F361316

General Info

Members Datasets Scaffolds Average Seq Length
250 154 500 175

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100565777|Ga0070670_1005657771
Length 186
Sequence MGSGRSPEGALMADGRSHAYAEALLAVARAEGALADVSDELFRFARVLETNDELRTTLTDQQLPVSRRQQIVEDLLGGRAHPITTTLVSMVVGAGRARDLPAIIDDLVDLSAAEGNKELAEVRSAVPLTDDQQQRLAAALEAATGKKVELKVIVDPTVLGGLVAQVGDTVIDGSVRSRLAQLQTAF

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
88 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
94 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
95 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
96 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
99 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0
Rhizoplane 14.4
Rhizosphere 81.6
Stem 0
Stem Tuber 0
Unclassified 2.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100565777 3300005331 Bacteria 1015
2 Ga0070683_100642362 3300005329 Bacteria 1016
3 Ga0070690_100055325 3300005330 Bacteria 2541
4 Ga0068868_100252900 3300005338 Bacteria 1483
5 Ga0068868_100404997 3300005338 Bacteria 1178
6 Ga0068868_100455782 3300005338 Bacteria 1113
7 Ga0070687_100016934 3300005343 Bacteria 3339
8 Ga0070661_101089825 3300005344 Bacteria 665
9 Ga0070668_100363460 3300005347 Bacteria 1228
10 Ga0070669_100138694 3300005353 Bacteria 1873
11 Ga0070674_100153170 3300005356 Bacteria 1741
12 Ga0070688_100036879 3300005365 Bacteria 2976
13 Ga0070667_101469636 3300005367 Bacteria 640
14 Ga0070703_10201567 3300005406 Bacteria 781
15 Ga0070700_100099085 3300005441 Bacteria 1917
16 Ga0070678_100537340 3300005456 Bacteria 1036
17 Ga0070681_10087258 3300005458 Bacteria 3073
18 Ga0068867_100005274 3300005459 Bacteria 9132
19 Ga0070698_100698786 3300005471 Bacteria 956
20 Ga0068853_100182588 3300005539 Bacteria 1903
21 Ga0068853_100772842 3300005539 Bacteria 919
22 Ga0070672_100287489 3300005543 Bacteria 1391
23 Ga0070695_101180773 3300005545 Bacteria 629
24 Ga0070702_100099617 3300005615 Bacteria 1780
25 Ga0068852_100271217 3300005616 Bacteria 1633
26 Ga0068852_100951659 3300005616 Bacteria 877
27 Ga0068859_100582971 3300005617 Bacteria 1212
28 Ga0068866_10002295 3300005718 Bacteria 7921
29 Ga0068861_101415754 3300005719 Unclassified 679
30 Ga0068858_101017374 3300005842 Bacteria 812
31 Ga0068862_100260584 3300005844 Bacteria 1583
32 Ga0081539_10005377 3300005985 Bacteria 13109
33 Ga0075367_10356854 3300006178 Bacteria 923
34 Ga0075366_10111488 3300006195 Bacteria 1645
35 Ga0097621_100392291 3300006237 Bacteria 1242
36 Ga0075428_100008954 3300006844 Bacteria 11106
37 Ga0075428_100073887 3300006844 Bacteria 3724
38 Ga0075428_100395004 3300006844 Bacteria 1482
39 Ga0075430_100024024 3300006846 Bacteria 5190
40 Ga0075430_100207422 3300006846 Bacteria 1626
41 Ga0075430_100887285 3300006846 Bacteria 735
42 Ga0075431_100069659 3300006847 Bacteria 3629
43 Ga0075431_100450071 3300006847 Bacteria 1283
44 Ga0075431_100555282 3300006847 Bacteria 1135
45 Ga0075434_100830019 3300006871 Bacteria 940
46 Ga0075429_100021738 3300006880 Bacteria 5563
47 Ga0075429_100205743 3300006880 Bacteria 1724
48 Ga0075429_100751007 3300006880 Bacteria 854
49 Ga0068865_100179913 3300006881 Bacteria 1628
50 Ga0097620_100582875 3300006931 Bacteria 1212
51 Ga0105251_10104319 3300009011 Bacteria 1295
52 Ga0111539_10335886 3300009094 Bacteria 1759
53 Ga0111539_10353425 3300009094 Bacteria 1710
54 Ga0111539_10416515 3300009094 Bacteria 1565
55 Ga0111539_11009344 3300009094 Bacteria 967
56 Ga0105245_10005104 3300009098 Bacteria 11544
57 Ga0105245_10374122 3300009098 Bacteria 1417
58 Ga0105245_10536407 3300009098 Bacteria 1191
59 Ga0114129_10008597 3300009147 Bacteria 14561
60 Ga0114129_10016666 3300009147 Bacteria 10464
61 Ga0114129_10044455 3300009147 Bacteria 6248
62 Ga0105243_10041847 3300009148 Bacteria 3584
63 Ga0105242_10023019 3300009176 Bacteria 4908
64 Ga0105248_10375461 3300009177 Bacteria 1601
65 Ga0105249_10133991 3300009553 Bacteria 2369
66 Ga0157378_10049277 3300013297 Bacteria 3747
67 Ga0157378_10126947 3300013297 Bacteria 2357
68 Ga0157375_10067378 3300013308 Bacteria 3577
69 Ga0157375_10580476 3300013308 Bacteria 1281
70 Ga0163163_10057215 3300014325 Bacteria 3855
71 Ga0163163_10429166 3300014325 Bacteria 1381
72 Ga0163163_12033041 3300014325 Bacteria 634
73 Ga0157380_10632433 3300014326 Bacteria 1064
74 Ga0157379_10118824 3300014968 Bacteria 2378
75 Ga0157379_10262916 3300014968 Bacteria 1568
76 Ga0157379_10360808 3300014968 Bacteria 1332
77 Ga0157376_10200760 3300014969 Bacteria 1835
78 Ga0163161_10362508 3300017792 Bacteria 1155
79 Ga0207697_10111919 3300025315 Bacteria 1170
80 Ga0207642_10015414 3300025899 Bacteria 2847
81 Ga0207688_10026410 3300025901 Bacteria 3192
82 Ga0207645_10430804 3300025907 Bacteria 889
83 Ga0207649_10953958 3300025920 Bacteria 674
84 Ga0207650_10500047 3300025925 Bacteria 1016
85 Ga0207659_10403363 3300025926 Bacteria 1144
86 Ga0207687_10000840 3300025927 Bacteria 20775
87 Ga0207687_10143884 3300025927 Bacteria 1812
88 Ga0207687_10392751 3300025927 Bacteria 1139
89 Ga0207644_10735403 3300025931 Bacteria 824
90 Ga0207706_10187019 3300025933 Bacteria 1819
91 Ga0207686_10015332 3300025934 Bacteria 4284
92 Ga0207709_10011292 3300025935 Bacteria 4927
93 Ga0207670_10162186 3300025936 Bacteria 1669
94 Ga0207691_10128403 3300025940 Bacteria 2241
95 Ga0207712_10081219 3300025961 Bacteria 2360
96 Ga0207640_10174787 3300025981 Bacteria 1604
97 Ga0207677_10303992 3300026023 Bacteria 1319
98 Ga0207703_10110264 3300026035 Bacteria 2347
99 Ga0207703_10214337 3300026035 Bacteria 1718
100 Ga0207639_10171853 3300026041 Bacteria 1836
101 Ga0207678_11240331 3300026067 Bacteria 660
102 Ga0207708_10025856 3300026075 Bacteria 4442
103 Ga0207708_10165019 3300026075 Bacteria 1751
104 Ga0207648_10018524 3300026089 Bacteria 6301
105 Ga0207676_10348066 3300026095 Bacteria 1370
106 Ga0207676_10466164 3300026095 Bacteria 1194
107 Ga0207674_10675142 3300026116 Bacteria 997
108 Ga0207675_100501934 3300026118 Bacteria 1208
109 Ga0207675_100535434 3300026118 Bacteria 1169
110 Ga0207683_10851980 3300026121 Bacteria 846
111 Ga0207428_10072655 3300027907 Bacteria 2700
112 Ga0268266_10534097 3300028379 Bacteria 1122
113 Ga0268265_10709724 3300028380 Unclassified 972
114 Ga0268264_10156084 3300028381 Bacteria 2051
115 Ga0265338_10081714 3300028800 Bacteria 2708
116 Ga0316576_10005282 3300031727 Bacteria 7866
117 Ga0316576_10049548 3300031727 Bacteria 3051
118 Ga0316576_10098197 3300031727 Bacteria 2187
119 Ga0307405_10399932 3300031731 Bacteria 1075
120 Ga0316583_10023156 3300032133 Bacteria 2221
121 Ga0316596_1027962 3300033541 Bacteria 1457
122 Ga0316574_0120776 3300035398 Bacteria 1683
123 Ga0316574_0172259 3300035398 Bacteria 1393
124 Ga0316574_0245835 3300035398 Bacteria 1143
125 Ga0316582_0996650 3300036647 Bacteria 572
126 Ga0316584_0084275 3300036712 Bacteria 2381
127 Ga0395899_0501868 3300037312 Bacteria 787
128 Ga0439439_0048955 3300041406 Bacteria 1106
129 Ga0439466_0102552 3300041411 Bacteria 891
130 Ga0451797_1231408 3300041453 Bacteria 590
131 Ga0451843_1561521 3300041509 Bacteria 792
132 Ga0451853_1589692 3300041512 Unclassified 988
133 Ga0439463_008822 3300042016 Bacteria 2481
134 Ga0439434_0014033 3300042435 Bacteria 2382
135 Ga0451577_0001613 3300042876 Bacteria 29346
136 Ga0453684_0903704 3300044712 Bacteria 945
137 Ga0466967_0816079 3300045976 Bacteria 926
138 Ga0496100_0130681 3300048903 Bacteria 1768
139 Ga0496101_0026438 3300048904 Bacteria 4036
140 Ga0496101_0414016 3300048904 Bacteria 1062
141 Ga0496102_0084297 3300048905 Bacteria 2933
142 Ga0496102_0417266 3300048905 Bacteria 1261
143 Ga0496103_0026219 3300048906 Bacteria 3529
144 Ga0496103_0800660 3300048906 Bacteria 594
145 Ga0496104_0017186 3300048907 Bacteria 6580
146 Ga0496104_0870561 3300048907 Bacteria 806
147 Ga0496105_0050197 3300048908 Bacteria 3446
148 Ga0496105_0197648 3300048908 Bacteria 1642
149 Ga0496105_0459614 3300048908 Bacteria 1004
150 Ga0496105_0944580 3300048908 Bacteria 648
151 Ga0496106_0077237 3300048909 Bacteria 2553
152 Ga0496106_0906651 3300048909 Bacteria 696
153 Ga0496107_0761316 3300048910 Bacteria 710
154 Ga0496108_0072559 3300048911 Bacteria 2906
155 Ga0496108_0093363 3300048911 Bacteria 2560
156 Ga0496108_0159126 3300048911 Bacteria 1951
157 Ga0496109_0064933 3300048912 Bacteria 3341
158 Ga0496109_0119025 3300048912 Bacteria 2459
159 Ga0496109_0306183 3300048912 Bacteria 1499
160 Ga0496110_0040289 3300048913 Bacteria 4071
161 Ga0496110_0050980 3300048913 Bacteria 3636
162 Ga0496110_0053678 3300048913 Bacteria 3544
163 Ga0496110_0235046 3300048913 Bacteria 1667
164 Ga0496110_0480857 3300048913 Bacteria 1131
165 Ga0496111_0017718 3300048914 Bacteria 4926
166 Ga0496111_0017855 3300048914 Bacteria 4907
167 Ga0496111_0526782 3300048914 Bacteria 869
168 Ga0496114_0026480 3300048917 Bacteria 4747
169 Ga0496114_0093550 3300048917 Bacteria 2556
170 Ga0496114_0274229 3300048917 Bacteria 1486
171 Ga0496114_0577415 3300048917 Bacteria 992
172 Ga0496114_0729613 3300048917 Bacteria 867
173 Ga0501031_0049547 3300049568 Bacteria 2738
174 Ga0501031_0474632 3300049568 Unclassified 807
175 Ga0501034_0044468 3300049571 Bacteria 4492
176 Ga0501036_0221936 3300049572 Bacteria 1587
177 Ga0501038_0101744 3300049574 Bacteria 2392
178 Ga0501038_0103176 3300049574 Bacteria 2372
179 Ga0501039_0174330 3300049575 Bacteria 1691
180 Ga0501041_0071517 3300049577 Bacteria 2130
181 Ga0501042_0064879 3300049578 Bacteria 2610
182 Ga0501042_0073239 3300049578 Bacteria 2450
183 Ga0501042_0085212 3300049578 Bacteria 2266
184 Ga0501042_0177055 3300049578 Bacteria 1538
185 Ga0501043_0387820 3300049579 Bacteria 1057
186 Ga0501046_0391922 3300049580 Bacteria 1004
187 Ga0501046_0413391 3300049580 Bacteria 973
188 Ga0501048_0029208 3300049582 Bacteria 4000
189 Ga0501048_0067116 3300049582 Bacteria 2536
190 Ga0501048_0441239 3300049582 Bacteria 932
191 Ga0501067_0152992 3300049583 Bacteria 1285
192 Ga0501068_0062905 3300049584 Bacteria 2257
193 Ga0501068_0088650 3300049584 Bacteria 1906
194 Ga0501068_0870274 3300049584 Bacteria 592
195 Ga0501069_0090249 3300049585 Bacteria 1733
196 Ga0501070_0001076 3300049586 Bacteria 24470
197 Ga0501071_0054052 3300049587 Bacteria 2898
198 Ga0501071_0153362 3300049587 Bacteria 1719
199 Ga0501071_0247941 3300049587 Bacteria 1344
200 Ga0501072_0084406 3300049588 Bacteria 2518
201 Ga0501072_0130485 3300049588 Bacteria 2003
202 Ga0501072_1047080 3300049588 Bacteria 636
203 Ga0501073_0000908 3300049589 Bacteria 21287
204 Ga0501074_0197311 3300049590 Bacteria 1435
205 Ga0501075_0107374 3300049591 Bacteria 2122
206 Ga0501075_0202145 3300049591 Bacteria 1515
207 Ga0501075_0437617 3300049591 Bacteria 997
208 Ga0501075_0569836 3300049591 Bacteria 864
209 Ga0501076_0109342 3300049592 Bacteria 2234
210 Ga0501076_0263556 3300049592 Bacteria 1411
211 Ga0501076_0444468 3300049592 Unclassified 1067
212 Ga0501079_0037457 3300049741 Bacteria 3738
213 Ga0501079_0170512 3300049741 Bacteria 1697
214 Ga0501079_0336475 3300049741 Bacteria 1182
215 Ga0501080_0015388 3300049742 Bacteria 7051
216 Ga0501081_0243138 3300049743 Bacteria 1313
217 Ga0501081_0386069 3300049743 Bacteria 1035
218 Ga0501083_0008307 3300049744 Bacteria 7341
219 Ga0501044_0828728 3300049823 Bacteria 803
220 Ga0501045_0031046 3300049824 Bacteria 3869
221 Ga0501045_0070994 3300049824 Bacteria 2563
222 Ga0501045_0306672 3300049824 Bacteria 1182
223 nmdc:mga03n38_623023_c1 3300050490 Bacteria 616
224 nmdc:mga0yw44_216414_c1 3300050492 Bacteria 1268
225 nmdc:mga0yw44_82402_c1 3300050492 Bacteria 2018
226 nmdc:mga06z11_880805_c1 3300050494 Unclassified 545
227 nmdc:mga05p37_372814_c1 3300050507 Bacteria 1675
228 nmdc:mga09592_212889_c1 3300050508 Bacteria 1675
229 nmdc:mga0qj67_107422_c1 3300050509 Bacteria 2251
230 nmdc:mga0qj67_236379_c1 3300050509 Bacteria 1483
231 nmdc:mga0qj67_64471_c1 3300050509 Bacteria 2914
232 nmdc:mga0qj67_819959_c1 3300050509 Bacteria 736
233 nmdc:mga06r32_339023_c1 3300050510 Bacteria 1488
234 nmdc:mga06r32_60560_c1 3300050510 Bacteria 3644
235 nmdc:mga06r32_72152_c1 3300050510 Bacteria 3343
236 nmdc:mga08y16_1514653_c1 3300050511 Bacteria 631
237 nmdc:mga08y16_208401_c1 3300050511 Bacteria 2025
238 nmdc:mga08y16_89074_c1 3300050511 Bacteria 3216
239 Ga0500568_0058103 3300053139 Bacteria 1504
240 Ga0500616_0024413 3300053153 Bacteria 3359
241 Ga0501084_0003125 3300054114 Bacteria 13410
242 Ga0501084_0089145 3300054114 Bacteria 2589
243 Ga0501084_0176889 3300054114 Bacteria 1801
244 Ga0501084_0265551 3300054114 Bacteria 1449
245 Ga0501082_0123612 3300060353 Bacteria 2244
246 Ga0501082_0679364 3300060353 Bacteria 901
247 Ga0530510_0013749 3300061734 Bacteria 5698
248 Ga0530510_0196589 3300061734 Bacteria 1498
249 Ga0530510_0217134 3300061734 Bacteria 1421
250 Ga0530510_0348183 3300061734 Bacteria 1113
251 Ga0070670_100565777
252 Ga0070683_100642362
253 Ga0070690_100055325
254 Ga0068868_100252900
255 Ga0068868_100404997
256 Ga0068868_100455782
257 Ga0070687_100016934
258 Ga0070661_101089825
259 Ga0070668_100363460
260 Ga0070669_100138694
261 Ga0070674_100153170
262 Ga0070688_100036879
263 Ga0070667_101469636
264 Ga0070703_10201567
265 Ga0070700_100099085
266 Ga0070678_100537340
267 Ga0070681_10087258
268 Ga0068867_100005274
269 Ga0070698_100698786
270 Ga0068853_100182588
271 Ga0068853_100772842
272 Ga0070672_100287489
273 Ga0070695_101180773
274 Ga0070702_100099617
275 Ga0068852_100271217
276 Ga0068852_100951659
277 Ga0068859_100582971
278 Ga0068866_10002295
279 Ga0068861_101415754
280 Ga0068858_101017374
281 Ga0068862_100260584
282 Ga0081539_10005377
283 Ga0075367_10356854
284 Ga0075366_10111488
285 Ga0097621_100392291
286 Ga0075428_100008954
287 Ga0075428_100073887
288 Ga0075428_100395004
289 Ga0075430_100024024
290 Ga0075430_100207422
291 Ga0075430_100887285
292 Ga0075431_100069659
293 Ga0075431_100450071
294 Ga0075431_100555282
295 Ga0075434_100830019
296 Ga0075429_100021738
297 Ga0075429_100205743
298 Ga0075429_100751007
299 Ga0068865_100179913
300 Ga0097620_100582875
301 Ga0105251_10104319
302 Ga0111539_10335886
303 Ga0111539_10353425
304 Ga0111539_10416515
305 Ga0111539_11009344
306 Ga0105245_10005104
307 Ga0105245_10374122
308 Ga0105245_10536407
309 Ga0114129_10008597
310 Ga0114129_10016666
311 Ga0114129_10044455
312 Ga0105243_10041847
313 Ga0105242_10023019
314 Ga0105248_10375461
315 Ga0105249_10133991
316 Ga0157378_10049277
317 Ga0157378_10126947
318 Ga0157375_10067378
319 Ga0157375_10580476
320 Ga0163163_10057215
321 Ga0163163_10429166
322 Ga0163163_12033041
323 Ga0157380_10632433
324 Ga0157379_10118824
325 Ga0157379_10262916
326 Ga0157379_10360808
327 Ga0157376_10200760
328 Ga0163161_10362508
329 Ga0207697_10111919
330 Ga0207642_10015414
331 Ga0207688_10026410
332 Ga0207645_10430804
333 Ga0207649_10953958
334 Ga0207650_10500047
335 Ga0207659_10403363
336 Ga0207687_10000840
337 Ga0207687_10143884
338 Ga0207687_10392751
339 Ga0207644_10735403
340 Ga0207706_10187019
341 Ga0207686_10015332
342 Ga0207709_10011292
343 Ga0207670_10162186
344 Ga0207691_10128403
345 Ga0207712_10081219
346 Ga0207640_10174787
347 Ga0207677_10303992
348 Ga0207703_10110264
349 Ga0207703_10214337
350 Ga0207639_10171853
351 Ga0207678_11240331
352 Ga0207708_10025856
353 Ga0207708_10165019
354 Ga0207648_10018524
355 Ga0207676_10348066
356 Ga0207676_10466164
357 Ga0207674_10675142
358 Ga0207675_100501934
359 Ga0207675_100535434
360 Ga0207683_10851980
361 Ga0207428_10072655
362 Ga0268266_10534097
363 Ga0268265_10709724
364 Ga0268264_10156084
365 Ga0265338_10081714
366 Ga0316576_10005282
367 Ga0316576_10049548
368 Ga0316576_10098197
369 Ga0307405_10399932
370 Ga0316583_10023156
371 Ga0316596_1027962
372 Ga0316574_0120776
373 Ga0316574_0172259
374 Ga0316574_0245835
375 Ga0316582_0996650
376 Ga0316584_0084275
377 Ga0395899_0501868
378 Ga0439439_0048955
379 Ga0439466_0102552
380 Ga0451797_1231408
381 Ga0451843_1561521
382 Ga0451853_1589692
383 Ga0439463_008822
384 Ga0439434_0014033
385 Ga0451577_0001613
386 Ga0453684_0903704
387 Ga0466967_0816079
388 Ga0496100_0130681
389 Ga0496101_0026438
390 Ga0496101_0414016
391 Ga0496102_0084297
392 Ga0496102_0417266
393 Ga0496103_0026219
394 Ga0496103_0800660
395 Ga0496104_0017186
396 Ga0496104_0870561
397 Ga0496105_0050197
398 Ga0496105_0197648
399 Ga0496105_0459614
400 Ga0496105_0944580
401 Ga0496106_0077237
402 Ga0496106_0906651
403 Ga0496107_0761316
404 Ga0496108_0072559
405 Ga0496108_0093363
406 Ga0496108_0159126
407 Ga0496109_0064933
408 Ga0496109_0119025
409 Ga0496109_0306183
410 Ga0496110_0040289
411 Ga0496110_0050980
412 Ga0496110_0053678
413 Ga0496110_0235046
414 Ga0496110_0480857
415 Ga0496111_0017718
416 Ga0496111_0017855
417 Ga0496111_0526782
418 Ga0496114_0026480
419 Ga0496114_0093550
420 Ga0496114_0274229
421 Ga0496114_0577415
422 Ga0496114_0729613
423 Ga0501031_0049547
424 Ga0501031_0474632
425 Ga0501034_0044468
426 Ga0501036_0221936
427 Ga0501038_0101744
428 Ga0501038_0103176
429 Ga0501039_0174330
430 Ga0501041_0071517
431 Ga0501042_0064879
432 Ga0501042_0073239
433 Ga0501042_0085212
434 Ga0501042_0177055
435 Ga0501043_0387820
436 Ga0501046_0391922
437 Ga0501046_0413391
438 Ga0501048_0029208
439 Ga0501048_0067116
440 Ga0501048_0441239
441 Ga0501067_0152992
442 Ga0501068_0062905
443 Ga0501068_0088650
444 Ga0501068_0870274
445 Ga0501069_0090249
446 Ga0501070_0001076
447 Ga0501071_0054052
448 Ga0501071_0153362
449 Ga0501071_0247941
450 Ga0501072_0084406
451 Ga0501072_0130485
452 Ga0501072_1047080
453 Ga0501073_0000908
454 Ga0501074_0197311
455 Ga0501075_0107374
456 Ga0501075_0202145
457 Ga0501075_0437617
458 Ga0501075_0569836
459 Ga0501076_0109342
460 Ga0501076_0263556
461 Ga0501076_0444468
462 Ga0501079_0037457
463 Ga0501079_0170512
464 Ga0501079_0336475
465 Ga0501080_0015388
466 Ga0501081_0243138
467 Ga0501081_0386069
468 Ga0501083_0008307
469 Ga0501044_0828728
470 Ga0501045_0031046
471 Ga0501045_0070994
472 Ga0501045_0306672
473 nmdc:mga03n38_623023_c1
474 nmdc:mga0yw44_216414_c1
475 nmdc:mga0yw44_82402_c1
476 nmdc:mga06z11_880805_c1
477 nmdc:mga05p37_372814_c1
478 nmdc:mga09592_212889_c1
479 nmdc:mga0qj67_107422_c1
480 nmdc:mga0qj67_236379_c1
481 nmdc:mga0qj67_64471_c1
482 nmdc:mga0qj67_819959_c1
483 nmdc:mga06r32_339023_c1
484 nmdc:mga06r32_60560_c1
485 nmdc:mga06r32_72152_c1
486 nmdc:mga08y16_1514653_c1
487 nmdc:mga08y16_208401_c1
488 nmdc:mga08y16_89074_c1
489 Ga0500568_0058103
490 Ga0500616_0024413
491 Ga0501084_0003125
492 Ga0501084_0089145
493 Ga0501084_0176889
494 Ga0501084_0265551
495 Ga0501082_0123612
496 Ga0501082_0679364
497 Ga0530510_0013749
498 Ga0530510_0196589
499 Ga0530510_0217134
500 Ga0530510_0348183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00213

OSCP

ATP synthase delta (OSCP) subunit

17

186

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6re7-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 2c, focussed refinement of f1 head and rotor 0.8615 7 105
6rea-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 2d, focussed refinement of f1 head and rotor 0.8554 7 105
6rdp-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 1c, focussed refinement of f1 head and rotor 0.8546 7 105
6rde-assembly1.cif.gz_P cryoem structure of polytomella f-atp synthase, primary rotary state 2, focussed refinement of f1 head and rotor 0.8521 7 104
6rdv-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 1e, focussed refinement of f1 head and rotor 0.8501 7 105
ID Description Score Start End Superfamily
af_Q2FWE7_104_179_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.9742 107 175 3.30.2320.30
af_Q7JNG1_50_145_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.9345 7 97 1.10.520.20
af_Q96251_57_149_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.9196 8 97 1.10.520.20
af_Q84R40_123_196_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.9172 107 174 3.30.2320.30
af_Q5A7P7_25_119_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.9145 7 97 1.10.520.20
ID Description Score Start End GO Terms
AF-A0A537Z517-F1-model_v4 ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta) 0.9856 4 176 GO:0005886
GO:0045261
GO:0046933
AF-A0A382KS24-F1-model_v4 ATP synthase subunit delta 0.9694 9 174 GO:0016020
GO:0046933
AF-A0A537Z517-F1-model_v4 ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta) 0.9635 4 176 GO:0005886
GO:0045261
GO:0046933
AF-A0A351M0G9-F1-model_v4 ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta) 0.9627 2 175 GO:0005886
GO:0045261
GO:0046933
AF-A0A382KS24-F1-model_v4 ATP synthase subunit delta 0.9471 9 174 GO:0016020
GO:0046933

Map