Ga0587111_0191199 3300060346 Bacteria 575

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2756170246 2756676307 60
2 iso_pu_bacteria 2958100919 2958106885 62
3 iso_pu_bacteria 2958172287 2958172974 62
4 iso_pu_bacteria 2979710463 2979712847 62
5 3300037418 Ga0395900_1007196 Ga0395900_1007196_243_494 63
6 3300006038 Ga0075365_10004901 Ga0075365_1000490110 64
7 3300006051 Ga0075364_10170830 Ga0075364_101708305 64
8 3300006051 Ga0075364_10463890 Ga0075364_104638901 64
9 3300006177 Ga0075362_10021728 Ga0075362_100217281 64
10 3300006177 Ga0075362_10173906 Ga0075362_101739062 64
11 3300006186 Ga0075369_10013740 Ga0075369_100137405 64
12 3300048905 Ga0496102_0087425 Ga0496102_0087425_1643_1858 64
13 3300050489 nmdc:mga03683_167984_c1 nmdc:mga03683_167984_c1_584_793 64
14 3300050489 nmdc:mga03683_34508_c1 nmdc:mga03683_34508_c1_52_261 64
15 3300050491 nmdc:mga00v17_254394_c1 nmdc:mga00v17_254394_c1_176_385 64
16 3300050491 nmdc:mga00v17_86578_c1 nmdc:mga00v17_86578_c1_1003_1212 64
17 3300050492 nmdc:mga0yw44_3708_c1 nmdc:mga0yw44_3708_c1_5658_5867 64
18 3300050493 nmdc:mga0k408_92307_c1 nmdc:mga0k408_92307_c1_1068_1277 64
19 3300050494 nmdc:mga06z11_70189_c1 nmdc:mga06z11_70189_c1_480_689 64
20 3300050516 nmdc:mga0sz30_10481_c1 nmdc:mga0sz30_10481_c1_1062_1271 64
21 3300050516 nmdc:mga0sz30_494349_c1 nmdc:mga0sz30_494349_c1_174_383 64
22 3300059645 Ga0587076_132013 Ga0587076_132013_357_572 64
23 iso_pu_bacteria 2906378014 2906380838 64
24 3300037466 Ga0395898_1237502 Ga0395898_1237502_139_378 65
25 iso_pu_bacteria 2937822353 2937828840 65
26 iso_pu_bacteria 2847686936 2847691772 66
27 iso_pu_bacteria 2871444079 2871446818 66
28 iso_pu_bacteria 2874102143 2874102520 66
29 iso_pu_bacteria 2874168670 2874171163 66
30 iso_pu_bacteria 2922158528 2922160751 66
31 iso_pu_bacteria 2924726620 2924726919 66
32 iso_pu_bacteria 2958115193 2958121408 66
33 iso_pu_bacteria 2968097103 2968101199 66
34 iso_pu_bacteria 2979779861 2979785811 66
35 iso_pu_bacteria 2996341866 2996347999 66
36 iso_pu_bacteria 8004703790 8004713141 66
37 3300006051 Ga0075364_11099069 Ga0075364_110990692 67
38 3300006186 Ga0075369_10205062 Ga0075369_102050622 67
39 3300006195 Ga0075366_10598116 Ga0075366_105981162 67
40 3300050491 nmdc:mga00v17_217647_c1 nmdc:mga00v17_217647_c1_138_356 67
41 3300050491 nmdc:mga00v17_911114_c1 nmdc:mga00v17_911114_c1_180_398 67
42 3300050492 nmdc:mga0yw44_67870_c1 nmdc:mga0yw44_67870_c1_692_910 67
43 3300050493 nmdc:mga0k408_358463_c1 nmdc:mga0k408_358463_c1_496_714 67
44 3300050516 nmdc:mga0sz30_114372_c1 nmdc:mga0sz30_114372_c1_62_280 67
45 iso_pu_bacteria 2881853255 2881855723 67
46 iso_pu_bacteria 2508501127 2509140799 68
47 iso_pu_bacteria 2513237305 2514417870 68
48 iso_pu_bacteria 2513237305 2514417871 68
49 iso_pu_bacteria 2597489875 2597811418 68
50 iso_pu_bacteria 2597489875 2597813479 68
51 iso_pu_bacteria 2721755686 2723578290 68
52 iso_pu_bacteria 2721755686 2723578291 68
53 iso_pu_bacteria 2847670302 2847672664 68
54 iso_pu_bacteria 2856342000 2856347331 68
55 iso_pu_bacteria 2856342000 2856348055 68
56 iso_pu_bacteria 2856364286 2856365886 68
57 iso_pu_bacteria 2869285874 2869286773 68
58 iso_pu_bacteria 2871429161 2871434036 68
59 iso_pu_bacteria 2871488783 2871490125 68
60 iso_pu_bacteria 2874146452 2874147694 68
61 iso_pu_bacteria 2874155637 2874156613 68
62 iso_pu_bacteria 2876377896 2876385378 68
63 iso_pu_bacteria 2876377896 2876385379 68
64 iso_pu_bacteria 2876413966 2876414814 68
65 iso_pu_bacteria 2878035449 2878042033 68
66 iso_pu_bacteria 2878745973 2878746746 68
67 iso_pu_bacteria 2878753008 2878753189 68
68 iso_pu_bacteria 2881845957 2881852424 68
69 iso_pu_bacteria 2882912400 2882918937 68
70 iso_pu_bacteria 2885305155 2885308774 68
71 iso_pu_bacteria 2885312484 2885318640 68
72 iso_pu_bacteria 2885318864 2885321625 68
73 iso_pu_bacteria 2885318864 2885321626 68
74 iso_pu_bacteria 2888343758 2888345219 68
75 iso_pu_bacteria 2888343758 2888347074 68
76 iso_pu_bacteria 2889010040 2889013833 68
77 iso_pu_bacteria 2889010040 2889013834 68
78 iso_pu_bacteria 2889016732 2889021472 68
79 iso_pu_bacteria 2889016732 2889021473 68
80 iso_pu_bacteria 2903492973 2903498046 68
81 iso_pu_bacteria 2903492973 2903498189 68
82 iso_pu_bacteria 2906308376 2906309127 68
83 iso_pu_bacteria 2906321335 2906326733 68
84 iso_pu_bacteria 2906414383 2906415106 68
85 iso_pu_bacteria 2924754689 2924759657 68
86 iso_pu_bacteria 2924754689 2924761170 68
87 iso_pu_bacteria 2937813078 2937814015 68
88 iso_pu_bacteria 2937822353 2937829019 68
89 iso_pu_bacteria 2937822353 2937829020 68
90 iso_pu_bacteria 2938014810 2938018054 68
91 iso_pu_bacteria 2938014810 2938018055 68
92 iso_pu_bacteria 2958064165 2958068342 68
93 iso_pu_bacteria 2958130278 2958131176 68
94 iso_pu_bacteria 2958179912 2958180575 68
95 iso_pu_bacteria 2961077736 2961078410 68
96 iso_pu_bacteria 2961127735 2961129996 68
97 iso_pu_bacteria 2965119406 2965124200 68
98 iso_pu_bacteria 2965119406 2965124201 68
99 iso_pu_bacteria 2967996073 2968002861 68
100 iso_pu_bacteria 2968003550 2968005258 68
101 iso_pu_bacteria 2970524798 2970526925 68
102 iso_pu_bacteria 2970524798 2970530593 68
103 iso_pu_bacteria 2970540015 2970543856 68
104 iso_pu_bacteria 2970540015 2970546655 68
105 iso_pu_bacteria 2977821940 2977822120 68
106 iso_pu_bacteria 2977828996 2977829516 68
107 iso_pu_bacteria 2977843712 2977845282 68
108 iso_pu_bacteria 2977858184 2977858670 68
109 iso_pu_bacteria 2987652177 2987658512 68
110 iso_pu_bacteria 2987652177 2987658513 68
111 iso_pu_bacteria 3000135777 3000142305 68
112 iso_pu_bacteria 3000135777 3000142306 68
113 iso_pu_bacteria 8004374579 8004374760 68
114 iso_pu_bacteria 8004387939 8004388056 68
115 iso_pu_bacteria 8004395343 8004396573 68
116 iso_pu_bacteria 8004395343 8004403398 68
117 iso_pu_bacteria 8004445564 8004448339 68
118 iso_pu_bacteria 8004714634 8004715384 68
119 3300005337 Ga0070682_101947934 Ga0070682_1019479341 69
120 3300005563 Ga0068855_100972465 Ga0068855_1009724652 69
121 3300006353 Ga0075370_10389757 Ga0075370_103897572 69
122 3300046460 Ga0495638_0223890 Ga0495638_0223890_760_969 69
123 3300046515 Ga0495620_0048847 Ga0495620_0048847_50_259 69
124 3300046660 Ga0495625_0190979 Ga0495625_0190979_680_889 69
125 3300047472 Ga0495686_0272275 Ga0495686_0272275_448_657 69
126 3300050496 nmdc:mga07m45_49373_c1 nmdc:mga07m45_49373_c1_1442_1651 69
127 3300053134 Ga0500658_0101560 Ga0500658_0101560_362_571 69
128 3300053151 Ga0500604_0049988 Ga0500604_0049988_150_359 69
129 3300053155 Ga0500620_067109 Ga0500620_067109_377_586 69
130 3300053158 Ga0500627_0007883 Ga0500627_0007883_1533_1742 69
131 3300053158 Ga0500627_0013813 Ga0500627_0013813_1729_1938 69
132 3300053727 Ga0500611_132666 Ga0500611_132666_377_586 69
133 3300006353 Ga0075370_10930744 Ga0075370_109307441 70
134 3300009093 Ga0105240_10324481 Ga0105240_103244811 70
135 3300010375 Ga0105239_10155931 Ga0105239_101559313 70
136 3300025913 Ga0207695_11104125 Ga0207695_111041252 70
137 3300046460 Ga0495638_0156477 Ga0495638_0156477_113_325 70
138 3300048918 Ga0496115_0669348 Ga0496115_0669348_480_692 70
139 3300050489 nmdc:mga03683_471492_c1 nmdc:mga03683_471492_c1_103_315 70
140 3300009093 Ga0105240_10324481 Ga0105240_103244812 71
141 3300010375 Ga0105239_10155931 Ga0105239_101559314 71
142 3300025913 Ga0207695_11104125 Ga0207695_111041251 71
143 3300048914 Ga0496111_1092814 Ga0496111_1092814_154_369 71
144 3300059477 Ga0587084_114008 Ga0587084_114008_48_281 71
145 3300002705 JGI25156J39149_1001580 JGI25156J39149_10015802 72
146 3300002741 JGI25157J39369_1000744 JGI25157J39369_10007444 72
147 3300004798 Ga0058859_11726275 Ga0058859_117262752 72
148 3300009093 Ga0105240_10327206 Ga0105240_103272062 72
149 3300009174 Ga0105241_11659567 Ga0105241_116595671 72
150 3300009545 Ga0105237_10367353 Ga0105237_103673532 72
151 3300010375 Ga0105239_10514964 Ga0105239_105149642 72
152 3300010375 Ga0105239_10514964 Ga0105239_105149643 72
153 3300010375 Ga0105239_13317479 Ga0105239_133174792 72
154 3300020078 Ga0206352_10562369 Ga0206352_105623691 72
155 3300020082 Ga0206353_10319156 Ga0206353_103191562 72
156 3300025250 Ga0209026_1000116 Ga0209026_100011629 72
157 3300025256 Ga0209759_1000153 Ga0209759_100015394 72
158 3300025913 Ga0207695_10332178 Ga0207695_103321782 72
159 3300037312 Ga0395899_0000295 Ga0395899_0000295_57997_58233 72
160 3300037312 Ga0395899_0000295 Ga0395899_0000295_58289_58525 72
161 3300037418 Ga0395900_0003677 Ga0395900_0003677_14569_14805 72
162 3300037418 Ga0395900_0003677 Ga0395900_0003677_14861_15097 72
163 3300037418 Ga0395900_0972968 Ga0395900_0972968_124_363 72
164 3300037418 Ga0395900_0972968 Ga0395900_0972968_417_653 72
165 3300037466 Ga0395898_0000634 Ga0395898_0000634_3478_3714 72
166 3300037466 Ga0395898_0000634 Ga0395898_0000634_3770_4006 72
167 3300037471 Ga0395905_0000367 Ga0395905_0000367_49445_49681 72
168 3300037471 Ga0395905_0000367 Ga0395905_0000367_49737_49973 72
169 3300037471 Ga0395905_0742113 Ga0395905_0742113_285_524 72
170 3300037471 Ga0395905_0742113 Ga0395905_0742113_578_814 72
171 3300037471 Ga0395905_1059510 Ga0395905_1059510_77_295 72
172 3300038443 Ga0395901_0000274 Ga0395901_0000274_21164_21400 72
173 3300038443 Ga0395901_0000274 Ga0395901_0000274_21456_21692 72
174 3300038443 Ga0395901_0145510 Ga0395901_0145510_2056_2295 72
175 3300038443 Ga0395901_2025209 Ga0395901_2025209_187_405 72
176 3300046515 Ga0495620_0149241 Ga0495620_0149241_456_674 72
177 3300046522 Ga0495643_0512622 Ga0495643_0512622_179_397 72
178 3300059477 Ga0587084_006980 Ga0587084_006980_826_1044 72
179 3300059477 Ga0587084_118507 Ga0587084_118507_169_405 72
180 3300059478 Ga0587093_006039 Ga0587093_006039_742_960 72
181 3300059478 Ga0587093_071602 Ga0587093_071602_67_303 72
182 3300059490 Ga0587066_008939 Ga0587066_008939_139_357 72
183 3300059490 Ga0587066_008939 Ga0587066_008939_418_636 72
184 3300059490 Ga0587066_129342 Ga0587066_129342_34_273 72
185 3300059490 Ga0587066_157053 Ga0587066_157053_14_232 72
186 3300059490 Ga0587066_187908 Ga0587066_187908_252_470 72
187 3300059491 Ga0587070_019330 Ga0587070_019330_566_784 72
188 3300059492 Ga0587073_0119970 Ga0587073_0119970_357_596 72
189 3300059492 Ga0587073_0119970 Ga0587073_0119970_67_303 72
190 3300059493 Ga0587077_120813 Ga0587077_120813_369_605 72
191 3300059493 Ga0587077_120813 Ga0587077_120813_76_315 72
192 3300059493 Ga0587077_179227 Ga0587077_179227_312_548 72
193 3300059493 Ga0587077_218737 Ga0587077_218737_12_230 72
194 3300059503 Ga0587080_040539 Ga0587080_040539_263_481 72
195 3300059503 Ga0587080_040539 Ga0587080_040539_542_760 72
196 3300059503 Ga0587080_046691 Ga0587080_046691_348_584 72
197 3300059504 Ga0587082_158215 Ga0587082_158215_67_303 72
198 3300059505 Ga0587083_0013856 Ga0587083_0013856_543_761 72
199 3300059505 Ga0587083_0013856 Ga0587083_0013856_822_1040 72
200 3300059505 Ga0587083_0251442 Ga0587083_0251442_225_461 72
201 3300059506 Ga0587085_006971 Ga0587085_006971_326_544 72
202 3300059506 Ga0587085_113924 Ga0587085_113924_284_520 72
203 3300059507 Ga0587086_037491 Ga0587086_037491_174_392 72
204 3300059507 Ga0587086_115705 Ga0587086_115705_225_461 72
205 3300059508 Ga0587088_010269 Ga0587088_010269_345_563 72
206 3300059510 Ga0587090_089219 Ga0587090_089219_327_563 72
207 3300059510 Ga0587090_089219 Ga0587090_089219_34_273 72
208 3300059511 Ga0587091_055270 Ga0587091_055270_262_480 72
209 3300059511 Ga0587091_055270 Ga0587091_055270_543_761 72
210 3300059511 Ga0587091_210333 Ga0587091_210333_225_461 72
211 3300059512 Ga0587092_014756 Ga0587092_014756_345_563 72
212 3300059512 Ga0587092_044603 Ga0587092_044603_307_525 72
213 3300059513 Ga0587094_006349 Ga0587094_006349_827_1045 72
214 3300059513 Ga0587094_079644 Ga0587094_079644_67_303 72
215 3300059514 Ga0587095_006668 Ga0587095_006668_328_546 72
216 3300059608 Ga0587129_030583 Ga0587129_030583_232_450 72
217 3300059624 Ga0587109_006797 Ga0587109_006797_378_596 72
218 3300059624 Ga0587109_006797 Ga0587109_006797_657_875 72
219 3300059624 Ga0587109_141201 Ga0587109_141201_134_370 72
220 3300059627 Ga0587117_115458 Ga0587117_115458_293_511 72
221 3300059629 Ga0587127_021176 Ga0587127_021176_234_452 72
222 3300059630 Ga0587128_089827 Ga0587128_089827_358_597 72
223 3300059630 Ga0587128_089827 Ga0587128_089827_68_304 72
224 3300059639 Ga0587062_016809 Ga0587062_016809_316_555 72
225 3300059639 Ga0587062_101542 Ga0587062_101542_48_266 72
226 3300059640 Ga0587067_107885 Ga0587067_107885_88_306 72
227 3300059640 Ga0587067_160287 Ga0587067_160287_288_506 72
228 3300059641 Ga0587068_024576 Ga0587068_024576_357_575 72
229 3300059641 Ga0587068_024576 Ga0587068_024576_78_296 72
230 3300059641 Ga0587068_138534 Ga0587068_138534_133_351 72
231 3300059642 Ga0587069_074450 Ga0587069_074450_88_306 72
232 3300059642 Ga0587069_152665 Ga0587069_152665_281_499 72
233 3300059643 Ga0587072_013059 Ga0587072_013059_827_1045 72
234 3300059643 Ga0587072_039282 Ga0587072_039282_348_566 72
235 3300059643 Ga0587072_039282 Ga0587072_039282_67_285 72
236 3300059643 Ga0587072_199915 Ga0587072_199915_225_461 72
237 3300059644 Ga0587075_096787 Ga0587075_096787_67_303 72
238 3300059645 Ga0587076_132013 Ga0587076_132013_67_303 72
239 3300059645 Ga0587076_134259 Ga0587076_134259_95_313 72
240 3300059645 Ga0587076_148533 Ga0587076_148533_12_230 72
241 3300059645 Ga0587076_164549 Ga0587076_164549_264_482 72
242 3300059646 Ga0587078_067925 Ga0587078_067925_267_485 72
243 3300059647 Ga0587079_027814 Ga0587079_027814_345_563 72
244 3300059650 Ga0587104_022234 Ga0587104_022234_253_471 72
245 3300059652 Ga0587107_104797 Ga0587107_104797_293_511 72
246 3300060344 Ga0587071_065177 Ga0587071_065177_507_725 72
247 3300060344 Ga0587071_133033 Ga0587071_133033_17_256 72
248 3300060344 Ga0587071_133033 Ga0587071_133033_310_546 72
249 3300060346 Ga0587111_0191199 Ga0587111_0191199_19_237 72
250 3300060346 Ga0587111_0191199 Ga0587111_0191199_300_518 72

Feature Viewer

pLDDT pTM Quality
80.04 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map