F361517

General Info

Members Datasets Scaffolds Average Seq Length
250 191 500 435

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10030023|Ga0105245_100300233
Length 487
Sequence MSAVEPVHPPTPPRNLGASASAIENECASIGASALRKASVRLIPLIAIAYGVAYTDRVNISFAALQMNRDLHFSASAYGLGAGLFFLSYAACEIPSNLLLYRFGARRWIARIMFTWGFLAMGMMLVKTPLEFYVVRFLLGMAEAGFFPGVVFYLSQWFPANVRARTVSRFYVALPLSSVFMGGIAGALLNLQGRMGLAGWQWLFLVEGLPAVLLSIVFLLYLPNTPADVKWLTAEERAWLVNQLRADNQSIGESXXXSARPPILQSSEQSGRSSNANPGGATTGEHHAGGALRATLNPRVWQLGIFLLCLYIGFYAFSFSAPVLIQQATGLSNTNVGFLIALMGLLGALGLVLNGQHSDRAGERFLHIAVPSLLIGLAFVVGGLTVAPVFALPAYAIIFVGFNATAGPSWAIASSFLTGKSSAAGIATANTIAIVGGFLGPYWMGRAKDFTGNYQTGLLTLAIPAFAGTAIALFMRRRAAGSHGRRG

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
180 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
181 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
182 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
183 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
184 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
185 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
186 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
187 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
188 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
189 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
190 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
191 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.2
Metatranscriptomes 0
Isolates 4.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 3.2
Rhizoplane 2.8
Rhizosphere 86
Stem 0
Stem Tuber 0
Unclassified 6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10030023 3300009098 Bacteria 4806
2 Ga0065165_1002061 3300005262 Bacteria 18594
3 Ga0070658_10009768 3300005327 Bacteria 7707
4 Ga0070658_10076375 3300005327 Unclassified 2747
5 Ga0070683_100019511 3300005329 Bacteria 6023
6 Ga0070683_100058058 3300005329 Bacteria 3596
7 Ga0070683_100085582 3300005329 Bacteria 2955
8 Ga0070683_100243985 3300005329 Bacteria 1709
9 Ga0070670_100090112 3300005331 Bacteria 2636
10 Ga0070680_100008793 3300005336 Bacteria 7747
11 Ga0070682_100111678 3300005337 Bacteria 1822
12 Ga0068868_100220231 3300005338 Bacteria 1589
13 Ga0070660_100064378 3300005339 Unclassified 2852
14 Ga0070660_100067292 3300005339 Bacteria 2791
15 Ga0070689_100080216 3300005340 Bacteria 2561
16 Ga0070661_100033837 3300005344 Bacteria 3704
17 Ga0070668_100130184 3300005347 Bacteria 2019
18 Ga0070671_100002027 3300005355 Bacteria 15597
19 Ga0070673_100001586 3300005364 Bacteria 13422
20 Ga0070659_100181577 3300005366 Bacteria 1727
21 Ga0070667_100001918 3300005367 Bacteria 18453
22 Ga0070711_100040323 3300005439 Bacteria 3148
23 Ga0070708_100189862 3300005445 Bacteria 1921
24 Ga0070663_100060969 3300005455 Unclassified 2715
25 Ga0070681_10015300 3300005458 Bacteria 7632
26 Ga0070685_10088013 3300005466 Bacteria 1875
27 Ga0070707_100159970 3300005468 Bacteria 2194
28 Ga0070699_100012766 3300005518 Bacteria 7240
29 Ga0070699_100038970 3300005518 Bacteria 4114
30 Ga0070679_100015044 3300005530 Bacteria 7434
31 Ga0070679_100042634 3300005530 Bacteria 4520
32 Ga0070684_100016121 3300005535 Bacteria 6104
33 Ga0070697_100040051 3300005536 Plasmid 3790
34 Ga0070697_100113709 3300005536 Bacteria 2258
35 Ga0068853_100189545 3300005539 Bacteria 1868
36 Ga0070672_100024824 3300005543 Bacteria 4436
37 Ga0070686_100193278 3300005544 Bacteria 1454
38 Ga0070696_100061871 3300005546 Bacteria 2619
39 Ga0070665_100015065 3300005548 Bacteria 7762
40 Ga0070665_100016117 3300005548 Bacteria 7500
41 Ga0070665_100033752 3300005548 Bacteria 5147
42 Ga0068855_100045012 3300005563 Bacteria 5220
43 Ga0068855_100149664 3300005563 Bacteria 2654
44 Ga0068855_100151964 3300005563 Unclassified 2632
45 Ga0070664_100006185 3300005564 Bacteria 9674
46 Ga0068854_100014926 3300005578 Bacteria 5130
47 Ga0068854_100055764 3300005578 Unclassified 2846
48 Ga0068856_100047857 3300005614 Bacteria 4213
49 Ga0068859_100062047 3300005617 Bacteria 3767
50 Ga0068864_100151618 3300005618 Bacteria 2100
51 Ga0068866_10046364 3300005718 Bacteria 2186
52 Ga0068861_100069617 3300005719 Bacteria 2722
53 Ga0068851_10096466 3300005834 Bacteria 1563
54 Ga0068863_100019916 3300005841 Bacteria 6417
55 Ga0081540_1000472 3300005983 Bacteria 39749
56 Ga0081540_1004175 3300005983 Bacteria 11116
57 Ga0075363_100003369 3300006048 Bacteria 6788
58 Ga0070712_100040542 3300006175 Bacteria 3193
59 Ga0075367_10001853 3300006178 Bacteria 9339
60 Ga0075370_10010960 3300006353 Bacteria 4752
61 Ga0068865_100013224 3300006881 Bacteria 5211
62 Ga0097620_100062042 3300006931 Bacteria 3767
63 Ga0099823_1002725 3300006944 Bacteria 16198
64 Ga0105240_10000001 3300009093 Bacteria 2887840
65 Ga0105240_10022276 3300009093 Bacteria 8404
66 Ga0105240_10045139 3300009093 Bacteria 5593
67 Ga0105240_10143861 3300009093 Unclassified 2848
68 Ga0111539_10371395 3300009094 Bacteria 1665
69 Ga0105245_10018409 3300009098 Bacteria 6107
70 Ga0105245_10169703 3300009098 Bacteria 2077
71 Ga0105247_10012675 3300009101 Bacteria 5057
72 Ga0114129_10077570 3300009147 Bacteria 4621
73 Ga0114129_10088002 3300009147 Bacteria 4306
74 Ga0105242_10021854 3300009176 Bacteria 5028
75 Ga0105248_10097838 3300009177 Bacteria 3306
76 Ga0105237_10010025 3300009545 Bacteria 10110
77 Ga0105237_10358033 3300009545 Bacteria 1463
78 Ga0105238_10048519 3300009551 Bacteria 4279
79 Ga0105238_10088974 3300009551 Bacteria 3075
80 Ga0105239_10055018 3300010375 Bacteria 4364
81 Ga0105246_10008285 3300011119 Bacteria 6385
82 Ga0157373_10026580 3300013100 Bacteria 4179
83 Ga0157371_10011727 3300013102 Bacteria 6735
84 Ga0157370_10015483 3300013104 Bacteria 7752
85 Ga0157370_10090073 3300013104 Unclassified 2880
86 Ga0157369_10071004 3300013105 Bacteria 3740
87 Ga0157369_10113843 3300013105 Unclassified 2874
88 Ga0157374_10005185 3300013296 Bacteria 10930
89 Ga0157378_10008999 3300013297 Bacteria 8694
90 Ga0163162_10040730 3300013306 Bacteria 4646
91 Ga0163162_10115523 3300013306 Bacteria 2784
92 Ga0157372_10052401 3300013307 Bacteria 4543
93 Ga0157375_10014969 3300013308 Bacteria 6935
94 Ga0157375_10047058 3300013308 Bacteria 4209
95 Ga0157375_10139675 3300013308 Bacteria 2549
96 Ga0163163_10032450 3300014325 Bacteria 5043
97 Ga0163163_10042132 3300014325 Bacteria 4469
98 Ga0163163_10068496 3300014325 Bacteria 3531
99 Ga0163163_10128220 3300014325 Bacteria 2576
100 Ga0157379_10007394 3300014968 Bacteria 9511
101 Ga0157379_10053166 3300014968 Bacteria 3618
102 Ga0163161_10039518 3300017792 Bacteria 3388
103 Ga0213872_10002841 3300021361 Bacteria 9899
104 Ga0213871_10018635 3300021441 Bacteria 1700
105 Ga0207426_1001687 3300025302 Bacteria 17046
106 Ga0207645_10145791 3300025907 Bacteria 1543
107 Ga0207705_10015420 3300025909 Bacteria 5484
108 Ga0207705_10016673 3300025909 Bacteria 5261
109 Ga0207684_10051303 3300025910 Bacteria 3500
110 Ga0207654_10088665 3300025911 Bacteria 1880
111 Ga0207707_10050688 3300025912 Bacteria 3615
112 Ga0207695_10000001 3300025913 Bacteria 2888630
113 Ga0207695_10006420 3300025913 Bacteria 15268
114 Ga0207695_10015635 3300025913 Bacteria 8925
115 Ga0207695_10108526 3300025913 Unclassified 2759
116 Ga0207671_10080881 3300025914 Bacteria 2436
117 Ga0207663_10042304 3300025916 Bacteria 2783
118 Ga0207660_10002841 3300025917 Bacteria 11325
119 Ga0207657_10025278 3300025919 Bacteria 5479
120 Ga0207657_10077906 3300025919 Unclassified 2793
121 Ga0207652_10009660 3300025921 Bacteria 7759
122 Ga0207646_10017341 3300025922 Bacteria 6740
123 Ga0207694_10046576 3300025924 Bacteria 3351
124 Ga0207659_10066243 3300025926 Bacteria 2621
125 Ga0207687_10031349 3300025927 Bacteria 3591
126 Ga0207690_10161761 3300025932 Bacteria 1669
127 Ga0207686_10026155 3300025934 Bacteria 3403
128 Ga0207670_10027039 3300025936 Bacteria 3623
129 Ga0207704_10050280 3300025938 Bacteria 2513
130 Ga0207691_10187760 3300025940 Bacteria 1804
131 Ga0207711_10099185 3300025941 Bacteria 2574
132 Ga0207689_10042845 3300025942 Bacteria 3743
133 Ga0207661_10005752 3300025944 Bacteria 8743
134 Ga0207661_10061456 3300025944 Bacteria 3035
135 Ga0207661_10144793 3300025944 Bacteria 2049
136 Ga0207667_10007562 3300025949 Bacteria 13037
137 Ga0207667_10018178 3300025949 Bacteria 7891
138 Ga0207640_10010513 3300025981 Bacteria 5216
139 Ga0207640_10044457 3300025981 Unclassified 2846
140 Ga0207677_10031136 3300026023 Bacteria 3414
141 Ga0207677_10092059 3300026023 Bacteria 2207
142 Ga0207678_10003578 3300026067 Bacteria 13971
143 Ga0207678_10080058 3300026067 Unclassified 2797
144 Ga0207641_10076552 3300026088 Bacteria 2892
145 Ga0207675_100100263 3300026118 Bacteria 2728
146 Ga0207683_10006802 3300026121 Bacteria 9792
147 Ga0209389_1000146 3300027296 Bacteria 60860
148 Ga0268266_10002294 3300028379 Bacteria 20753
149 Ga0268264_10100301 3300028381 Bacteria 2514
150 Ga0307513_10024750 3300031456 Bacteria 6978
151 Ga0373927_0076440 3300035695 Bacteria 2168
152 Ga0373927_0153182 3300035695 Bacteria 1509
153 Ga0373933_0004680 3300035724 Bacteria 7494
154 Ga0373947_0046830 3300035725 Bacteria 2590
155 Ga0373947_0116215 3300035725 Bacteria 1696
156 Ga0395905_0046741 3300037471 Bacteria 4059
157 Ga0395905_0247845 3300037471 Bacteria 1664
158 Ga0436365_1723853 3300039437 Bacteria 2334
159 Ga0436360_0334152 3300039438 Bacteria 3352
160 Ga0436361_0962335 3300039447 Bacteria 31232
161 Ga0439448_0008404 3300042005 Bacteria 3022
162 Ga0451576_0322841 3300045051 Bacteria 1616
163 Ga0495592_0046991 3300046454 Bacteria 3216
164 Ga0495629_0049308 3300046459 Bacteria 2951
165 Ga0495638_0000847 3300046460 Bacteria 31974
166 Ga0495651_0004676 3300046462 Bacteria 10479
167 Ga0495653_0003793 3300046463 Bacteria 12222
168 Ga0495582_0001710 3300046473 Bacteria 12378
169 Ga0495639_0001482 3300046475 Bacteria 10466
170 Ga0495662_0006556 3300046476 Bacteria 5810
171 Ga0495664_0011586 3300046477 Bacteria 4973
172 Ga0495664_0082780 3300046477 Bacteria 1925
173 Ga0495607_0016835 3300046501 Bacteria 4711
174 Ga0495583_0002411 3300046506 Bacteria 16070
175 Ga0495606_0043428 3300046507 Bacteria 2998
176 Ga0495608_0023899 3300046511 Bacteria 4181
177 Ga0495616_0059278 3300046513 Bacteria 1883
178 Ga0495618_0033869 3300046514 Bacteria 3203
179 Ga0495628_0007883 3300046516 Bacteria 9177
180 Ga0495628_0018093 3300046516 Bacteria 5844
181 Ga0495628_0250563 3300046516 Bacteria 1322
182 Ga0495630_0073313 3300046517 Bacteria 2578
183 Ga0495632_0012515 3300046519 Bacteria 4890
184 Ga0495666_0000685 3300046526 Bacteria 15389
185 Ga0495652_0009930 3300046529 Bacteria 8630
186 Ga0495652_0020851 3300046529 Bacteria 5824
187 Ga0495665_0007165 3300046531 Bacteria 6019
188 Ga0495640_0004578 3300046533 Bacteria 11024
189 Ga0495586_0010292 3300046535 Bacteria 4975
190 Ga0495586_0067762 3300046535 Bacteria 1946
191 Ga0495587_0006863 3300046536 Bacteria 7406
192 Ga0495587_0074858 3300046536 Bacteria 1966
193 Ga0495645_0000880 3300046543 Bacteria 20477
194 Ga0495667_0005160 3300046559 Bacteria 8824
195 Ga0495667_0046239 3300046559 Bacteria 2879
196 Ga0495667_0100629 3300046559 Bacteria 1870
197 Ga0495634_0001527 3300046642 Bacteria 20440
198 Ga0495635_0002634 3300046663 Bacteria 12274
199 Ga0495588_0085947 3300046674 Unclassified 1645
200 Ga0495657_0187615 3300046675 Bacteria 1265
201 Ga0495599_0003784 3300046678 Bacteria 8886
202 Ga0495599_0019222 3300046678 Bacteria 4260
203 Ga0495623_0051412 3300046679 Bacteria 2607
204 Ga0495646_0011045 3300046680 Bacteria 5736
205 Ga0495613_0011189 3300046689 Bacteria 6664
206 Ga0495613_0063156 3300046689 Unclassified 2710
207 Ga0495649_0005173 3300046694 Bacteria 8362
208 Ga0495649_0011713 3300046694 Bacteria 5132
209 Ga0495589_0001514 3300046794 Bacteria 13365
210 Ga0495589_0009133 3300046794 Bacteria 5155
211 Ga0495600_0000621 3300046809 Bacteria 18307
212 Ga0495604_0021327 3300047317 Bacteria 5171
213 Ga0495672_0027697 3300047320 Bacteria 3596
214 Ga0495676_0005754 3300047321 Bacteria 11368
215 Ga0495683_0011925 3300047323 Bacteria 4570
216 Ga0495675_0008184 3300047444 Bacteria 6472
217 Ga0495675_0138846 3300047444 Bacteria 1507
218 Ga0495673_0028496 3300047469 Bacteria 2644
219 Ga0495684_0016993 3300047471 Bacteria 5606
220 Ga0495593_0083113 3300047673 Bacteria 1655
221 Ga0496101_0270682 3300048904 Unclassified 1326
222 Ga0496104_0016488 3300048907 Bacteria 6713
223 Ga0496104_0062704 3300048907 Bacteria 3525
224 Ga0496106_0000045 3300048909 Bacteria 103269
225 Ga0496109_0042698 3300048912 Bacteria 4109
226 Ga0496114_0129890 3300048917 Bacteria 2175
227 Ga0496115_0046634 3300048918 Bacteria 3465
228 Ga0496121_0015366 3300048924 Bacteria 8028
229 Ga0496126_0001321 3300048929 Bacteria 39430
230 nmdc:mga03n38_1250_c1 3300050490 Bacteria 7146
231 nmdc:mga0yw44_14238_c1 3300050492 Bacteria 4216
232 nmdc:mga06z11_8981_c1 3300050494 Bacteria 4196
233 nmdc:mga05p37_25499_c1 3300050507 Bacteria 4821
234 nmdc:mga0n895_164348_c1 3300050512 Bacteria 2251
235 nmdc:mga0a205_19842_c1 3300050515 Bacteria 6342
236 Ga0495619_0033572 3300053085 Bacteria 3333
237 Ga0500595_003826 3300053119 Bacteria 6918
238 Ga0500618_001589 3300053125 Bacteria 9885
239 2513721030 2513237104 Bacteria 10034502
240 2805922771 2802429603 Bacteria 8777136
241 2824665128 2824661429 Bacteria 9877870
242 2824709258 2824704595 Bacteria 9667483
243 2824761974 2824753945 Bacteria 9787441
244 2824772434 2824763712 Bacteria 9792355
245 2841945986 2841941048 Bacteria 8688029
246 2841965219 2841957949 Bacteria 8652217
247 2876770438 2876761206 Bacteria 10111113
248 2903769875 2903768456 Bacteria 9749579
249 2904717355 2904711408 Bacteria 9771557
250 8056683399 8056681323 Bacteria 8472857
251 Ga0105245_10030023
252 Ga0065165_1002061
253 Ga0070658_10009768
254 Ga0070658_10076375
255 Ga0070683_100019511
256 Ga0070683_100058058
257 Ga0070683_100085582
258 Ga0070683_100243985
259 Ga0070670_100090112
260 Ga0070680_100008793
261 Ga0070682_100111678
262 Ga0068868_100220231
263 Ga0070660_100064378
264 Ga0070660_100067292
265 Ga0070689_100080216
266 Ga0070661_100033837
267 Ga0070668_100130184
268 Ga0070671_100002027
269 Ga0070673_100001586
270 Ga0070659_100181577
271 Ga0070667_100001918
272 Ga0070711_100040323
273 Ga0070708_100189862
274 Ga0070663_100060969
275 Ga0070681_10015300
276 Ga0070685_10088013
277 Ga0070707_100159970
278 Ga0070699_100012766
279 Ga0070699_100038970
280 Ga0070679_100015044
281 Ga0070679_100042634
282 Ga0070684_100016121
283 Ga0070697_100040051
284 Ga0070697_100113709
285 Ga0068853_100189545
286 Ga0070672_100024824
287 Ga0070686_100193278
288 Ga0070696_100061871
289 Ga0070665_100015065
290 Ga0070665_100016117
291 Ga0070665_100033752
292 Ga0068855_100045012
293 Ga0068855_100149664
294 Ga0068855_100151964
295 Ga0070664_100006185
296 Ga0068854_100014926
297 Ga0068854_100055764
298 Ga0068856_100047857
299 Ga0068859_100062047
300 Ga0068864_100151618
301 Ga0068866_10046364
302 Ga0068861_100069617
303 Ga0068851_10096466
304 Ga0068863_100019916
305 Ga0081540_1000472
306 Ga0081540_1004175
307 Ga0075363_100003369
308 Ga0070712_100040542
309 Ga0075367_10001853
310 Ga0075370_10010960
311 Ga0068865_100013224
312 Ga0097620_100062042
313 Ga0099823_1002725
314 Ga0105240_10000001
315 Ga0105240_10022276
316 Ga0105240_10045139
317 Ga0105240_10143861
318 Ga0111539_10371395
319 Ga0105245_10018409
320 Ga0105245_10169703
321 Ga0105247_10012675
322 Ga0114129_10077570
323 Ga0114129_10088002
324 Ga0105242_10021854
325 Ga0105248_10097838
326 Ga0105237_10010025
327 Ga0105237_10358033
328 Ga0105238_10048519
329 Ga0105238_10088974
330 Ga0105239_10055018
331 Ga0105246_10008285
332 Ga0157373_10026580
333 Ga0157371_10011727
334 Ga0157370_10015483
335 Ga0157370_10090073
336 Ga0157369_10071004
337 Ga0157369_10113843
338 Ga0157374_10005185
339 Ga0157378_10008999
340 Ga0163162_10040730
341 Ga0163162_10115523
342 Ga0157372_10052401
343 Ga0157375_10014969
344 Ga0157375_10047058
345 Ga0157375_10139675
346 Ga0163163_10032450
347 Ga0163163_10042132
348 Ga0163163_10068496
349 Ga0163163_10128220
350 Ga0157379_10007394
351 Ga0157379_10053166
352 Ga0163161_10039518
353 Ga0213872_10002841
354 Ga0213871_10018635
355 Ga0207426_1001687
356 Ga0207645_10145791
357 Ga0207705_10015420
358 Ga0207705_10016673
359 Ga0207684_10051303
360 Ga0207654_10088665
361 Ga0207707_10050688
362 Ga0207695_10000001
363 Ga0207695_10006420
364 Ga0207695_10015635
365 Ga0207695_10108526
366 Ga0207671_10080881
367 Ga0207663_10042304
368 Ga0207660_10002841
369 Ga0207657_10025278
370 Ga0207657_10077906
371 Ga0207652_10009660
372 Ga0207646_10017341
373 Ga0207694_10046576
374 Ga0207659_10066243
375 Ga0207687_10031349
376 Ga0207690_10161761
377 Ga0207686_10026155
378 Ga0207670_10027039
379 Ga0207704_10050280
380 Ga0207691_10187760
381 Ga0207711_10099185
382 Ga0207689_10042845
383 Ga0207661_10005752
384 Ga0207661_10061456
385 Ga0207661_10144793
386 Ga0207667_10007562
387 Ga0207667_10018178
388 Ga0207640_10010513
389 Ga0207640_10044457
390 Ga0207677_10031136
391 Ga0207677_10092059
392 Ga0207678_10003578
393 Ga0207678_10080058
394 Ga0207641_10076552
395 Ga0207675_100100263
396 Ga0207683_10006802
397 Ga0209389_1000146
398 Ga0268266_10002294
399 Ga0268264_10100301
400 Ga0307513_10024750
401 Ga0373927_0076440
402 Ga0373927_0153182
403 Ga0373933_0004680
404 Ga0373947_0046830
405 Ga0373947_0116215
406 Ga0395905_0046741
407 Ga0395905_0247845
408 Ga0436365_1723853
409 Ga0436360_0334152
410 Ga0436361_0962335
411 Ga0439448_0008404
412 Ga0451576_0322841
413 Ga0495592_0046991
414 Ga0495629_0049308
415 Ga0495638_0000847
416 Ga0495651_0004676
417 Ga0495653_0003793
418 Ga0495582_0001710
419 Ga0495639_0001482
420 Ga0495662_0006556
421 Ga0495664_0011586
422 Ga0495664_0082780
423 Ga0495607_0016835
424 Ga0495583_0002411
425 Ga0495606_0043428
426 Ga0495608_0023899
427 Ga0495616_0059278
428 Ga0495618_0033869
429 Ga0495628_0007883
430 Ga0495628_0018093
431 Ga0495628_0250563
432 Ga0495630_0073313
433 Ga0495632_0012515
434 Ga0495666_0000685
435 Ga0495652_0009930
436 Ga0495652_0020851
437 Ga0495665_0007165
438 Ga0495640_0004578
439 Ga0495586_0010292
440 Ga0495586_0067762
441 Ga0495587_0006863
442 Ga0495587_0074858
443 Ga0495645_0000880
444 Ga0495667_0005160
445 Ga0495667_0046239
446 Ga0495667_0100629
447 Ga0495634_0001527
448 Ga0495635_0002634
449 Ga0495588_0085947
450 Ga0495657_0187615
451 Ga0495599_0003784
452 Ga0495599_0019222
453 Ga0495623_0051412
454 Ga0495646_0011045
455 Ga0495613_0011189
456 Ga0495613_0063156
457 Ga0495649_0005173
458 Ga0495649_0011713
459 Ga0495589_0001514
460 Ga0495589_0009133
461 Ga0495600_0000621
462 Ga0495604_0021327
463 Ga0495672_0027697
464 Ga0495676_0005754
465 Ga0495683_0011925
466 Ga0495675_0008184
467 Ga0495675_0138846
468 Ga0495673_0028496
469 Ga0495684_0016993
470 Ga0495593_0083113
471 Ga0496101_0270682
472 Ga0496104_0016488
473 Ga0496104_0062704
474 Ga0496106_0000045
475 Ga0496109_0042698
476 Ga0496114_0129890
477 Ga0496115_0046634
478 Ga0496121_0015366
479 Ga0496126_0001321
480 nmdc:mga03n38_1250_c1
481 nmdc:mga0yw44_14238_c1
482 nmdc:mga06z11_8981_c1
483 nmdc:mga05p37_25499_c1
484 nmdc:mga0n895_164348_c1
485 nmdc:mga0a205_19842_c1
486 Ga0495619_0033572
487 Ga0500595_003826
488 Ga0500618_001589
489 2513721030
490 2805922771
491 2824665128
492 2824709258
493 2824761974
494 2824772434
495 2841945986
496 2841965219
497 2876770438
498 2903769875
499 2904717355
500 8056683399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

46

441

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8739 25 435
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8721 27 431
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8619 25 441
8dwi-assembly1.cif.gz_A molecular mechanism of sialic acid transport mediated by sialin 0.861 26 425
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.861 25 435
ID Description Score Start End Superfamily
af_O53919_11_216_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9754 20 224 1.20.1250.20
af_P0AA76_9_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9725 29 222 1.20.1250.20
af_P76470_6_212_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9723 18 223 1.20.1250.20
af_P40445_70_275_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9627 17 212 1.20.1250.20
af_O53919_11_216_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9615 20 224 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7Z0FI51-F1-model_v4 deleted 0.9855 38 427
AF-A0A1I3J5X4-F1-model_v4 D-galactonate transporter 0.9843 17 426 GO:0016020
GO:0022857
AF-A0A5C8T211-F1-model_v4 MFS transporter 0.9828 18 221 GO:0016020
GO:0022857
AF-A0A534VQM7-F1-model_v4 MFS transporter 0.9827 33 212 GO:0016020
GO:0022857
AF-Q2L1Z8-F1-model_v4 Probable transporter 0.9825 18 427 GO:0005886
GO:0022857

Map