F361453

General Info

Members Datasets Scaffolds Average Seq Length
250 140 500 504

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1004965|Ga0081540_100496511
Length 543
Sequence MATSLLAMPIEKLLVTNRGEIALRVFRACRELGIATVAVAPEDDASSLHARSAAETVRISSYLDASEHVRAARETGADAIHPGYGFLAESPEFAEAVEAAGLTWVGPPPAALRAGGDKLEAKRLAREAGVPVVPEGEPEEIGFPLMVKAAAXXXXRGMRVVREAGELEEALEAARREAKAAFGDDRVFCERYVERPRHVEIQLLGDSHGTVVALGERECSVQRRHQKVLEESPSPALDPDLRARMGEAAVAFARAIGYRSAGTAEFMLDGGDFWFLELNGRIQVEHPVTELVSGADLVAEQIRIAQGERLRAEPRLVGHAVEVRLYAEDPQTFLPQTGWLERLRLPSSVRVDAGVEEGDEIGTTYDPLIAKLIAHGSTRDDALDRLSAALAETEVGGVVTNLAFLRWLVAHPALRAGETTTAFLTEHPPLSAPPLRLPDRPWRGGFRLNLPTPAPAAPPDLAASADHGGRHEQSSLSAPMPGTVIRVLVAEGERVGPRQPLVVLEAMKMETPVVSPYEAVVRAVHVGEGDSVAGGDVLVELEE

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
70 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
76 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
90 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
91 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
92 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
93 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 18
Rhizosphere 82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1004965 3300005983 Bacteria 10004
2 Ga0070658_10009834 3300005327 Bacteria 7683
3 Ga0070666_10039863 3300005335 Bacteria 3133
4 Ga0070682_100013575 3300005337 Bacteria 4690
5 Ga0070659_100008070 3300005366 Bacteria 7676
6 Ga0070714_100000941 3300005435 Bacteria 20721
7 Ga0070714_100152866 3300005435 Bacteria 2081
8 Ga0070713_100002531 3300005436 Bacteria 11952
9 Ga0070662_100025712 3300005457 Bacteria 4068
10 Ga0070681_10008413 3300005458 Bacteria 10105
11 Ga0070707_100010930 3300005468 Bacteria 8453
12 Ga0070707_100024466 3300005468 Bacteria 5720
13 Ga0070707_100055626 3300005468 Bacteria 3794
14 Ga0070698_100005683 3300005471 Bacteria 13650
15 Ga0070699_100016592 3300005518 Bacteria 6320
16 Ga0070679_100051785 3300005530 Bacteria 4089
17 Ga0070679_100062072 3300005530 Bacteria 3725
18 Ga0070679_100085295 3300005530 Bacteria 3145
19 Ga0070684_100138365 3300005535 Bacteria 2201
20 Ga0070695_100036396 3300005545 Bacteria 3097
21 Ga0070696_100017223 3300005546 Bacteria 4875
22 Ga0068855_100063634 3300005563 Bacteria 4304
23 Ga0070664_100115988 3300005564 Bacteria 2341
24 Ga0068856_100045130 3300005614 Bacteria 4338
25 Ga0068856_100169382 3300005614 Bacteria 2196
26 Ga0068861_100005347 3300005719 Bacteria 8678
27 Ga0081455_10006181 3300005937 Bacteria 12915
28 Ga0081455_10006261 3300005937 Bacteria 12806
29 Ga0081455_10007421 3300005937 Bacteria 11550
30 Ga0081455_10017233 3300005937 Bacteria 6934
31 Ga0081538_10000184 3300005981 Bacteria 68601
32 Ga0081538_10000651 3300005981 Bacteria 38466
33 Ga0081538_10020158 3300005981 Bacteria 4924
34 Ga0081539_10002997 3300005985 Bacteria 22067
35 Ga0070717_10041047 3300006028 Bacteria 3771
36 Ga0070717_10051125 3300006028 Bacteria 3400
37 Ga0070716_100006144 3300006173 Bacteria 5861
38 Ga0070712_100088538 3300006175 Bacteria 2262
39 Ga0075430_100063114 3300006846 Bacteria 3112
40 Ga0075431_100132379 3300006847 Bacteria 2572
41 Ga0075433_10058798 3300006852 Bacteria 3363
42 Ga0075434_100075560 3300006871 Bacteria 3363
43 Ga0075429_100062973 3300006880 Bacteria 3231
44 Ga0075436_100061087 3300006914 Bacteria 2603
45 Ga0075435_100017132 3300007076 Bacteria 5476
46 Ga0105240_10174183 3300009093 Bacteria 2545
47 Ga0111539_10185651 3300009094 Bacteria 2428
48 Ga0114129_10000910 3300009147 Bacteria 38506
49 Ga0105243_10114715 3300009148 Bacteria 2261
50 Ga0105237_10183631 3300009545 Bacteria 2091
51 Ga0105239_10100171 3300010375 Bacteria 3204
52 Ga0157369_10012482 3300013105 Bacteria 9638
53 Ga0157374_10001404 3300013296 Bacteria 20421
54 Ga0157372_10078582 3300013307 Bacteria 3728
55 Ga0157372_10173591 3300013307 Bacteria 2494
56 Ga0157375_10023910 3300013308 Bacteria 5645
57 Ga0207685_10033436 3300025905 Bacteria 1858
58 Ga0207707_10010378 3300025912 Bacteria 8082
59 Ga0207663_10015958 3300025916 Bacteria 4155
60 Ga0207663_10025263 3300025916 Bacteria 3431
61 Ga0207657_10034207 3300025919 Bacteria 4573
62 Ga0207652_10179723 3300025921 Bacteria 1901
63 Ga0207646_10003183 3300025922 Bacteria 18776
64 Ga0207646_10023009 3300025922 Bacteria 5730
65 Ga0207646_10050078 3300025922 Bacteria 3739
66 Ga0207646_10151358 3300025922 Bacteria 2092
67 Ga0207687_10081647 3300025927 Bacteria 2337
68 Ga0207700_10000141 3300025928 Bacteria 43403
69 Ga0207644_10013183 3300025931 Bacteria 5507
70 Ga0207706_10010184 3300025933 Bacteria 8603
71 Ga0207665_10015025 3300025939 Bacteria 5084
72 Ga0207667_10038005 3300025949 Bacteria 5144
73 Ga0207678_10007761 3300026067 Bacteria 9479
74 Ga0207708_10013305 3300026075 Bacteria 6145
75 Ga0207702_10001160 3300026078 Bacteria 26852
76 Ga0207648_10046733 3300026089 Bacteria 3795
77 Ga0207675_100002763 3300026118 Bacteria 17252
78 Ga0207683_10031572 3300026121 Bacteria 4597
79 Ga0207428_10013637 3300027907 Bacteria 7090
80 Ga0207428_10021116 3300027907 Bacteria 5516
81 Ga0268266_10125829 3300028379 Bacteria 2287
82 Ga0395899_0007479 3300037312 Bacteria 8438
83 Ga0395899_0009281 3300037312 Bacteria 7553
84 Ga0395899_0012011 3300037312 Bacteria 6635
85 Ga0395899_0018496 3300037312 Bacteria 5297
86 Ga0395899_0019769 3300037312 Bacteria 5113
87 Ga0395899_0022937 3300037312 Bacteria 4729
88 Ga0395899_0058402 3300037312 Bacteria 2845
89 Ga0395900_0002122 3300037418 Bacteria 22181
90 Ga0395900_0003384 3300037418 Bacteria 17224
91 Ga0395900_0010335 3300037418 Bacteria 9550
92 Ga0395900_0016877 3300037418 Bacteria 7452
93 Ga0395900_0030800 3300037418 Bacteria 5509
94 Ga0395900_0045936 3300037418 Bacteria 4498
95 Ga0395900_0060558 3300037418 Bacteria 3895
96 Ga0395900_0066771 3300037418 Bacteria 3696
97 Ga0395900_0094353 3300037418 Bacteria 3073
98 Ga0395900_0118670 3300037418 Bacteria 2715
99 Ga0395900_0156047 3300037418 Bacteria 2331
100 Ga0395900_0188734 3300037418 Bacteria 2091
101 Ga0395898_0002255 3300037466 Bacteria 23396
102 Ga0395898_0007430 3300037466 Bacteria 11630
103 Ga0395898_0007585 3300037466 Bacteria 11518
104 Ga0395898_0009213 3300037466 Bacteria 10386
105 Ga0395898_0012640 3300037466 Bacteria 8727
106 Ga0395898_0017348 3300037466 Bacteria 7354
107 Ga0395898_0026495 3300037466 Bacteria 5832
108 Ga0395898_0028500 3300037466 Bacteria 5594
109 Ga0395898_0041906 3300037466 Bacteria 4519
110 Ga0395898_0047660 3300037466 Bacteria 4204
111 Ga0395898_0050508 3300037466 Bacteria 4069
112 Ga0395898_0057610 3300037466 Bacteria 3786
113 Ga0395898_0083178 3300037466 Bacteria 3085
114 Ga0395905_0001065 3300037471 Bacteria 34603
115 Ga0395905_0007429 3300037471 Bacteria 10895
116 Ga0395905_0007801 3300037471 Bacteria 10615
117 Ga0395905_0009858 3300037471 Bacteria 9311
118 Ga0395905_0022577 3300037471 Bacteria 5950
119 Ga0395905_0023424 3300037471 Bacteria 5834
120 Ga0395905_0035365 3300037471 Bacteria 4691
121 Ga0395905_0041027 3300037471 Bacteria 4342
122 Ga0395905_0071382 3300037471 Bacteria 3255
123 Ga0395901_0001460 3300038443 Bacteria 24601
124 Ga0395901_0002723 3300038443 Bacteria 17814
125 Ga0395901_0002879 3300038443 Bacteria 17364
126 Ga0395901_0006516 3300038443 Bacteria 11810
127 Ga0395901_0012466 3300038443 Bacteria 8628
128 Ga0395901_0014893 3300038443 Bacteria 7902
129 Ga0395901_0028404 3300038443 Bacteria 5752
130 Ga0395901_0042327 3300038443 Bacteria 4722
131 Ga0395901_0056402 3300038443 Bacteria 4086
132 Ga0395901_0058802 3300038443 Bacteria 3998
133 Ga0395901_0060628 3300038443 Bacteria 3937
134 Ga0439451_002931 3300042009 Bacteria 3470
135 Ga0439446_0007417 3300042156 Bacteria 2882
136 Ga0466972_0005383 3300044658 Bacteria 6411
137 Ga0466966_0048471 3300044684 Bacteria 2706
138 Ga0466961_0030030 3300044693 Bacteria 3493
139 Ga0466961_0077433 3300044693 Bacteria 2106
140 Ga0466963_0004993 3300044694 Bacteria 7746
141 Ga0466963_0005154 3300044694 Bacteria 7630
142 Ga0466964_0025282 3300044706 Bacteria 2318
143 Ga0466971_0031762 3300044719 Bacteria 2365
144 Ga0466957_0002864 3300044842 Bacteria 9339
145 Ga0466957_0043800 3300044842 Bacteria 2711
146 Ga0451576_0035357 3300045051 Bacteria 5301
147 Ga0466958_0000712 3300045836 Bacteria 14533
148 Ga0466958_0003335 3300045836 Bacteria 8319
149 Ga0466958_0011127 3300045836 Bacteria 5061
150 Ga0466967_0000880 3300045976 Bacteria 16000
151 Ga0466967_0003678 3300045976 Bacteria 10094
152 Ga0466967_0018307 3300045976 Bacteria 5593
153 Ga0495592_0002190 3300046454 Bacteria 13765
154 Ga0495603_0038771 3300046455 Bacteria 2856
155 Ga0495662_0047866 3300046476 Bacteria 2064
156 Ga0495594_0000915 3300046499 Bacteria 15329
157 Ga0495628_0031557 3300046516 Bacteria 4284
158 Ga0495642_0040724 3300046528 Bacteria 1888
159 Ga0495652_0006893 3300046529 Bacteria 10518
160 Ga0495645_0034893 3300046543 Bacteria 3667
161 Ga0495645_0110624 3300046543 Bacteria 1944
162 Ga0495656_0024983 3300046615 Bacteria 2365
163 Ga0495623_0058835 3300046679 Bacteria 2415
164 Ga0495647_0007298 3300046681 Bacteria 3697
165 Ga0495658_0029669 3300046683 Bacteria 2964
166 Ga0495581_0005906 3300047315 Bacteria 7100
167 Ga0495676_0002605 3300047321 Bacteria 16101
168 Ga0495680_0138632 3300047322 Bacteria 1781
169 Ga0495684_0018307 3300047471 Bacteria 5398
170 Ga0495684_0082618 3300047471 Bacteria 2437
171 Ga0496101_0014370 3300048904 Bacteria 5319
172 Ga0496102_0015884 3300048905 Bacteria 6567
173 Ga0496102_0021732 3300048905 Bacteria 5677
174 Ga0496103_0021293 3300048906 Bacteria 3901
175 Ga0496104_0008834 3300048907 Bacteria 8957
176 Ga0496104_0009591 3300048907 Bacteria 8618
177 Ga0496104_0016407 3300048907 Bacteria 6727
178 Ga0496104_0093005 3300048907 Bacteria 2883
179 Ga0496104_0097123 3300048907 Bacteria 2819
180 Ga0496105_0002412 3300048908 Bacteria 13537
181 Ga0496105_0005632 3300048908 Bacteria 9529
182 Ga0496105_0019501 3300048908 Bacteria 5470
183 Ga0496105_0028153 3300048908 Bacteria 4595
184 Ga0496105_0075398 3300048908 Bacteria 2785
185 Ga0496108_0006476 3300048911 Bacteria 9496
186 Ga0496108_0032465 3300048911 Bacteria 4337
187 Ga0496108_0050357 3300048911 Bacteria 3486
188 Ga0496109_0010701 3300048912 Bacteria 7849
189 Ga0496109_0038484 3300048912 Bacteria 4324
190 Ga0496110_0002261 3300048913 Bacteria 14390
191 Ga0496110_0047826 3300048913 Bacteria 3747
192 Ga0496110_0072274 3300048913 Bacteria 3060
193 Ga0496110_0182166 3300048913 Bacteria 1907
194 Ga0496111_0006329 3300048914 Bacteria 7675
195 Ga0496111_0008659 3300048914 Bacteria 6748
196 Ga0496111_0010479 3300048914 Bacteria 6223
197 Ga0496111_0012754 3300048914 Bacteria 5699
198 Ga0496111_0037856 3300048914 Bacteria 3453
199 Ga0496111_0074244 3300048914 Bacteria 2477
200 Ga0496112_0006865 3300048915 Bacteria 10037
201 Ga0496112_0008910 3300048915 Bacteria 9005
202 Ga0496112_0010028 3300048915 Bacteria 8575
203 Ga0496112_0013365 3300048915 Bacteria 7579
204 Ga0496112_0031925 3300048915 Bacteria 5111
205 Ga0496112_0040660 3300048915 Bacteria 4546
206 Ga0496112_0133670 3300048915 Bacteria 2451
207 Ga0496113_0000346 3300048916 Bacteria 22110
208 Ga0496113_0033649 3300048916 Bacteria 3734
209 Ga0496114_0102109 3300048917 Bacteria 2449
210 Ga0496115_0000948 3300048918 Bacteria 21056
211 Ga0496115_0008562 3300048918 Bacteria 7574
212 Ga0496115_0019315 3300048918 Bacteria 5243
213 Ga0496115_0083233 3300048918 Bacteria 2608
214 Ga0496115_0095643 3300048918 Bacteria 2431
215 Ga0496115_0117047 3300048918 Bacteria 2192
216 Ga0501032_0019754 3300049569 Bacteria 4706
217 Ga0501033_0004074 3300049570 Bacteria 11790
218 Ga0501036_0002532 3300049572 Bacteria 14356
219 Ga0501037_0002486 3300049573 Bacteria 13311
220 Ga0501038_0001419 3300049574 Bacteria 21940
221 Ga0501039_0003332 3300049575 Bacteria 12001
222 Ga0501043_0012498 3300049579 Bacteria 6643
223 Ga0501047_0027027 3300049581 Bacteria 5527
224 Ga0501048_0024049 3300049582 Bacteria 4448
225 Ga0501068_0000820 3300049584 Bacteria 16120
226 Ga0501069_0002228 3300049585 Bacteria 9772
227 Ga0501070_0006828 3300049586 Bacteria 9712
228 Ga0501073_0014319 3300049589 Bacteria 5761
229 Ga0501074_0005250 3300049590 Bacteria 9318
230 Ga0501080_0062674 3300049742 Bacteria 3460
231 Ga0501081_0012568 3300049743 Bacteria 5567
232 Ga0501083_0013992 3300049744 Bacteria 5606
233 Ga0501035_0005485 3300049822 Bacteria 11985
234 Ga0501044_0040256 3300049823 Bacteria 4871
235 Ga0501045_0080304 3300049824 Bacteria 2404
236 nmdc:mga05p37_203498_c1 3300050507 Bacteria 2396
237 nmdc:mga05p37_260919_c1 3300050507 Bacteria 2074
238 nmdc:mga06r32_18202_c1 3300050510 Bacteria 6428
239 nmdc:mga08y16_21873_c1 3300050511 Bacteria 6750
240 nmdc:mga0n895_35339_c1 3300050512 Bacteria 4818
241 nmdc:mga0rr50_6327_c1 3300050513 Bacteria 7196
242 nmdc:mga0rr50_70166_c1 3300050513 Bacteria 2670
243 nmdc:mga08x19_16128_c1 3300050514 Bacteria 4553
244 nmdc:mga0a205_42436_c1 3300050515 Bacteria 4384
245 Ga0495601_0020793 3300053077 Bacteria 4011
246 Ga0495595_0004034 3300053084 Bacteria 5876
247 Ga0495595_0028075 3300053084 Bacteria 2511
248 Ga0495619_0043636 3300053085 Bacteria 2940
249 Ga0466962_0006719 3300061719 Bacteria 5515
250 Ga0466962_0010539 3300061719 Bacteria 4447
251 Ga0081540_1004965
252 Ga0070658_10009834
253 Ga0070666_10039863
254 Ga0070682_100013575
255 Ga0070659_100008070
256 Ga0070714_100000941
257 Ga0070714_100152866
258 Ga0070713_100002531
259 Ga0070662_100025712
260 Ga0070681_10008413
261 Ga0070707_100010930
262 Ga0070707_100024466
263 Ga0070707_100055626
264 Ga0070698_100005683
265 Ga0070699_100016592
266 Ga0070679_100051785
267 Ga0070679_100062072
268 Ga0070679_100085295
269 Ga0070684_100138365
270 Ga0070695_100036396
271 Ga0070696_100017223
272 Ga0068855_100063634
273 Ga0070664_100115988
274 Ga0068856_100045130
275 Ga0068856_100169382
276 Ga0068861_100005347
277 Ga0081455_10006181
278 Ga0081455_10006261
279 Ga0081455_10007421
280 Ga0081455_10017233
281 Ga0081538_10000184
282 Ga0081538_10000651
283 Ga0081538_10020158
284 Ga0081539_10002997
285 Ga0070717_10041047
286 Ga0070717_10051125
287 Ga0070716_100006144
288 Ga0070712_100088538
289 Ga0075430_100063114
290 Ga0075431_100132379
291 Ga0075433_10058798
292 Ga0075434_100075560
293 Ga0075429_100062973
294 Ga0075436_100061087
295 Ga0075435_100017132
296 Ga0105240_10174183
297 Ga0111539_10185651
298 Ga0114129_10000910
299 Ga0105243_10114715
300 Ga0105237_10183631
301 Ga0105239_10100171
302 Ga0157369_10012482
303 Ga0157374_10001404
304 Ga0157372_10078582
305 Ga0157372_10173591
306 Ga0157375_10023910
307 Ga0207685_10033436
308 Ga0207707_10010378
309 Ga0207663_10015958
310 Ga0207663_10025263
311 Ga0207657_10034207
312 Ga0207652_10179723
313 Ga0207646_10003183
314 Ga0207646_10023009
315 Ga0207646_10050078
316 Ga0207646_10151358
317 Ga0207687_10081647
318 Ga0207700_10000141
319 Ga0207644_10013183
320 Ga0207706_10010184
321 Ga0207665_10015025
322 Ga0207667_10038005
323 Ga0207678_10007761
324 Ga0207708_10013305
325 Ga0207702_10001160
326 Ga0207648_10046733
327 Ga0207675_100002763
328 Ga0207683_10031572
329 Ga0207428_10013637
330 Ga0207428_10021116
331 Ga0268266_10125829
332 Ga0395899_0007479
333 Ga0395899_0009281
334 Ga0395899_0012011
335 Ga0395899_0018496
336 Ga0395899_0019769
337 Ga0395899_0022937
338 Ga0395899_0058402
339 Ga0395900_0002122
340 Ga0395900_0003384
341 Ga0395900_0010335
342 Ga0395900_0016877
343 Ga0395900_0030800
344 Ga0395900_0045936
345 Ga0395900_0060558
346 Ga0395900_0066771
347 Ga0395900_0094353
348 Ga0395900_0118670
349 Ga0395900_0156047
350 Ga0395900_0188734
351 Ga0395898_0002255
352 Ga0395898_0007430
353 Ga0395898_0007585
354 Ga0395898_0009213
355 Ga0395898_0012640
356 Ga0395898_0017348
357 Ga0395898_0026495
358 Ga0395898_0028500
359 Ga0395898_0041906
360 Ga0395898_0047660
361 Ga0395898_0050508
362 Ga0395898_0057610
363 Ga0395898_0083178
364 Ga0395905_0001065
365 Ga0395905_0007429
366 Ga0395905_0007801
367 Ga0395905_0009858
368 Ga0395905_0022577
369 Ga0395905_0023424
370 Ga0395905_0035365
371 Ga0395905_0041027
372 Ga0395905_0071382
373 Ga0395901_0001460
374 Ga0395901_0002723
375 Ga0395901_0002879
376 Ga0395901_0006516
377 Ga0395901_0012466
378 Ga0395901_0014893
379 Ga0395901_0028404
380 Ga0395901_0042327
381 Ga0395901_0056402
382 Ga0395901_0058802
383 Ga0395901_0060628
384 Ga0439451_002931
385 Ga0439446_0007417
386 Ga0466972_0005383
387 Ga0466966_0048471
388 Ga0466961_0030030
389 Ga0466961_0077433
390 Ga0466963_0004993
391 Ga0466963_0005154
392 Ga0466964_0025282
393 Ga0466971_0031762
394 Ga0466957_0002864
395 Ga0466957_0043800
396 Ga0451576_0035357
397 Ga0466958_0000712
398 Ga0466958_0003335
399 Ga0466958_0011127
400 Ga0466967_0000880
401 Ga0466967_0003678
402 Ga0466967_0018307
403 Ga0495592_0002190
404 Ga0495603_0038771
405 Ga0495662_0047866
406 Ga0495594_0000915
407 Ga0495628_0031557
408 Ga0495642_0040724
409 Ga0495652_0006893
410 Ga0495645_0034893
411 Ga0495645_0110624
412 Ga0495656_0024983
413 Ga0495623_0058835
414 Ga0495647_0007298
415 Ga0495658_0029669
416 Ga0495581_0005906
417 Ga0495676_0002605
418 Ga0495680_0138632
419 Ga0495684_0018307
420 Ga0495684_0082618
421 Ga0496101_0014370
422 Ga0496102_0015884
423 Ga0496102_0021732
424 Ga0496103_0021293
425 Ga0496104_0008834
426 Ga0496104_0009591
427 Ga0496104_0016407
428 Ga0496104_0093005
429 Ga0496104_0097123
430 Ga0496105_0002412
431 Ga0496105_0005632
432 Ga0496105_0019501
433 Ga0496105_0028153
434 Ga0496105_0075398
435 Ga0496108_0006476
436 Ga0496108_0032465
437 Ga0496108_0050357
438 Ga0496109_0010701
439 Ga0496109_0038484
440 Ga0496110_0002261
441 Ga0496110_0047826
442 Ga0496110_0072274
443 Ga0496110_0182166
444 Ga0496111_0006329
445 Ga0496111_0008659
446 Ga0496111_0010479
447 Ga0496111_0012754
448 Ga0496111_0037856
449 Ga0496111_0074244
450 Ga0496112_0006865
451 Ga0496112_0008910
452 Ga0496112_0010028
453 Ga0496112_0013365
454 Ga0496112_0031925
455 Ga0496112_0040660
456 Ga0496112_0133670
457 Ga0496113_0000346
458 Ga0496113_0033649
459 Ga0496114_0102109
460 Ga0496115_0000948
461 Ga0496115_0008562
462 Ga0496115_0019315
463 Ga0496115_0083233
464 Ga0496115_0095643
465 Ga0496115_0117047
466 Ga0501032_0019754
467 Ga0501033_0004074
468 Ga0501036_0002532
469 Ga0501037_0002486
470 Ga0501038_0001419
471 Ga0501039_0003332
472 Ga0501043_0012498
473 Ga0501047_0027027
474 Ga0501048_0024049
475 Ga0501068_0000820
476 Ga0501069_0002228
477 Ga0501070_0006828
478 Ga0501073_0014319
479 Ga0501074_0005250
480 Ga0501080_0062674
481 Ga0501081_0012568
482 Ga0501083_0013992
483 Ga0501035_0005485
484 Ga0501044_0040256
485 Ga0501045_0080304
486 nmdc:mga05p37_203498_c1
487 nmdc:mga05p37_260919_c1
488 nmdc:mga06r32_18202_c1
489 nmdc:mga08y16_21873_c1
490 nmdc:mga0n895_35339_c1
491 nmdc:mga0rr50_6327_c1
492 nmdc:mga0rr50_70166_c1
493 nmdc:mga08x19_16128_c1
494 nmdc:mga0a205_42436_c1
495 Ga0495601_0020793
496 Ga0495595_0004034
497 Ga0495595_0028075
498 Ga0495619_0043636
499 Ga0466962_0006719
500 Ga0466962_0010539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02785

Biotin_carb_C

Biotin carboxylase C-terminal domain

322

426

0.99

PF00289

Biotin_carb_N

Biotin carboxylase, N-terminal domain

9

112

0.97

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

474

541

0.97

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

117

313

0.95

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

124

281

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vr1-assembly1.cif.gz_A crystal structure of biotin carboxylase from e. coli in complex with atp analog, adpcf2p. 0.9609 1 400
3g8d-assembly2.cif.gz_B crystal structure of the biotin carboxylase subunit, e296a mutant, of acetyl-coa carboxylase from escherichia coli 0.9608 2 400
4mv3-assembly1.cif.gz_A crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and bicarbonate 0.9585 1 400
4mv4-assembly1.cif.gz_A crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and mg2 0.9558 1 400
2j9g-assembly1.cif.gz_A crystal structure of biotin carboxylase from e. coli in complex with amppnp and adp 0.9555 1 400
ID Description Score Start End Superfamily
af_A0A2R8PV58_229_474_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9766 167 400 3.30.470.20
2qf7B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9761 1 124 3.40.50.20
af_P9WPQ3_1_451_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9728 2 400 3.30.470.20
af_A0A2R8PV58_38_157_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9709 13 124 3.40.50.20
3bg5B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9695 1 93 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A7V2RXR3-F1-model_v4 Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.1) 0.9826 166 401 GO:0004736
GO:0005524
GO:0046872
AF-A0A3S1SN64-F1-model_v4 deleted 0.9799 175 401
AF-A0A0T6B7B5-F1-model_v4 Biotin carboxylation domain-containing protein 0.9797 192 401 GO:0004485
GO:0005524
GO:0005739
GO:0046872
AF-A0A7C7WBJ6-F1-model_v4 Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.1) 0.9784 166 401 GO:0004736
GO:0005524
GO:0046872
AF-A0A3Q0J2H8-F1-model_v4 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial isoform X1 0.9768 2 401 GO:0004485
GO:0005524
GO:0005739
GO:0046872

Map