F361320

General Info

Members Datasets Scaffolds Average Seq Length
250 144 500 340

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100004045|Ga0068869_1000040451
Length 401
Sequence MGSCRVFCTKYNAPPGVRDGDESFKMQCIGPRHGSSPWRVRTLEYRLMNDARPAAVAPPSAASALQFPFDHPPAPGTWYPVAPGVYWLRMPLPFALDHINLWVLHDGPGWTLIDSGLNSEVTRGLWDRLVESAFAGLPVQRLIVTHFHPDHFGLAGWLTRRFSVPLWMTESEYLATQVHCAQLAPVTRDAAIGLFTRHGLDAERQDALRQQKHSYSRAVSEPPSSFNRMLDGDTIMIDGRRWRVIVGYGHAPEHAALYCAEIDTLISGDMVLPKISTNVSVWPTEPDGDPLSLFLRSVARHAELPDRTLVLPSHGLPFYGLRARAAALHEHHRLRLDEVLTACTKPMSAADIVPVLFRRKLDTHQISFAMGEAIAHLNHLMYRNSVTRTSDADGVLRFERR

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 1.6
Rhizosphere 96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100004045 3300005334 Bacteria 9073
2 Ga0070676_10000712 3300005328 Bacteria 16253
3 Ga0070676_10001300 3300005328 Bacteria 12562
4 Ga0070690_100033098 3300005330 Bacteria 3233
5 Ga0070670_100029007 3300005331 Bacteria 4763
6 Ga0070670_100050670 3300005331 Bacteria 3567
7 Ga0070670_100132661 3300005331 Bacteria 2151
8 Ga0070670_100251752 3300005331 Bacteria 1539
9 Ga0070677_10001284 3300005333 Bacteria 8044
10 Ga0070666_10001057 3300005335 Bacteria 16820
11 Ga0070666_10020620 3300005335 Bacteria 4263
12 Ga0070666_10040916 3300005335 Bacteria 3095
13 Ga0070666_10136780 3300005335 Bacteria 1705
14 Ga0070680_100215536 3300005336 Bacteria 1620
15 Ga0068868_100001544 3300005338 Bacteria 15719
16 Ga0068868_100014904 3300005338 Bacteria 5739
17 Ga0068868_100027627 3300005338 Bacteria 4329
18 Ga0068868_100061785 3300005338 Bacteria 2968
19 Ga0070689_100123368 3300005340 Bacteria 2071
20 Ga0070661_100248078 3300005344 Bacteria 1373
21 Ga0070668_100004949 3300005347 Bacteria 9864
22 Ga0070668_100009226 3300005347 Bacteria 7316
23 Ga0070668_100033502 3300005347 Bacteria 3912
24 Ga0070668_100075597 3300005347 Bacteria 2630
25 Ga0070668_100148911 3300005347 Bacteria 1891
26 Ga0070668_100202692 3300005347 Bacteria 1629
27 Ga0070669_100001265 3300005353 Bacteria 18326
28 Ga0070675_100001972 3300005354 Bacteria 15193
29 Ga0070675_100006960 3300005354 Bacteria 8688
30 Ga0070675_100022372 3300005354 Bacteria 5051
31 Ga0070675_100168963 3300005354 Bacteria 1885
32 Ga0070671_100007839 3300005355 Bacteria 8533
33 Ga0070671_100012152 3300005355 Bacteria 6930
34 Ga0070674_100000214 3300005356 Bacteria 27901
35 Ga0070673_100001352 3300005364 Bacteria 14315
36 Ga0070673_100008590 3300005364 Bacteria 6801
37 Ga0070667_100001294 3300005367 Bacteria 22631
38 Ga0070667_100013862 3300005367 Bacteria 6663
39 Ga0070667_100070194 3300005367 Bacteria 2982
40 Ga0070705_100145756 3300005440 Bacteria 1564
41 Ga0070708_100000235 3300005445 Bacteria 41417
42 Ga0070663_100014822 3300005455 Bacteria 5012
43 Ga0070663_100184344 3300005455 Bacteria 1621
44 Ga0070678_100000115 3300005456 Bacteria 31495
45 Ga0070678_100001003 3300005456 Bacteria 14655
46 Ga0070678_100006065 3300005456 Bacteria 7051
47 Ga0070681_10012828 3300005458 Bacteria 8319
48 Ga0068867_100002089 3300005459 Bacteria 14000
49 Ga0068867_100061703 3300005459 Bacteria 2784
50 Ga0068867_100269198 3300005459 Bacteria 1392
51 Ga0070698_100253591 3300005471 Bacteria 1692
52 Ga0070679_100024369 3300005530 Bacteria 5929
53 Ga0070679_100218667 3300005530 Bacteria 1867
54 Ga0068853_100018526 3300005539 Bacteria 5765
55 Ga0068853_100042688 3300005539 Bacteria 3878
56 Ga0070672_100000912 3300005543 Bacteria 17711
57 Ga0070672_100024180 3300005543 Bacteria 4485
58 Ga0070672_100054473 3300005543 Bacteria 3131
59 Ga0070672_100189211 3300005543 Bacteria 1718
60 Ga0070672_100205332 3300005543 Bacteria 1648
61 Ga0070665_100004923 3300005548 Bacteria 13856
62 Ga0070665_100007004 3300005548 Bacteria 11456
63 Ga0070665_100042573 3300005548 Bacteria 4565
64 Ga0070665_100070823 3300005548 Bacteria 3493
65 Ga0070704_100132387 3300005549 Bacteria 1935
66 Ga0068855_100166819 3300005563 Bacteria 2496
67 Ga0070664_100019436 3300005564 Bacteria 5589
68 Ga0068857_100052243 3300005577 Bacteria 3626
69 Ga0068854_100231065 3300005578 Bacteria 1468
70 Ga0068852_100004365 3300005616 Bacteria 9989
71 Ga0068852_100115754 3300005616 Bacteria 2445
72 Ga0068859_100042467 3300005617 Bacteria 4567
73 Ga0068864_100117670 3300005618 Bacteria 2372
74 Ga0068861_100022615 3300005719 Bacteria 4532
75 Ga0068861_100026484 3300005719 Bacteria 4216
76 Ga0068861_100280297 3300005719 Bacteria 1435
77 Ga0068851_10000852 3300005834 Bacteria 13138
78 Ga0068870_10004825 3300005840 Bacteria 5829
79 Ga0068870_10142617 3300005840 Bacteria 1403
80 Ga0068863_100003845 3300005841 Bacteria 14849
81 Ga0068863_100016683 3300005841 Bacteria 7047
82 Ga0068863_100071814 3300005841 Bacteria 3275
83 Ga0068858_100000652 3300005842 Bacteria 36211
84 Ga0068858_100021515 3300005842 Bacteria 6026
85 Ga0068860_100004322 3300005843 Bacteria 14523
86 Ga0068860_100020167 3300005843 Bacteria 6461
87 Ga0068860_100193280 3300005843 Bacteria 1970
88 Ga0068862_100085622 3300005844 Bacteria 2739
89 Ga0068862_100096275 3300005844 Bacteria 2583
90 Ga0081539_10011704 3300005985 Bacteria 6891
91 Ga0081539_10014903 3300005985 Bacteria 5705
92 Ga0075364_10000107 3300006051 Bacteria 33968
93 Ga0075364_10003664 3300006051 Bacteria 8760
94 Ga0097621_100002419 3300006237 Bacteria 12782
95 Ga0097621_100052908 3300006237 Bacteria 3308
96 Ga0068871_100001447 3300006358 Bacteria 15879
97 Ga0075428_100002569 3300006844 Bacteria 19722
98 Ga0075428_100248596 3300006844 Bacteria 1917
99 Ga0075431_100042079 3300006847 Bacteria 4711
100 Ga0075433_10182519 3300006852 Bacteria 1867
101 Ga0075434_100081028 3300006871 Bacteria 3243
102 Ga0075429_100008224 3300006880 Bacteria 9069
103 Ga0068865_100006132 3300006881 Bacteria 7333
104 Ga0097620_100042467 3300006931 Bacteria 4567
105 Ga0111539_10000584 3300009094 Bacteria 47005
106 Ga0105245_10437777 3300009098 Bacteria 1313
107 Ga0105241_10013840 3300009174 Bacteria 5909
108 Ga0105248_10016858 3300009177 Bacteria 8040
109 Ga0105248_10108608 3300009177 Bacteria 3128
110 Ga0105248_10144636 3300009177 Bacteria 2683
111 Ga0105237_10136378 3300009545 Bacteria 2448
112 Ga0105238_10084510 3300009551 Bacteria 3163
113 Ga0105239_10167079 3300010375 Bacteria 2460
114 Ga0105239_10282751 3300010375 Bacteria 1868
115 Ga0157374_10002810 3300013296 Bacteria 14607
116 Ga0163162_10003799 3300013306 Bacteria 14485
117 Ga0163162_10248995 3300013306 Bacteria 1909
118 Ga0157372_10033179 3300013307 Bacteria 5668
119 Ga0157375_10010538 3300013308 Bacteria 8138
120 Ga0157375_10061831 3300013308 Bacteria 3719
121 Ga0157375_10063062 3300013308 Bacteria 3685
122 Ga0157375_10070998 3300013308 Bacteria 3494
123 Ga0157375_10081017 3300013308 Bacteria 3285
124 Ga0157380_10093814 3300014326 Bacteria 2483
125 Ga0157379_10001372 3300014968 Bacteria 19928
126 Ga0157376_10005256 3300014969 Bacteria 9041
127 Ga0207697_10010959 3300025315 Bacteria 3849
128 Ga0207656_10001065 3300025321 Bacteria 8975
129 Ga0207682_10000243 3300025893 Bacteria 24690
130 Ga0207642_10027568 3300025899 Bacteria 2326
131 Ga0207680_10011110 3300025903 Bacteria 4536
132 Ga0207680_10014882 3300025903 Bacteria 4043
133 Ga0207645_10000045 3300025907 Bacteria 85310
134 Ga0207645_10004371 3300025907 Bacteria 10463
135 Ga0207643_10010803 3300025908 Bacteria 4925
136 Ga0207684_10075645 3300025910 Bacteria 2862
137 Ga0207654_10034593 3300025911 Bacteria 2808
138 Ga0207707_10032709 3300025912 Bacteria 4552
139 Ga0207652_10029409 3300025921 Bacteria 4593
140 Ga0207652_10132687 3300025921 Bacteria 2222
141 Ga0207646_10112888 3300025922 Bacteria 2439
142 Ga0207681_10014688 3300025923 Bacteria 4875
143 Ga0207681_10142449 3300025923 Bacteria 1787
144 Ga0207650_10023582 3300025925 Bacteria 4365
145 Ga0207650_10038562 3300025925 Bacteria 3490
146 Ga0207650_10071866 3300025925 Bacteria 2604
147 Ga0207650_10079215 3300025925 Bacteria 2488
148 Ga0207659_10003587 3300025926 Bacteria 9344
149 Ga0207659_10077596 3300025926 Bacteria 2445
150 Ga0207659_10084785 3300025926 Bacteria 2352
151 Ga0207644_10009113 3300025931 Bacteria 6507
152 Ga0207644_10048402 3300025931 Bacteria 3039
153 Ga0207644_10082177 3300025931 Bacteria 2383
154 Ga0207670_10071537 3300025936 Bacteria 2399
155 Ga0207669_10005178 3300025937 Bacteria 5819
156 Ga0207669_10041242 3300025937 Bacteria 2685
157 Ga0207704_10013183 3300025938 Bacteria 4129
158 Ga0207691_10000452 3300025940 Bacteria 40569
159 Ga0207691_10000688 3300025940 Bacteria 33404
160 Ga0207691_10206474 3300025940 Bacteria 1708
161 Ga0207711_10070001 3300025941 Bacteria 3042
162 Ga0207711_10174863 3300025941 Bacteria 1950
163 Ga0207689_10007226 3300025942 Bacteria 9755
164 Ga0207679_10012520 3300025945 Bacteria 5532
165 Ga0207679_10051462 3300025945 Bacteria 3015
166 Ga0207679_10220790 3300025945 Bacteria 1594
167 Ga0207651_10014476 3300025960 Bacteria 4557
168 Ga0207668_10003591 3300025972 Bacteria 9113
169 Ga0207668_10003948 3300025972 Bacteria 8740
170 Ga0207668_10041361 3300025972 Bacteria 3115
171 Ga0207658_10018860 3300025986 Bacteria 4770
172 Ga0207677_10007464 3300026023 Bacteria 6053
173 Ga0207677_10020626 3300026023 Bacteria 4005
174 Ga0207677_10040850 3300026023 Bacteria 3062
175 Ga0207677_10101007 3300026023 Bacteria 2122
176 Ga0207703_10007334 3300026035 Bacteria 8766
177 Ga0207703_10059955 3300026035 Bacteria 3109
178 Ga0207639_10013095 3300026041 Bacteria 5792
179 Ga0207639_10017646 3300026041 Bacteria 5060
180 Ga0207678_10026372 3300026067 Bacteria 5070
181 Ga0207678_10083286 3300026067 Bacteria 2736
182 Ga0207678_10251321 3300026067 Bacteria 1514
183 Ga0207708_10042993 3300026075 Bacteria 3443
184 Ga0207641_10026776 3300026088 Bacteria 4760
185 Ga0207641_10048596 3300026088 Bacteria 3581
186 Ga0207641_10170704 3300026088 Bacteria 1985
187 Ga0207641_10211557 3300026088 Bacteria 1794
188 Ga0207648_10000048 3300026089 Bacteria 109946
189 Ga0207648_10011011 3300026089 Bacteria 8540
190 Ga0207676_10114171 3300026095 Bacteria 2265
191 Ga0207676_10132755 3300026095 Bacteria 2120
192 Ga0207676_10142486 3300026095 Bacteria 2054
193 Ga0207674_10050586 3300026116 Bacteria 4244
194 Ga0207675_100018180 3300026118 Bacteria 6554
195 Ga0207675_100041823 3300026118 Bacteria 4279
196 Ga0207683_10000003 3300026121 Bacteria 191866
197 Ga0207683_10000258 3300026121 Bacteria 47224
198 Ga0207683_10046354 3300026121 Bacteria 3804
199 Ga0207698_10010585 3300026142 Bacteria 5938
200 Ga0209971_1000595 3300027682 Bacteria 9408
201 Ga0209974_10004011 3300027876 Bacteria 5265
202 Ga0209974_10032160 3300027876 Bacteria 1738
203 Ga0207428_10030228 3300027907 Bacteria 4480
204 Ga0268266_10006464 3300028379 Bacteria 10727
205 Ga0268266_10009923 3300028379 Bacteria 8364
206 Ga0268266_10019156 3300028379 Bacteria 5828
207 Ga0268266_10019821 3300028379 Bacteria 5731
208 Ga0268265_10058209 3300028380 Bacteria 2949
209 Ga0268265_10069631 3300028380 Bacteria 2733
210 Ga0268264_10132309 3300028381 Bacteria 2213
211 Ga0307409_100142510 3300031995 Bacteria 2067
212 Ga0373932_0040501 3300035112 Bacteria 1342
213 Ga0373924_0007290 3300035410 Bacteria 3988
214 Ga0373937_0159474 3300036401 Bacteria 2115
215 Ga0436365_0192195 3300039437 Bacteria 2659
216 Ga0451807_1393720 3300041486 Bacteria 1118
217 Ga0451577_0096949 3300042876 Bacteria 2633
218 Ga0453684_0167860 3300044712 Bacteria 2589
219 Ga0451576_0013051 3300045051 Bacteria 9305
220 Ga0451576_0014064 3300045051 Bacteria 8918
221 Ga0451576_0134971 3300045051 Bacteria 2573
222 Ga0495580_0058852 3300046472 Bacteria 2701
223 Ga0496108_0305163 3300048911 Bacteria 1387
224 Ga0496110_0072351 3300048913 Bacteria 3059
225 Ga0496110_0189437 3300048913 Bacteria 1868
226 Ga0501033_0074093 3300049570 Bacteria 2499
227 Ga0501036_0449908 3300049572 Bacteria 1073
228 Ga0501038_0030712 3300049574 Bacteria 4750
229 Ga0501043_0154575 3300049579 Bacteria 1794
230 Ga0501047_0039233 3300049581 Bacteria 4581
231 Ga0501067_0005136 3300049583 Bacteria 7274
232 Ga0501068_0000960 3300049584 Bacteria 15139
233 Ga0501073_0001375 3300049589 Bacteria 17975
234 Ga0501073_0124169 3300049589 Bacteria 1789
235 Ga0501080_0001249 3300049742 Bacteria 21171
236 Ga0501080_0026270 3300049742 Bacteria 5410
237 Ga0501080_0103798 3300049742 Bacteria 2636
238 Ga0501081_0094436 3300049743 Bacteria 2107
239 Ga0501083_0054401 3300049744 Bacteria 2686
240 Ga0501035_0073219 3300049822 Bacteria 3031
241 Ga0501044_0005620 3300049823 Bacteria 13926
242 nmdc:mga00v17_2298_c2 3300050491 Bacteria 8638
243 nmdc:mga00v17_43617_c1 3300050491 Bacteria 2702
244 nmdc:mga09592_3141_c1 3300050508 Bacteria 13413
245 nmdc:mga06r32_234095_c1 3300050510 Bacteria 1825
246 nmdc:mga06r32_294148_c1 3300050510 Bacteria 1610
247 nmdc:mga08y16_151454_c1 3300050511 Bacteria 2411
248 nmdc:mga0rr50_55087_c1 3300050513 Bacteria 2965
249 nmdc:mga0a205_203587_c1 3300050515 Bacteria 1869
250 2526212475 2526164512 Bacteria 4025691
251 Ga0068869_100004045
252 Ga0070676_10000712
253 Ga0070676_10001300
254 Ga0070690_100033098
255 Ga0070670_100029007
256 Ga0070670_100050670
257 Ga0070670_100132661
258 Ga0070670_100251752
259 Ga0070677_10001284
260 Ga0070666_10001057
261 Ga0070666_10020620
262 Ga0070666_10040916
263 Ga0070666_10136780
264 Ga0070680_100215536
265 Ga0068868_100001544
266 Ga0068868_100014904
267 Ga0068868_100027627
268 Ga0068868_100061785
269 Ga0070689_100123368
270 Ga0070661_100248078
271 Ga0070668_100004949
272 Ga0070668_100009226
273 Ga0070668_100033502
274 Ga0070668_100075597
275 Ga0070668_100148911
276 Ga0070668_100202692
277 Ga0070669_100001265
278 Ga0070675_100001972
279 Ga0070675_100006960
280 Ga0070675_100022372
281 Ga0070675_100168963
282 Ga0070671_100007839
283 Ga0070671_100012152
284 Ga0070674_100000214
285 Ga0070673_100001352
286 Ga0070673_100008590
287 Ga0070667_100001294
288 Ga0070667_100013862
289 Ga0070667_100070194
290 Ga0070705_100145756
291 Ga0070708_100000235
292 Ga0070663_100014822
293 Ga0070663_100184344
294 Ga0070678_100000115
295 Ga0070678_100001003
296 Ga0070678_100006065
297 Ga0070681_10012828
298 Ga0068867_100002089
299 Ga0068867_100061703
300 Ga0068867_100269198
301 Ga0070698_100253591
302 Ga0070679_100024369
303 Ga0070679_100218667
304 Ga0068853_100018526
305 Ga0068853_100042688
306 Ga0070672_100000912
307 Ga0070672_100024180
308 Ga0070672_100054473
309 Ga0070672_100189211
310 Ga0070672_100205332
311 Ga0070665_100004923
312 Ga0070665_100007004
313 Ga0070665_100042573
314 Ga0070665_100070823
315 Ga0070704_100132387
316 Ga0068855_100166819
317 Ga0070664_100019436
318 Ga0068857_100052243
319 Ga0068854_100231065
320 Ga0068852_100004365
321 Ga0068852_100115754
322 Ga0068859_100042467
323 Ga0068864_100117670
324 Ga0068861_100022615
325 Ga0068861_100026484
326 Ga0068861_100280297
327 Ga0068851_10000852
328 Ga0068870_10004825
329 Ga0068870_10142617
330 Ga0068863_100003845
331 Ga0068863_100016683
332 Ga0068863_100071814
333 Ga0068858_100000652
334 Ga0068858_100021515
335 Ga0068860_100004322
336 Ga0068860_100020167
337 Ga0068860_100193280
338 Ga0068862_100085622
339 Ga0068862_100096275
340 Ga0081539_10011704
341 Ga0081539_10014903
342 Ga0075364_10000107
343 Ga0075364_10003664
344 Ga0097621_100002419
345 Ga0097621_100052908
346 Ga0068871_100001447
347 Ga0075428_100002569
348 Ga0075428_100248596
349 Ga0075431_100042079
350 Ga0075433_10182519
351 Ga0075434_100081028
352 Ga0075429_100008224
353 Ga0068865_100006132
354 Ga0097620_100042467
355 Ga0111539_10000584
356 Ga0105245_10437777
357 Ga0105241_10013840
358 Ga0105248_10016858
359 Ga0105248_10108608
360 Ga0105248_10144636
361 Ga0105237_10136378
362 Ga0105238_10084510
363 Ga0105239_10167079
364 Ga0105239_10282751
365 Ga0157374_10002810
366 Ga0163162_10003799
367 Ga0163162_10248995
368 Ga0157372_10033179
369 Ga0157375_10010538
370 Ga0157375_10061831
371 Ga0157375_10063062
372 Ga0157375_10070998
373 Ga0157375_10081017
374 Ga0157380_10093814
375 Ga0157379_10001372
376 Ga0157376_10005256
377 Ga0207697_10010959
378 Ga0207656_10001065
379 Ga0207682_10000243
380 Ga0207642_10027568
381 Ga0207680_10011110
382 Ga0207680_10014882
383 Ga0207645_10000045
384 Ga0207645_10004371
385 Ga0207643_10010803
386 Ga0207684_10075645
387 Ga0207654_10034593
388 Ga0207707_10032709
389 Ga0207652_10029409
390 Ga0207652_10132687
391 Ga0207646_10112888
392 Ga0207681_10014688
393 Ga0207681_10142449
394 Ga0207650_10023582
395 Ga0207650_10038562
396 Ga0207650_10071866
397 Ga0207650_10079215
398 Ga0207659_10003587
399 Ga0207659_10077596
400 Ga0207659_10084785
401 Ga0207644_10009113
402 Ga0207644_10048402
403 Ga0207644_10082177
404 Ga0207670_10071537
405 Ga0207669_10005178
406 Ga0207669_10041242
407 Ga0207704_10013183
408 Ga0207691_10000452
409 Ga0207691_10000688
410 Ga0207691_10206474
411 Ga0207711_10070001
412 Ga0207711_10174863
413 Ga0207689_10007226
414 Ga0207679_10012520
415 Ga0207679_10051462
416 Ga0207679_10220790
417 Ga0207651_10014476
418 Ga0207668_10003591
419 Ga0207668_10003948
420 Ga0207668_10041361
421 Ga0207658_10018860
422 Ga0207677_10007464
423 Ga0207677_10020626
424 Ga0207677_10040850
425 Ga0207677_10101007
426 Ga0207703_10007334
427 Ga0207703_10059955
428 Ga0207639_10013095
429 Ga0207639_10017646
430 Ga0207678_10026372
431 Ga0207678_10083286
432 Ga0207678_10251321
433 Ga0207708_10042993
434 Ga0207641_10026776
435 Ga0207641_10048596
436 Ga0207641_10170704
437 Ga0207641_10211557
438 Ga0207648_10000048
439 Ga0207648_10011011
440 Ga0207676_10114171
441 Ga0207676_10132755
442 Ga0207676_10142486
443 Ga0207674_10050586
444 Ga0207675_100018180
445 Ga0207675_100041823
446 Ga0207683_10000003
447 Ga0207683_10000258
448 Ga0207683_10046354
449 Ga0207698_10010585
450 Ga0209971_1000595
451 Ga0209974_10004011
452 Ga0209974_10032160
453 Ga0207428_10030228
454 Ga0268266_10006464
455 Ga0268266_10009923
456 Ga0268266_10019156
457 Ga0268266_10019821
458 Ga0268265_10058209
459 Ga0268265_10069631
460 Ga0268264_10132309
461 Ga0307409_100142510
462 Ga0373932_0040501
463 Ga0373924_0007290
464 Ga0373937_0159474
465 Ga0436365_0192195
466 Ga0451807_1393720
467 Ga0451577_0096949
468 Ga0453684_0167860
469 Ga0451576_0013051
470 Ga0451576_0014064
471 Ga0451576_0134971
472 Ga0495580_0058852
473 Ga0496108_0305163
474 Ga0496110_0072351
475 Ga0496110_0189437
476 Ga0501033_0074093
477 Ga0501036_0449908
478 Ga0501038_0030712
479 Ga0501043_0154575
480 Ga0501047_0039233
481 Ga0501067_0005136
482 Ga0501068_0000960
483 Ga0501073_0001375
484 Ga0501073_0124169
485 Ga0501080_0001249
486 Ga0501080_0026270
487 Ga0501080_0103798
488 Ga0501081_0094436
489 Ga0501083_0054401
490 Ga0501035_0073219
491 Ga0501044_0005620
492 nmdc:mga00v17_2298_c2
493 nmdc:mga00v17_43617_c1
494 nmdc:mga09592_3141_c1
495 nmdc:mga06r32_234095_c1
496 nmdc:mga06r32_294148_c1
497 nmdc:mga08y16_151454_c1
498 nmdc:mga0rr50_55087_c1
499 nmdc:mga0a205_203587_c1
500 2526212475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21221

B_lactamase-like_C

Metallo-beta-lactamase-like, C-terminal domain

342

386

0.97

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

95

314

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u8o-assembly1.cif.gz_B crystal structure of beta-lactamase domain protein, from burkholderia multivorans 0.9435 1 316
6ao1-assembly2.cif.gz_B crystal structure of a beta-lactamase from burkholderia phymatum 0.9355 1 314
5u8o-assembly1.cif.gz_B crystal structure of beta-lactamase domain protein, from burkholderia multivorans 0.9348 1 316
5u8o-assembly2.cif.gz_D crystal structure of beta-lactamase domain protein, from burkholderia multivorans 0.934 1 316
6ao1-assembly3.cif.gz_C crystal structure of a beta-lactamase from burkholderia phymatum 0.932 1 314
ID Description Score Start End Superfamily
2zo4A01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8811 2 250 3.60.15.10
af_Q99KR3_205_288_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8538 233 316 1.10.10.10
af_Q9VLS9_206_284_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8519 235 311 1.10.10.10
4ad9A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8499 233 316 1.10.10.10
af_Q6NYF0_205_289_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8406 233 314 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W0X051-F1-model_v4 MBL fold metallo-hydrolase 0.9919 1 269 GO:0016787
AF-A0A2V6TKE1-F1-model_v4 MBL fold metallo-hydrolase 0.9863 1 82 GO:0016787
AF-A0A7V7WSG5-F1-model_v4 MBL fold metallo-hydrolase 0.986 1 315 GO:0016787
GO:0046872
AF-N6XN16-F1-model_v4 Beta-lactamase 0.9857 1 316 GO:0016787
GO:0046872
AF-A0A2I6S3J9-F1-model_v4 Zn-dependent hydrolase 0.9837 1 318 GO:0016787
GO:0046872

Map