F361511

General Info

Members Datasets Scaffolds Average Seq Length
250 174 500 315

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10386743|Ga0105240_103867432
Length 313
Sequence MKRLLLAAVAIALFAVPGLSNAQQKYKFALVPKAMNNPFFDLARDGCMQAMKELPNVECVYIGPAEHTESEQVQILQDLISKGIDGIAVSSSNAAAVAVALKAAKDANIPVVTWDSDAPKSKRVAFYGVDDLAAGRIMGEQAVTLLGGKGKVAIITSVGATNLERRLAGVHEVLAKHKGMEIVEVYDIKEDPVRCAEIIASGTNRYPDLGAWISVGGWPVFTRNALAAVPPTTKVISFDTIPPAPDLLKAGKVQVLLGQKYFGWGGESVRILSDIKSGRPPASPIVDSGVDVVTAANVDDYVKQWKAWEKGEK

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
126 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
129 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
165 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.6
Nodule 0
Rhizoplane 1.2
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 10.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10386743 3300009093 Bacteria 1579
2 Ga0065715_10042410 3300005293 Bacteria 1687
3 Ga0070670_100128632 3300005331 Bacteria 2186
4 Ga0070670_100259456 3300005331 Bacteria 1515
5 Ga0070677_10058321 3300005333 Bacteria 1585
6 Ga0068869_100069900 3300005334 Bacteria 2597
7 Ga0068869_100125221 3300005334 Bacteria 1970
8 Ga0070666_10050432 3300005335 Bacteria 2799
9 Ga0070666_10062121 3300005335 Bacteria 2530
10 Ga0068868_100058378 3300005338 Bacteria 3050
11 Ga0068868_100093874 3300005338 Bacteria 2420
12 Ga0070689_100011957 3300005340 Bacteria 6235
13 Ga0070689_100098989 3300005340 Bacteria 2307
14 Ga0070689_100475897 3300005340 Unclassified 1066
15 Ga0070692_10004149 3300005345 Bacteria 5997
16 Ga0070669_100202974 3300005353 Bacteria 1561
17 Ga0070675_100017024 3300005354 Bacteria 5777
18 Ga0070675_100146541 3300005354 Unclassified 2022
19 Ga0070675_100311222 3300005354 Unclassified 1390
20 Ga0070671_100032107 3300005355 Bacteria 4342
21 Ga0070673_100058881 3300005364 Bacteria 3039
22 Ga0070673_100334719 3300005364 Unclassified 1340
23 Ga0070688_100011738 3300005365 Bacteria 4883
24 Ga0070713_100056779 3300005436 Unclassified 3257
25 Ga0070701_10004943 3300005438 Bacteria 5460
26 Ga0070700_100253045 3300005441 Unclassified 1264
27 Ga0070662_100128577 3300005457 Bacteria 1950
28 Ga0070662_100139119 3300005457 Bacteria 1880
29 Ga0070681_10054428 3300005458 Bacteria 3987
30 Ga0068867_100006053 3300005459 Bacteria 8574
31 Ga0070685_10087270 3300005466 Unclassified 1882
32 Ga0070706_100075647 3300005467 Bacteria 3116
33 Ga0070707_100039151 3300005468 Bacteria 4531
34 Ga0070698_100108673 3300005471 Unclassified 2740
35 Ga0070698_100146677 3300005471 Bacteria 2308
36 Ga0070699_100227832 3300005518 Bacteria 1662
37 Ga0070684_100017391 3300005535 Bacteria 5901
38 Ga0070684_100209160 3300005535 Bacteria 1778
39 Ga0070697_100086631 3300005536 Bacteria 2585
40 Ga0070672_100256931 3300005543 Bacteria 1473
41 Ga0070696_100312410 3300005546 Unclassified 1207
42 Ga0070693_100108291 3300005547 Bacteria 1705
43 Ga0070693_100149487 3300005547 Bacteria 1478
44 Ga0070665_100003353 3300005548 Bacteria 17136
45 Ga0070704_100097242 3300005549 Bacteria 2209
46 Ga0068857_100265397 3300005577 Bacteria 1577
47 Ga0068854_100173227 3300005578 Bacteria 1680
48 Ga0070702_100043375 3300005615 Bacteria 2534
49 Ga0068852_100392992 3300005616 Unclassified 1363
50 Ga0068859_100063034 3300005617 Bacteria 3737
51 Ga0068864_100308658 3300005618 Bacteria 1483
52 Ga0068864_100403092 3300005618 Bacteria 1300
53 Ga0068863_100022348 3300005841 Bacteria 6040
54 Ga0068858_100016893 3300005842 Bacteria 6852
55 Ga0068858_100036345 3300005842 Bacteria 4567
56 Ga0068858_100168806 3300005842 Bacteria 2063
57 Ga0068858_100279191 3300005842 Bacteria 1590
58 Ga0068860_100098893 3300005843 Bacteria 2782
59 Ga0068862_100071634 3300005844 Bacteria 2992
60 Ga0081539_10012661 3300005985 Bacteria 6466
61 Ga0075365_10033309 3300006038 Bacteria 3319
62 Ga0075367_10001679 3300006178 Bacteria 9666
63 Ga0075366_10000209 3300006195 Bacteria 25751
64 Ga0075428_100029683 3300006844 Bacteria 6050
65 Ga0075428_100063986 3300006844 Bacteria 4028
66 Ga0075428_100302552 3300006844 Bacteria 1719
67 Ga0075430_100032117 3300006846 Bacteria 4456
68 Ga0075431_100014672 3300006847 Bacteria 7928
69 Ga0075431_100043007 3300006847 Bacteria 4661
70 Ga0075431_100618747 3300006847 Unclassified 1065
71 Ga0075433_10018161 3300006852 Bacteria 5841
72 Ga0075434_100088112 3300006871 Bacteria 3105
73 Ga0075434_100307750 3300006871 Bacteria 1605
74 Ga0075434_100333217 3300006871 Unclassified 1538
75 Ga0075429_100096617 3300006880 Bacteria 2577
76 Ga0075429_100255159 3300006880 Bacteria 1535
77 Ga0068865_100323499 3300006881 Bacteria 1241
78 Ga0097620_100063037 3300006931 Bacteria 3737
79 Ga0075435_100005956 3300007076 Bacteria 8577
80 Ga0075435_100019565 3300007076 Bacteria 5175
81 Ga0105240_10011250 3300009093 Bacteria 12478
82 Ga0105240_10083074 3300009093 Bacteria 3932
83 Ga0111539_10003952 3300009094 Bacteria 19471
84 Ga0111539_10192368 3300009094 Bacteria 2380
85 Ga0105245_10010557 3300009098 Bacteria 8036
86 Ga0105245_10021741 3300009098 Bacteria 5632
87 Ga0105245_10355187 3300009098 Bacteria 1453
88 Ga0105247_10062660 3300009101 Bacteria 2307
89 Ga0114129_10011539 3300009147 Bacteria 12581
90 Ga0114129_10026932 3300009147 Bacteria 8137
91 Ga0114129_10034985 3300009147 Bacteria 7096
92 Ga0114129_10048977 3300009147 Bacteria 5939
93 Ga0114129_10079493 3300009147 Bacteria 4560
94 Ga0114129_10098887 3300009147 Bacteria 4039
95 Ga0114129_10123479 3300009147 Bacteria 3561
96 Ga0114129_10143320 3300009147 Bacteria 3274
97 Ga0105243_10140989 3300009148 Bacteria 2056
98 Ga0105242_10001591 3300009176 Bacteria 17854
99 Ga0105248_10016113 3300009177 Bacteria 8225
100 Ga0105248_10076411 3300009177 Bacteria 3764
101 Ga0105248_10125803 3300009177 Bacteria 2892
102 Ga0105237_10669996 3300009545 Bacteria 1044
103 Ga0105249_10412607 3300009553 Unclassified 1383
104 Ga0105239_10228049 3300010375 Bacteria 2090
105 Ga0105246_10285362 3300011119 Unclassified 1326
106 Ga0163162_10146798 3300013306 Bacteria 2475
107 Ga0163162_10368003 3300013306 Bacteria 1570
108 Ga0157375_10183086 3300013308 Bacteria 2247
109 Ga0163163_10044952 3300014325 Bacteria 4334
110 Ga0157380_10023435 3300014326 Bacteria 4656
111 Ga0157379_10010713 3300014968 Bacteria 7988
112 Ga0157379_10308855 3300014968 Bacteria 1442
113 Ga0157376_10106193 3300014969 Bacteria 2463
114 Ga0207642_10098500 3300025899 Unclassified 1462
115 Ga0207645_10021564 3300025907 Bacteria 4199
116 Ga0207645_10200293 3300025907 Bacteria 1313
117 Ga0207684_10365804 3300025910 Unclassified 1241
118 Ga0207707_10082926 3300025912 Bacteria 2799
119 Ga0207662_10013233 3300025918 Bacteria 4612
120 Ga0207662_10085528 3300025918 Bacteria 1931
121 Ga0207657_10146298 3300025919 Bacteria 1927
122 Ga0207681_10099569 3300025923 Bacteria 2094
123 Ga0207659_10160824 3300025926 Bacteria 1763
124 Ga0207687_10006546 3300025927 Bacteria 7691
125 Ga0207700_10070226 3300025928 Unclassified 2692
126 Ga0207664_10030122 3300025929 Bacteria 4142
127 Ga0207690_10088002 3300025932 Bacteria 2187
128 Ga0207706_10037927 3300025933 Bacteria 4276
129 Ga0207686_10067133 3300025934 Bacteria 2293
130 Ga0207709_10391748 3300025935 Unclassified 1060
131 Ga0207670_10054556 3300025936 Bacteria 2697
132 Ga0207670_10078224 3300025936 Bacteria 2306
133 Ga0207704_10293989 3300025938 Bacteria 1241
134 Ga0207691_10024040 3300025940 Bacteria 5732
135 Ga0207691_10083559 3300025940 Bacteria 2867
136 Ga0207711_10013045 3300025941 Bacteria 6902
137 Ga0207711_10116107 3300025941 Bacteria 2386
138 Ga0207711_10130273 3300025941 Bacteria 2254
139 Ga0207689_10031622 3300025942 Bacteria 4404
140 Ga0207689_10088320 3300025942 Bacteria 2547
141 Ga0207661_10064657 3300025944 Bacteria 2966
142 Ga0207679_10295702 3300025945 Bacteria 1394
143 Ga0207651_10008146 3300025960 Bacteria 5639
144 Ga0207677_10070951 3300026023 Bacteria 2457
145 Ga0207703_10009008 3300026035 Bacteria 7859
146 Ga0207703_10244902 3300026035 Bacteria 1613
147 Ga0207639_10461493 3300026041 Bacteria 1155
148 Ga0207708_10002023 3300026075 Bacteria 14946
149 Ga0207708_10027201 3300026075 Bacteria 4330
150 Ga0207641_10111443 3300026088 Bacteria 2426
151 Ga0207648_10005579 3300026089 Bacteria 12659
152 Ga0207648_10008403 3300026089 Bacteria 9999
153 Ga0207676_10009590 3300026095 Bacteria 6892
154 Ga0207676_10264789 3300026095 Bacteria 1554
155 Ga0207674_10083152 3300026116 Bacteria 3201
156 Ga0207683_10173935 3300026121 Bacteria 1951
157 Ga0207428_10000671 3300027907 Bacteria 39984
158 Ga0268266_10035790 3300028379 Bacteria 4222
159 Ga0268265_10063813 3300028380 Bacteria 2835
160 Ga0268265_10265719 3300028380 Unclassified 1528
161 Ga0268264_10133620 3300028381 Bacteria 2203
162 Ga0268264_10157469 3300028381 Bacteria 2043
163 Ga0265330_10007995 3300031235 Bacteria 5124
164 Ga0265330_10019084 3300031235 Bacteria 3146
165 Ga0265332_10000053 3300031238 Bacteria 108878
166 Ga0265332_10005501 3300031238 Bacteria 5838
167 Ga0265328_10026804 3300031239 Bacteria 2165
168 Ga0265328_10047971 3300031239 Unclassified 1570
169 Ga0265320_10059146 3300031240 Bacteria 1833
170 Ga0265329_10024773 3300031242 Bacteria 1989
171 Ga0265339_10000427 3300031249 Bacteria 33315
172 Ga0265339_10129934 3300031249 Bacteria 1289
173 Ga0265331_10000130 3300031250 Bacteria 99140
174 Ga0265331_10003992 3300031250 Bacteria 9325
175 Ga0265316_10000085 3300031344 Bacteria 99136
176 Ga0265314_10000414 3300031711 Bacteria 57450
177 Ga0265314_10000540 3300031711 Bacteria 48694
178 Ga0265342_10002318 3300031712 Bacteria 16554
179 Ga0265342_10047961 3300031712 Bacteria 2562
180 Ga0307409_100141877 3300031995 Bacteria 2071
181 Ga0307409_100198909 3300031995 Bacteria 1791
182 Ga0307411_10121960 3300032005 Bacteria 1888
183 Ga0373924_0032732 3300035410 Bacteria 2096
184 Ga0373937_0002908 3300036401 Bacteria 14312
185 Ga0373925_0001917 3300037068 Bacteria 17225
186 Ga0451853_1846637 3300041512 Unclassified 2489
187 Ga0439433_0041053 3300041999 Bacteria 1077
188 Ga0439446_0025902 3300042156 Bacteria 1678
189 Ga0439435_0000636 3300042436 Bacteria 5751
190 Ga0439460_0011149 3300042461 Unclassified 2315
191 Ga0450893_0010190 3300042532 Bacteria 1543
192 Ga0451576_0232380 3300045051 Bacteria 1926
193 Ga0495580_0177288 3300046472 Bacteria 1472
194 Ga0495674_0122831 3300047319 Bacteria 2193
195 Ga0495672_0005309 3300047320 Bacteria 10254
196 Ga0496109_0111744 3300048912 Bacteria 2541
197 Ga0496112_0068821 3300048915 Bacteria 3496
198 Ga0496114_0017874 3300048917 Bacteria 5732
199 Ga0501031_0267114 3300049568 Bacteria 1111
200 Ga0501036_0393385 3300049572 Bacteria 1156
201 Ga0501040_0279466 3300049576 Bacteria 1192
202 Ga0501046_0241263 3300049580 Bacteria 1333
203 Ga0501047_0276815 3300049581 Bacteria 1524
204 Ga0501048_0046124 3300049582 Bacteria 3112
205 Ga0501069_0179325 3300049585 Bacteria 1224
206 Ga0501071_0042762 3300049587 Bacteria 3247
207 Ga0501071_0094969 3300049587 Bacteria 2194
208 Ga0501072_0072710 3300049588 Bacteria 2718
209 Ga0501072_0107976 3300049588 Unclassified 2214
210 Ga0501073_0011681 3300049589 Bacteria 6414
211 Ga0501074_0033947 3300049590 Bacteria 3699
212 Ga0501075_0030847 3300049591 Bacteria 3974
213 Ga0501076_0127317 3300049592 Bacteria 2064
214 Ga0501079_0277976 3300049741 Bacteria 1309
215 Ga0501079_0363310 3300049741 Bacteria 1135
216 Ga0501081_0172527 3300049743 Bacteria 1562
217 Ga0501035_0162924 3300049822 Unclassified 1930
218 Ga0501045_0117805 3300049824 Unclassified 1971
219 Ga0501045_0277733 3300049824 Bacteria 1247
220 nmdc:mga0k408_4298_c1 3300050493 Bacteria 7565
221 nmdc:mga06z11_3237_c1 3300050494 Bacteria 6292
222 nmdc:mga05p37_118706_c1 3300050507 Bacteria 3250
223 nmdc:mga05p37_248023_c1 3300050507 Bacteria 2137
224 nmdc:mga05p37_26100_c1 3300050507 Bacteria 7104
225 nmdc:mga05p37_34686_c1 3300050507 Bacteria 6181
226 nmdc:mga05p37_72246_c2 3300050507 Bacteria 2671
227 nmdc:mga05p37_86174_c1 3300050507 Bacteria 3871
228 nmdc:mga05p37_93644_c1 3300050507 Bacteria 3702
229 nmdc:mga09592_46950_c2 3300050508 Bacteria 2152
230 nmdc:mga09592_63334_c1 3300050508 Bacteria 3130
231 nmdc:mga0qj67_31088_c1 3300050509 Bacteria 4158
232 nmdc:mga06r32_205128_c1 3300050510 Bacteria 1959
233 nmdc:mga06r32_43569_c1 3300050510 Bacteria 4270
234 nmdc:mga08y16_18306_c1 3300050511 Bacteria 7381
235 nmdc:mga08y16_8599_c1 3300050511 Bacteria 10699
236 nmdc:mga0n895_441816_c1 3300050512 Unclassified 1314
237 nmdc:mga0rr50_6312_c1 3300050513 Bacteria 7201
238 nmdc:mga0a205_46631_c1 3300050515 Bacteria 4179
239 Ga0500646_0006693 3300053090 Bacteria 2932
240 Ga0500555_000049 3300053103 Bacteria 61213
241 Ga0500616_0000306 3300053153 Bacteria 70571
242 Ga0500645_000146 3300053730 Bacteria 55117
243 Ga0501084_0143620 3300054114 Bacteria 2010
244 Ga0590071_000642 3300059421 Bacteria 9937
245 Ga0590071_001369 3300059421 Bacteria 6467
246 Ga0590074_000538 3300059423 Bacteria 5688
247 Ga0590075_046361 3300059424 Bacteria 1113
248 Ga0590077_001586 3300059426 Bacteria 5229
249 Ga0501082_0219395 3300060353 Bacteria 1654
250 Ga0530510_0140439 3300061734 Bacteria 1779
251 Ga0105240_10386743
252 Ga0065715_10042410
253 Ga0070670_100128632
254 Ga0070670_100259456
255 Ga0070677_10058321
256 Ga0068869_100069900
257 Ga0068869_100125221
258 Ga0070666_10050432
259 Ga0070666_10062121
260 Ga0068868_100058378
261 Ga0068868_100093874
262 Ga0070689_100011957
263 Ga0070689_100098989
264 Ga0070689_100475897
265 Ga0070692_10004149
266 Ga0070669_100202974
267 Ga0070675_100017024
268 Ga0070675_100146541
269 Ga0070675_100311222
270 Ga0070671_100032107
271 Ga0070673_100058881
272 Ga0070673_100334719
273 Ga0070688_100011738
274 Ga0070713_100056779
275 Ga0070701_10004943
276 Ga0070700_100253045
277 Ga0070662_100128577
278 Ga0070662_100139119
279 Ga0070681_10054428
280 Ga0068867_100006053
281 Ga0070685_10087270
282 Ga0070706_100075647
283 Ga0070707_100039151
284 Ga0070698_100108673
285 Ga0070698_100146677
286 Ga0070699_100227832
287 Ga0070684_100017391
288 Ga0070684_100209160
289 Ga0070697_100086631
290 Ga0070672_100256931
291 Ga0070696_100312410
292 Ga0070693_100108291
293 Ga0070693_100149487
294 Ga0070665_100003353
295 Ga0070704_100097242
296 Ga0068857_100265397
297 Ga0068854_100173227
298 Ga0070702_100043375
299 Ga0068852_100392992
300 Ga0068859_100063034
301 Ga0068864_100308658
302 Ga0068864_100403092
303 Ga0068863_100022348
304 Ga0068858_100016893
305 Ga0068858_100036345
306 Ga0068858_100168806
307 Ga0068858_100279191
308 Ga0068860_100098893
309 Ga0068862_100071634
310 Ga0081539_10012661
311 Ga0075365_10033309
312 Ga0075367_10001679
313 Ga0075366_10000209
314 Ga0075428_100029683
315 Ga0075428_100063986
316 Ga0075428_100302552
317 Ga0075430_100032117
318 Ga0075431_100014672
319 Ga0075431_100043007
320 Ga0075431_100618747
321 Ga0075433_10018161
322 Ga0075434_100088112
323 Ga0075434_100307750
324 Ga0075434_100333217
325 Ga0075429_100096617
326 Ga0075429_100255159
327 Ga0068865_100323499
328 Ga0097620_100063037
329 Ga0075435_100005956
330 Ga0075435_100019565
331 Ga0105240_10011250
332 Ga0105240_10083074
333 Ga0111539_10003952
334 Ga0111539_10192368
335 Ga0105245_10010557
336 Ga0105245_10021741
337 Ga0105245_10355187
338 Ga0105247_10062660
339 Ga0114129_10011539
340 Ga0114129_10026932
341 Ga0114129_10034985
342 Ga0114129_10048977
343 Ga0114129_10079493
344 Ga0114129_10098887
345 Ga0114129_10123479
346 Ga0114129_10143320
347 Ga0105243_10140989
348 Ga0105242_10001591
349 Ga0105248_10016113
350 Ga0105248_10076411
351 Ga0105248_10125803
352 Ga0105237_10669996
353 Ga0105249_10412607
354 Ga0105239_10228049
355 Ga0105246_10285362
356 Ga0163162_10146798
357 Ga0163162_10368003
358 Ga0157375_10183086
359 Ga0163163_10044952
360 Ga0157380_10023435
361 Ga0157379_10010713
362 Ga0157379_10308855
363 Ga0157376_10106193
364 Ga0207642_10098500
365 Ga0207645_10021564
366 Ga0207645_10200293
367 Ga0207684_10365804
368 Ga0207707_10082926
369 Ga0207662_10013233
370 Ga0207662_10085528
371 Ga0207657_10146298
372 Ga0207681_10099569
373 Ga0207659_10160824
374 Ga0207687_10006546
375 Ga0207700_10070226
376 Ga0207664_10030122
377 Ga0207690_10088002
378 Ga0207706_10037927
379 Ga0207686_10067133
380 Ga0207709_10391748
381 Ga0207670_10054556
382 Ga0207670_10078224
383 Ga0207704_10293989
384 Ga0207691_10024040
385 Ga0207691_10083559
386 Ga0207711_10013045
387 Ga0207711_10116107
388 Ga0207711_10130273
389 Ga0207689_10031622
390 Ga0207689_10088320
391 Ga0207661_10064657
392 Ga0207679_10295702
393 Ga0207651_10008146
394 Ga0207677_10070951
395 Ga0207703_10009008
396 Ga0207703_10244902
397 Ga0207639_10461493
398 Ga0207708_10002023
399 Ga0207708_10027201
400 Ga0207641_10111443
401 Ga0207648_10005579
402 Ga0207648_10008403
403 Ga0207676_10009590
404 Ga0207676_10264789
405 Ga0207674_10083152
406 Ga0207683_10173935
407 Ga0207428_10000671
408 Ga0268266_10035790
409 Ga0268265_10063813
410 Ga0268265_10265719
411 Ga0268264_10133620
412 Ga0268264_10157469
413 Ga0265330_10007995
414 Ga0265330_10019084
415 Ga0265332_10000053
416 Ga0265332_10005501
417 Ga0265328_10026804
418 Ga0265328_10047971
419 Ga0265320_10059146
420 Ga0265329_10024773
421 Ga0265339_10000427
422 Ga0265339_10129934
423 Ga0265331_10000130
424 Ga0265331_10003992
425 Ga0265316_10000085
426 Ga0265314_10000414
427 Ga0265314_10000540
428 Ga0265342_10002318
429 Ga0265342_10047961
430 Ga0307409_100141877
431 Ga0307409_100198909
432 Ga0307411_10121960
433 Ga0373924_0032732
434 Ga0373937_0002908
435 Ga0373925_0001917
436 Ga0451853_1846637
437 Ga0439433_0041053
438 Ga0439446_0025902
439 Ga0439435_0000636
440 Ga0439460_0011149
441 Ga0450893_0010190
442 Ga0451576_0232380
443 Ga0495580_0177288
444 Ga0495674_0122831
445 Ga0495672_0005309
446 Ga0496109_0111744
447 Ga0496112_0068821
448 Ga0496114_0017874
449 Ga0501031_0267114
450 Ga0501036_0393385
451 Ga0501040_0279466
452 Ga0501046_0241263
453 Ga0501047_0276815
454 Ga0501048_0046124
455 Ga0501069_0179325
456 Ga0501071_0042762
457 Ga0501071_0094969
458 Ga0501072_0072710
459 Ga0501072_0107976
460 Ga0501073_0011681
461 Ga0501074_0033947
462 Ga0501075_0030847
463 Ga0501076_0127317
464 Ga0501079_0277976
465 Ga0501079_0363310
466 Ga0501081_0172527
467 Ga0501035_0162924
468 Ga0501045_0117805
469 Ga0501045_0277733
470 nmdc:mga0k408_4298_c1
471 nmdc:mga06z11_3237_c1
472 nmdc:mga05p37_118706_c1
473 nmdc:mga05p37_248023_c1
474 nmdc:mga05p37_26100_c1
475 nmdc:mga05p37_34686_c1
476 nmdc:mga05p37_72246_c2
477 nmdc:mga05p37_86174_c1
478 nmdc:mga05p37_93644_c1
479 nmdc:mga09592_46950_c2
480 nmdc:mga09592_63334_c1
481 nmdc:mga0qj67_31088_c1
482 nmdc:mga06r32_205128_c1
483 nmdc:mga06r32_43569_c1
484 nmdc:mga08y16_18306_c1
485 nmdc:mga08y16_8599_c1
486 nmdc:mga0n895_441816_c1
487 nmdc:mga0rr50_6312_c1
488 nmdc:mga0a205_46631_c1
489 Ga0500646_0006693
490 Ga0500555_000049
491 Ga0500616_0000306
492 Ga0500645_000146
493 Ga0501084_0143620
494 Ga0590071_000642
495 Ga0590071_001369
496 Ga0590074_000538
497 Ga0590075_046361
498 Ga0590077_001586
499 Ga0501082_0219395
500 Ga0530510_0140439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

28

280

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hqj-assembly1.cif.gz_A crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose 0.9469 31 307
6gq0-assembly1.cif.gz_A crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus 0.9409 35 307
5dkv-assembly4.cif.gz_D crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d-tagatopyranose 0.9317 36 312
4wut-assembly1.cif.gz_A crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose 0.9298 38 314
3ksm-assembly3.cif.gz_B crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis 0.9297 39 305
ID Description Score Start End Superfamily
2qvcB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9617 37 141 3.40.50.2300
6dspB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9554 37 138 3.40.50.2300
af_P02925_28_128_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9296 39 137 3.40.50.2300
3g1wB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9292 39 142 3.40.50.2300
af_P76142_29_128_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9258 38 137 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3B9GII2-F1-model_v4 BMP family ABC transporter substrate-binding protein 0.948 51 307 GO:0005886
GO:0030246
GO:0030313
AF-A0A536JKV2-F1-model_v4 Substrate-binding domain-containing protein 0.9415 31 309 GO:0030246
GO:0030313
AF-A0A0U1KIZ1-F1-model_v4 D-allose-binding periplasmic protein 0.9359 35 307 GO:0016020
GO:0030246
GO:0030288
AF-A0A524AT60-F1-model_v4 D-ribose ABC transporter substrate-binding protein 0.9345 49 304 GO:0030246
GO:0030313
AF-A0A7V3S0Z7-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9334 17 321 GO:0030246
GO:0030288

Map