F361213

General Info

Members Datasets Scaffolds Average Seq Length
249 196 160 401

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006425503|3006429701
Length 457
Sequence DTGASGVIRAGAPAPPSPRPSGFPVPPGSPRSSGDGAAPGPGRDRDPDATKLHPGGPGYRRLSFALFASGVATFALLYSTQALLPAVSAGLGVSPSAASWTVSGATLGLALAVLPLSALSERFGRRALMTASLTVATLLALAVPFVPDLGTLIALRTAQGVALAGVPASAMAFLAEEVRAKAVVGAIGLFVAGNSVGGMAGRVVTGWAAQLWGWRAALASAAALAVLCLLVFRLLVPRPAHFTPAPAGPRALLRTVRGHLRDPLLCRLYAIGALFMTVFGGVYTVIGYRLAAEPFGLPQGVAGSVFLIYLVGTVSSASSGRLAGRLGRRGALYVAVTTTAAGLLLTLVDALTAVLAGLVLVTAGFFAGHAVASSSVSRSARTGRAQASALYQAAYYIGSSAGGAVGAVAFHAAGWPGVVALGLTAVTAAAGITVYATRRALADRRCRAAHPAAYAGG

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
6 2643221548 Streptomyces sp. Root55 Isolate Unclassified
7 2643221578 Streptomyces sp. Root63 Isolate Unclassified
8 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
9 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
10 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
11 2643221647 Streptomyces sp. Root369 Isolate Unclassified
12 2643221670 Streptomyces sp. Root431 Isolate Unclassified
13 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
14 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
15 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
16 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
17 2643221714 Streptomyces sp. Root264 Isolate Unclassified
18 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
19 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
20 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
21 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
22 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
23 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
24 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
25 2808606448 Streptomyces sp. 193411 Isolate Unclassified
26 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
27 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
28 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
29 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
30 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
31 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
32 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
33 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
34 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
35 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
36 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
37 2862574272 Streptomyces sp. AcE210 Isolate Nodule
38 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
39 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
40 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
41 2867369537 Streptomyces sp. Z26 Isolate Unclassified
42 2867428634 Streptomyces sp. RP5T Isolate Unclassified
43 2867475112 Streptomyces sp. TM32 Isolate Unclassified
44 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
45 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
46 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
47 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
48 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
49 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
50 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
51 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
52 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
53 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
54 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
55 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
56 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
57 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
58 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
59 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
60 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
61 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
62 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
63 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
64 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
65 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
66 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
67 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
68 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
69 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
70 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
71 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
72 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
73 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
87 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
91 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
92 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
93 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
94 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
95 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
182 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
183 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
184 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
185 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
186 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
187 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
188 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
189 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
190 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
191 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
192 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
193 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
194 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
195 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
196 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 64.26
Metatranscriptomes 0
Isolates 35.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0.4
Rhizoplane 0.4
Rhizosphere 75.1
Stem 0
Stem Tuber 0
Unclassified 23.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100064856 3300005530 Bacteria 3641
2 Ga0207426_1002378 3300025302 Bacteria 12167
3 Ga0207652_10217931 3300025921 Bacteria 1719
4 Ga0307517_10002028 3300028786 Bacteria 32972
5 Ga0307515_10004007 3300028794 Bacteria 30745
6 Ga0307511_10000238 3300030521 Bacteria 56455
7 Ga0307511_10034728 3300030521 Bacteria 4419
8 Ga0307513_10048157 3300031456 Bacteria 4629
9 Ga0307509_10054408 3300031507 Bacteria 4262
10 Ga0307509_10076601 3300031507 Bacteria 3470
11 Ga0307509_10085994 3300031507 Bacteria 3234
12 Ga0307508_10041223 3300031616 Bacteria 4144
13 Ga0307514_10005225 3300031649 Bacteria 11690
14 Ga0307514_10072030 3300031649 Bacteria 2589
15 Ga0307516_10011234 3300031730 Bacteria 9759
16 Ga0307516_10015060 3300031730 Bacteria 8152
17 Ga0307516_10063677 3300031730 Bacteria 3569
18 Ga0307413_10219843 3300031824 Bacteria 1387
19 Ga0307518_10017622 3300031838 Bacteria 5120
20 Ga0307507_10019013 3300033179 Bacteria 7771
21 Ga0307510_10024259 3300033180 Bacteria 7010
22 Ga0307510_10081735 3300033180 Bacteria 3130
23 Ga0307510_10095268 3300033180 Bacteria 2798
24 Ga0395898_0113160 3300037466 Bacteria 2601
25 Ga0439436_0005343 3300041404 Bacteria 3939
26 Ga0439439_0000497 3300041406 Bacteria 6786
27 Ga0439448_0002133 3300042005 Bacteria 5325
28 Ga0439457_001081 3300042014 Bacteria 8235
29 Ga0450903_000216 3300042138 Bacteria 12821
30 Ga0439458_0003095 3300042157 Bacteria 3958
31 Ga0466969_0009709 3300044656 Bacteria 5100
32 Ga0466969_0033587 3300044656 Bacteria 2604
33 Ga0466972_0033111 3300044658 Bacteria 2535
34 Ga0466965_0002458 3300044683 Bacteria 7874
35 Ga0466966_0000467 3300044684 Bacteria 25955
36 Ga0466966_0002927 3300044684 Bacteria 11250
37 Ga0466961_0000490 3300044693 Bacteria 25169
38 Ga0466961_0002710 3300044693 Bacteria 11007
39 Ga0466961_0053268 3300044693 Bacteria 2582
40 Ga0466961_0055390 3300044693 Bacteria 2528
41 Ga0466963_0000203 3300044694 Bacteria 25139
42 Ga0466964_0005362 3300044706 Bacteria 4764
43 Ga0466970_0005634 3300044765 Bacteria 6218
44 Ga0466957_0001212 3300044842 Bacteria 13444
45 Ga0466960_0006478 3300044901 Bacteria 4698
46 Ga0466960_0024531 3300044901 Bacteria 2721
47 Ga0466959_0001070 3300045049 Bacteria 16365
48 Ga0466959_0012818 3300045049 Bacteria 6065
49 Ga0466959_0145770 3300045049 Bacteria 1671
50 Ga0466958_0000214 3300045836 Bacteria 21753
51 Ga0466967_0000486 3300045976 Bacteria 19287
52 Ga0495617_006801 3300046452 Bacteria 3996
53 Ga0495592_0009529 3300046454 Bacteria 7305
54 Ga0495592_0027724 3300046454 Bacteria 4291
55 Ga0495603_0008833 3300046455 Bacteria 6090
56 Ga0495629_0012218 3300046459 Bacteria 6220
57 Ga0495629_0019701 3300046459 Bacteria 4816
58 Ga0495629_0027901 3300046459 Bacteria 4010
59 Ga0495629_0065547 3300046459 Bacteria 2535
60 Ga0495629_0100628 3300046459 Bacteria 2017
61 Ga0495638_0104112 3300046460 Bacteria 1693
62 Ga0495651_0001946 3300046462 Bacteria 15958
63 Ga0495651_0103596 3300046462 Bacteria 2114
64 Ga0495582_0079332 3300046473 Bacteria 1822
65 Ga0495605_0007330 3300046474 Bacteria 6264
66 Ga0495662_0000563 3300046476 Bacteria 17069
67 Ga0495662_0001785 3300046476 Bacteria 10772
68 Ga0495662_0046928 3300046476 Bacteria 2085
69 Ga0495664_0004832 3300046477 Bacteria 7366
70 Ga0495594_0000524 3300046499 Bacteria 19683
71 Ga0495594_0021749 3300046499 Bacteria 3425
72 Ga0495594_0124789 3300046499 Bacteria 1456
73 Ga0495607_0083358 3300046501 Bacteria 1751
74 Ga0495583_0039017 3300046506 Bacteria 2240
75 Ga0495606_0035328 3300046507 Bacteria 3417
76 Ga0495608_0001058 3300046511 Bacteria 19381
77 Ga0495616_0007501 3300046513 Bacteria 6530
78 Ga0495618_0159860 3300046514 Bacteria 1436
79 Ga0495628_0010328 3300046516 Bacteria 7938
80 Ga0495628_0038996 3300046516 Bacteria 3801
81 Ga0495630_0063640 3300046517 Bacteria 2771
82 Ga0495630_0143848 3300046517 Bacteria 1813
83 Ga0495631_0007031 3300046518 Bacteria 5755
84 Ga0495631_0012319 3300046518 Bacteria 4183
85 Ga0495637_0073510 3300046520 Bacteria 1375
86 Ga0495642_0022896 3300046528 Bacteria 2464
87 Ga0495652_0007438 3300046529 Bacteria 10096
88 Ga0495652_0024003 3300046529 Bacteria 5402
89 Ga0495665_0000959 3300046531 Bacteria 15251
90 Ga0495640_0010870 3300046533 Bacteria 7019
91 Ga0495587_0003684 3300046536 Bacteria 10194
92 Ga0495609_0041477 3300046538 Bacteria 2068
93 Ga0495622_0018505 3300046557 Bacteria 3245
94 Ga0495622_0025343 3300046557 Bacteria 2770
95 Ga0495622_0028377 3300046557 Bacteria 2614
96 Ga0495634_0001186 3300046642 Bacteria 24137
97 Ga0495611_0017202 3300046648 Bacteria 3091
98 Ga0495625_0024838 3300046660 Bacteria 4551
99 Ga0495635_0034197 3300046663 Bacteria 3525
100 Ga0495661_0040578 3300046665 Bacteria 2885
101 Ga0495588_0013231 3300046674 Bacteria 3926
102 Ga0495657_0008334 3300046675 Bacteria 7941
103 Ga0495657_0141753 3300046675 Bacteria 1497
104 Ga0495623_0008558 3300046679 Bacteria 6645
105 Ga0495646_0064788 3300046680 Bacteria 2165
106 Ga0495658_0012977 3300046683 Bacteria 4233
107 Ga0495613_0005453 3300046689 Bacteria 9553
108 Ga0495613_0042865 3300046689 Bacteria 3347
109 Ga0495649_0060310 3300046694 Bacteria 2041
110 Ga0495660_0133369 3300046810 Bacteria 1243
111 Ga0495581_0012076 3300047315 Bacteria 4998
112 Ga0495581_0017769 3300047315 Bacteria 4132
113 Ga0495581_0025822 3300047315 Bacteria 3406
114 Ga0495604_0000612 3300047317 Bacteria 30635
115 Ga0495604_0008856 3300047317 Bacteria 7953
116 Ga0495674_0020152 3300047319 Bacteria 6178
117 Ga0495676_0020843 3300047321 Bacteria 5741
118 Ga0495676_0069104 3300047321 Bacteria 2726
119 Ga0495687_009409 3300047443 Bacteria 5464
120 Ga0495675_0000649 3300047444 Bacteria 22067
121 Ga0495675_0008698 3300047444 Bacteria 6299
122 Ga0495675_0015572 3300047444 Bacteria 4808
123 Ga0495675_0042519 3300047444 Bacteria 2895
124 Ga0495685_025420 3300047447 Bacteria 2037
125 Ga0495681_0063518 3300047470 Bacteria 1694
126 Ga0495684_0134811 3300047471 Bacteria 1853
127 Ga0495686_0023309 3300047472 Bacteria 4085
128 Ga0495593_0001434 3300047673 Bacteria 13981
129 Ga0495593_0017509 3300047673 Bacteria 4032
130 Ga0495602_0008850 3300048088 Bacteria 10499
131 Ga0495602_0044877 3300048088 Bacteria 4005
132 Ga0495682_0036027 3300049460 Bacteria 1822
133 Ga0501032_0044488 3300049569 Bacteria 3005
134 Ga0501033_0201812 3300049570 Bacteria 1420
135 Ga0501036_0003285 3300049572 Bacteria 12894
136 Ga0501036_0025307 3300049572 Bacteria 5007
137 Ga0501037_0073482 3300049573 Bacteria 2486
138 Ga0501038_0003289 3300049574 Bacteria 15064
139 Ga0501038_0063109 3300049574 Bacteria 3163
140 Ga0501038_0086189 3300049574 Bacteria 2639
141 Ga0501043_0005233 3300049579 Bacteria 10495
142 Ga0501043_0159329 3300049579 Bacteria 1764
143 Ga0501043_0265656 3300049579 Bacteria 1318
144 Ga0501046_0028570 3300049580 Bacteria 4541
145 Ga0501047_0021514 3300049581 Bacteria 6194
146 Ga0501048_0138729 3300049582 Bacteria 1719
147 Ga0501048_0154553 3300049582 Bacteria 1623
148 Ga0501069_0030666 3300049585 Bacteria 2954
149 Ga0501070_0006045 3300049586 Bacteria 10309
150 Ga0501074_0000799 3300049590 Bacteria 19909
151 Ga0501080_0258716 3300049742 Bacteria 1586
152 Ga0501035_0001436 3300049822 Bacteria 24426
153 Ga0501035_0075509 3300049822 Bacteria 2981
154 Ga0501035_0130008 3300049822 Bacteria 2196
155 Ga0501044_0259774 3300049823 Bacteria 1675
156 nmdc:mga06z11_61458_c1 3300050494 Bacteria 1959
157 Ga0495601_0003307 3300053077 Bacteria 9223
158 Ga0466962_0002390 3300061719 Bacteria 8896
159 Ga0466962_0018858 3300061719 Bacteria 3315
160 Ga0466962_0065987 3300061719 Bacteria 1728

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0003285 Ga0501036_0003285_8888_10213 351
2 3300049574 Ga0501038_0086189 Ga0501038_0086189_1069_2394 351
3 3300049579 Ga0501043_0005233 Ga0501043_0005233_8881_10206 351
4 3300049586 Ga0501070_0006045 Ga0501070_0006045_5721_7046 351
5 3300049590 Ga0501074_0000799 Ga0501074_0000799_5530_6855 351
6 3300049822 Ga0501035_0001436 Ga0501035_0001436_20836_22161 351
7 3300045049 Ga0466959_0145770 Ga0466959_0145770_30_1382 357
8 3300061719 Ga0466962_0018858 Ga0466962_0018858_1610_2962 357
9 3300037466 Ga0395898_0113160 Ga0395898_0113160_44_1249 362
10 3300046473 Ga0495582_0079332 Ga0495582_0079332_416_1621 363
11 3300046680 Ga0495646_0064788 Ga0495646_0064788_525_1700 363
12 3300047315 Ga0495581_0025822 Ga0495581_0025822_1673_2848 363
13 3300047470 Ga0495681_0063518 Ga0495681_0063518_196_1401 363
14 3300046460 Ga0495638_0104112 Ga0495638_0104112_23_1198 365
15 3300046518 Ga0495631_0012319 Ga0495631_0012319_2732_3907 365
16 3300046648 Ga0495611_0017202 Ga0495611_0017202_336_1511 365
17 3300046474 Ga0495605_0007330 Ga0495605_0007330_4505_5680 366
18 3300046501 Ga0495607_0083358 Ga0495607_0083358_51_1226 366
19 3300046507 Ga0495606_0035328 Ga0495606_0035328_329_1504 366
20 3300046513 Ga0495616_0007501 Ga0495616_0007501_5027_6202 366
21 3300046518 Ga0495631_0007031 Ga0495631_0007031_1186_2361 366
22 3300046557 Ga0495622_0025343 Ga0495622_0025343_896_2071 366
23 3300046660 Ga0495625_0024838 Ga0495625_0024838_1310_2485 366
24 3300046665 Ga0495661_0040578 Ga0495661_0040578_1659_2834 366
25 3300046810 Ga0495660_0133369 Ga0495660_0133369_51_1226 366
26 3300047321 Ga0495676_0020843 Ga0495676_0020843_3519_4694 366
27 3300049460 Ga0495682_0036027 Ga0495682_0036027_57_1232 366
28 3300044901 Ga0466960_0006478 Ga0466960_0006478_2128_3306 367
29 3300046454 Ga0495592_0009529 Ga0495592_0009529_4414_5706 367
30 3300046459 Ga0495629_0019701 Ga0495629_0019701_2075_3367 367
31 3300046459 Ga0495629_0100628 Ga0495629_0100628_234_1409 367
32 3300046462 Ga0495651_0103596 Ga0495651_0103596_411_1586 367
33 3300046476 Ga0495662_0001785 Ga0495662_0001785_8416_9708 367
34 3300046499 Ga0495594_0124789 Ga0495594_0124789_33_1352 367
35 3300046514 Ga0495618_0159860 Ga0495618_0159860_135_1310 367
36 3300046516 Ga0495628_0010328 Ga0495628_0010328_3076_4368 367
37 3300046516 Ga0495628_0038996 Ga0495628_0038996_412_1587 367
38 3300046517 Ga0495630_0063640 Ga0495630_0063640_1311_2603 367
39 3300046528 Ga0495642_0022896 Ga0495642_0022896_608_1783 367
40 3300046529 Ga0495652_0007438 Ga0495652_0007438_2276_3451 367
41 3300046529 Ga0495652_0024003 Ga0495652_0024003_4097_5389 367
42 3300046536 Ga0495587_0003684 Ga0495587_0003684_8570_9862 367
43 3300046557 Ga0495622_0028377 Ga0495622_0028377_1000_2292 367
44 3300046642 Ga0495634_0001186 Ga0495634_0001186_13625_14917 367
45 3300046663 Ga0495635_0034197 Ga0495635_0034197_576_1868 367
46 3300046674 Ga0495588_0013231 Ga0495588_0013231_231_1550 367
47 3300046675 Ga0495657_0141753 Ga0495657_0141753_204_1379 367
48 3300046683 Ga0495658_0012977 Ga0495658_0012977_2812_4104 367
49 3300046689 Ga0495613_0005453 Ga0495613_0005453_3643_4935 367
50 3300047315 Ga0495581_0017769 Ga0495581_0017769_2279_3571 367
51 3300047321 Ga0495676_0069104 Ga0495676_0069104_301_1593 367
52 3300047444 Ga0495675_0015572 Ga0495675_0015572_958_2250 367
53 3300047444 Ga0495675_0042519 Ga0495675_0042519_1234_2409 367
54 3300047673 Ga0495593_0001434 Ga0495593_0001434_11483_12775 367
55 3300048088 Ga0495602_0044877 Ga0495602_0044877_1600_2892 367
56 3300044765 Ga0466970_0005634 Ga0466970_0005634_595_1800 368
57 3300050494 nmdc:mga06z11_61458_c1 nmdc:mga06z11_61458_c1_660_1910 368
58 3300041406 Ga0439439_0000497 Ga0439439_0000497_2326_3498 369
59 3300041404 Ga0439436_0005343 Ga0439436_0005343_383_1549 370
60 3300042005 Ga0439448_0002133 Ga0439448_0002133_3084_4250 370
61 3300042014 Ga0439457_001081 Ga0439457_001081_3407_4573 370
62 3300042138 Ga0450903_000216 Ga0450903_000216_9235_10401 370
63 3300042157 Ga0439458_0003095 Ga0439458_0003095_1611_2777 370
64 3300044658 Ga0466972_0033111 Ga0466972_0033111_235_1440 371
65 3300044683 Ga0466965_0002458 Ga0466965_0002458_1362_2567 371
66 3300044684 Ga0466966_0000467 Ga0466966_0000467_8698_9903 371
67 3300044693 Ga0466961_0000490 Ga0466961_0000490_3424_4629 371
68 3300044694 Ga0466963_0000203 Ga0466963_0000203_3207_4412 371
69 3300044706 Ga0466964_0005362 Ga0466964_0005362_337_1542 371
70 3300044842 Ga0466957_0001212 Ga0466957_0001212_11902_13107 371
71 3300045049 Ga0466959_0001070 Ga0466959_0001070_699_1904 371
72 3300045836 Ga0466958_0000214 Ga0466958_0000214_7978_9183 371
73 3300049570 Ga0501033_0201812 Ga0501033_0201812_41_1384 371
74 3300049582 Ga0501048_0154553 Ga0501048_0154553_251_1594 371
75 3300049572 Ga0501036_0025307 Ga0501036_0025307_534_1874 372
76 3300045976 Ga0466967_0000486 Ga0466967_0000486_5941_7146 373
77 3300049823 Ga0501044_0259774 Ga0501044_0259774_15_1358 374
78 3300031730 Ga0307516_10063677 Ga0307516_100636772 375
79 3300046506 Ga0495583_0039017 Ga0495583_0039017_86_1291 375
80 3300047443 Ga0495687_009409 Ga0495687_009409_3418_4623 375
81 3300047447 Ga0495685_025420 Ga0495685_025420_339_1544 375
82 3300031730 Ga0307516_10015060 Ga0307516_100150604 379
83 3300049579 Ga0501043_0159329 Ga0501043_0159329_130_1449 379
84 3300049581 Ga0501047_0021514 Ga0501047_0021514_1101_2420 379
85 3300049822 Ga0501035_0075509 Ga0501035_0075509_1075_2367 379
86 3300031507 Ga0307509_10076601 Ga0307509_100766012 380
87 3300049582 Ga0501048_0138729 Ga0501048_0138729_274_1584 380
88 3300047472 Ga0495686_0023309 Ga0495686_0023309_1843_3108 381
89 3300030521 Ga0307511_10000238 Ga0307511_1000023851 382
90 3300049579 Ga0501043_0265656 Ga0501043_0265656_83_1297 382
91 3300046459 Ga0495629_0065547 Ga0495629_0065547_77_1351 384
92 3300046476 Ga0495662_0046928 Ga0495662_0046928_179_1384 384
93 3300046689 Ga0495613_0042865 Ga0495613_0042865_874_2079 384
94 3300031649 Ga0307514_10005225 Ga0307514_100052252 385
95 3300031730 Ga0307516_10011234 Ga0307516_1001123411 385
96 3300033180 Ga0307510_10081735 Ga0307510_100817353 385
97 3300046452 Ga0495617_006801 Ga0495617_006801_1482_2771 385
98 3300046455 Ga0495603_0008833 Ga0495603_0008833_438_1745 385
99 3300046499 Ga0495594_0021749 Ga0495594_0021749_1551_2840 385
100 3300046520 Ga0495637_0073510 Ga0495637_0073510_13_1302 385
101 3300046538 Ga0495609_0041477 Ga0495609_0041477_698_1987 385
102 3300031838 Ga0307518_10017622 Ga0307518_100176223 386
103 iso_pu_bacteria 2990088156 2990092115 386
104 3300044693 Ga0466961_0055390 Ga0466961_0055390_1312_2487 387
105 3300046459 Ga0495629_0027901 Ga0495629_0027901_1335_2645 387
106 3300046499 Ga0495594_0000524 Ga0495594_0000524_2350_3660 387
107 3300046557 Ga0495622_0018505 Ga0495622_0018505_17_1327 387
108 3300061719 Ga0466962_0065987 Ga0466962_0065987_83_1258 387
109 3300044656 Ga0466969_0009709 Ga0466969_0009709_3759_4985 390
110 3300044684 Ga0466966_0002927 Ga0466966_0002927_3571_4797 390
111 3300044693 Ga0466961_0053268 Ga0466961_0053268_1190_2416 390
112 3300045049 Ga0466959_0012818 Ga0466959_0012818_3706_4932 390
113 3300049585 Ga0501069_0030666 Ga0501069_0030666_968_2302 390
114 3300031507 Ga0307509_10085994 Ga0307509_100859943 391
115 3300031616 Ga0307508_10041223 Ga0307508_100412234 391
116 3300044901 Ga0466960_0024531 Ga0466960_0024531_672_1877 391
117 3300049580 Ga0501046_0028570 Ga0501046_0028570_1590_2837 392
118 3300047444 Ga0495675_0000649 Ga0495675_0000649_6958_8271 393
119 3300046694 Ga0495649_0060310 Ga0495649_0060310_635_1831 394
120 iso_pu_bacteria 2837268691 2837274117 394
121 3300028786 Ga0307517_10002028 Ga0307517_1000202819 395
122 3300028794 Ga0307515_10004007 Ga0307515_1000400723 395
123 3300030521 Ga0307511_10034728 Ga0307511_100347282 395
124 3300033179 Ga0307507_10019013 Ga0307507_100190132 395
125 3300033180 Ga0307510_10024259 Ga0307510_100242597 395
126 3300033180 Ga0307510_10095268 Ga0307510_100952683 395
127 3300046459 Ga0495629_0012218 Ga0495629_0012218_4920_6203 395
128 3300046517 Ga0495630_0143848 Ga0495630_0143848_211_1428 397
129 3300046675 Ga0495657_0008334 Ga0495657_0008334_2807_4024 397
130 3300031456 Ga0307513_10048157 Ga0307513_100481572 400
131 iso_pu_bacteria 2867428634 2867428958 400
132 3300031507 Ga0307509_10054408 Ga0307509_100544082 401
133 3300049573 Ga0501037_0073482 Ga0501037_0073482_126_1373 401
134 3300049574 Ga0501038_0063109 Ga0501038_0063109_527_1774 401
135 3300049822 Ga0501035_0130008 Ga0501035_0130008_844_2091 401
136 3300025302 Ga0207426_1002378 Ga0207426_10023784 402
137 3300049569 Ga0501032_0044488 Ga0501032_0044488_923_2209 403
138 3300049574 Ga0501038_0003289 Ga0501038_0003289_5393_6679 403
139 3300049742 Ga0501080_0258716 Ga0501080_0258716_270_1556 403
140 3300046679 Ga0495623_0008558 Ga0495623_0008558_3087_4376 404
141 3300047317 Ga0495604_0008856 Ga0495604_0008856_3084_4373 404
142 3300047444 Ga0495675_0008698 Ga0495675_0008698_2010_3299 404
143 iso_pu_bacteria 2808606375 2808913130 405
144 3300046454 Ga0495592_0027724 Ga0495592_0027724_1416_2720 406
145 3300046462 Ga0495651_0001946 Ga0495651_0001946_11308_12612 406
146 3300046476 Ga0495662_0000563 Ga0495662_0000563_8796_10100 406
147 3300046477 Ga0495664_0004832 Ga0495664_0004832_1061_2365 406
148 3300046531 Ga0495665_0000959 Ga0495665_0000959_7496_8800 406
149 3300046533 Ga0495640_0010870 Ga0495640_0010870_4172_5476 406
150 3300047317 Ga0495604_0000612 Ga0495604_0000612_12136_13440 406
151 3300047319 Ga0495674_0020152 Ga0495674_0020152_1061_2365 406
152 3300048088 Ga0495602_0008850 Ga0495602_0008850_5013_6317 406
153 3300053077 Ga0495601_0003307 Ga0495601_0003307_1177_2481 406
154 3300046511 Ga0495608_0001058 Ga0495608_0001058_7335_8642 407
155 3300047315 Ga0495581_0012076 Ga0495581_0012076_1442_2749 407
156 3300047673 Ga0495593_0017509 Ga0495593_0017509_354_1661 407
157 iso_pu_bacteria 2791355406 2793984696 407
158 iso_pu_bacteria 2990044586 2990044973 407
159 iso_pu_bacteria 2811994917 2812479218 409
160 iso_pu_bacteria 2862705112 2862710453 409
161 iso_pu_bacteria 2867346516 2867351871 409
162 iso_pu_bacteria 8008485437 8008491425 409
163 iso_pu_bacteria 8025524527 8025530755 409
164 iso_pu_bacteria 2554235005 2554256608 410
165 iso_pu_bacteria 2643221670 2644385779 410
166 iso_pu_bacteria 2767802112 2768643695 410
167 3300031649 Ga0307514_10072030 Ga0307514_100720302 412
168 iso_pu_bacteria 2863404153 2863411337 412
169 iso_pu_bacteria 2786546132 2786672220 413
170 iso_pu_bacteria 2808606982 2811844887 413
171 iso_pu_bacteria 2862281513 2862287234 413
172 iso_pu_bacteria 2912715099 2912718197 413
173 iso_pu_bacteria 2954673503 2954678496 413
174 iso_pu_bacteria 2954682443 2954685659 413
175 iso_pu_bacteria 2954711539 2954714755 413
176 iso_pu_bacteria 2954721474 2954724700 413
177 iso_pu_bacteria 2954731030 2954737117 413
178 iso_pu_bacteria 2954740390 2954743624 413
179 iso_pu_bacteria 2954749733 2954755970 413
180 iso_pu_bacteria 2954759201 2954762576 413
181 iso_pu_bacteria 2582581313 2585306124 414
182 iso_pu_bacteria 2643221647 2644261341 414
183 iso_pu_bacteria 2818991472 2819742391 414
184 iso_pu_bacteria 2862178590 2862185126 414
185 iso_pu_bacteria 2947224130 2947227528 414
186 iso_pu_bacteria 2954691527 2954695318 414
187 iso_pu_bacteria 2954701450 2954710509 414
188 3300044656 Ga0466969_0033587 Ga0466969_0033587_1283_2593 415
189 3300044693 Ga0466961_0002710 Ga0466961_0002710_4448_5758 415
190 3300047471 Ga0495684_0134811 Ga0495684_0134811_322_1623 415
191 3300061719 Ga0466962_0002390 Ga0466962_0002390_452_1762 415
192 iso_pu_bacteria 2811994879 2812356479 415
193 iso_pu_bacteria 2852635781 2852640203 415
194 iso_pu_bacteria 2919468124 2919470441 415
195 iso_pu_bacteria 2946064051 2946069383 415
196 iso_pu_bacteria 2643221601 2644014328 416
197 iso_pu_bacteria 2643221631 2644175765 416
198 iso_pu_bacteria 2877676314 2877679557 416
199 iso_pu_bacteria 2912757875 2912762327 416
200 iso_pu_bacteria 2954002825 2954004975 416
201 3300031824 Ga0307413_10219843 Ga0307413_102198431 417
202 iso_pu_bacteria 2643221587 2643941807 417
203 iso_pu_bacteria 2643221677 2644428890 417
204 iso_pu_bacteria 2918501144 2918506009 417
205 iso_pu_bacteria 2935390628 2935391788 417
206 iso_pu_bacteria 3006493962 3006499025 417
207 iso_pu_bacteria 2784132148 2784589940 418
208 iso_pu_bacteria 2867369537 2867373390 418
209 iso_pu_bacteria 8025530807 8025532431 418
210 iso_pu_bacteria 8047893842 8047898252 418
211 iso_pu_bacteria 8048356638 8048360641 418
212 iso_pu_bacteria 8048369669 8048375216 418
213 iso_pu_bacteria 8048379754 8048382989 418
214 iso_pu_bacteria 2616644941 2616903040 419
215 iso_pu_bacteria 2643221678 2644439559 419
216 iso_pu_bacteria 2808606359 2808843566 419
217 iso_pu_bacteria 2862574272 2862577961 419
218 iso_pu_bacteria 2997600082 2997600557 419
219 iso_pu_bacteria 2808606448 2809233611 420
220 iso_pu_bacteria 8008574985 8008577592 420
221 iso_pu_bacteria 2582581312 2585296113 421
222 iso_pu_bacteria 2616644814 2616696513 421
223 iso_pu_bacteria 2643221714 2644633093 421
224 iso_pu_bacteria 2818991463 2819695053 421
225 iso_pu_bacteria 2912723979 2912730598 421
226 iso_pu_bacteria 8023623736 8023630292 421
227 iso_pu_bacteria 2643221578 2643903142 422
228 iso_pu_bacteria 2643221673 2644404347 422
229 iso_pu_bacteria 2875391855 2875396221 422
230 iso_pu_bacteria 2946045630 2946048377 422
231 iso_pu_bacteria 3006393351 3006393483 422
232 iso_pu_bacteria 8025478263 8025483210 422
233 iso_pu_bacteria 8056447290 8056453631 422
234 iso_pu_bacteria 8048406513 8048412209 423
235 iso_pu_bacteria 8056667051 8056670510 423
236 iso_pu_bacteria 2862507626 2862512088 424
237 iso_pu_bacteria 2643221548 2643764591 425
238 iso_pu_bacteria 2643221682 2644461976 425
239 iso_pu_bacteria 2862290372 2862293377 425
240 iso_pu_bacteria 2867475112 2867479528 425
241 iso_pu_bacteria 2990059506 2990059814 425
242 iso_pu_bacteria 8048127548 8048136886 425
243 iso_pu_bacteria 8054160619 8054166825 425
244 iso_pu_bacteria 2997451912 2997458029 426
245 iso_pu_bacteria 2802429296 2804845269 427
246 iso_pu_bacteria 3006425503 3006429701 427
247 iso_pu_bacteria 8025413630 8025415485 427
248 3300005530 Ga0070679_100064856 Ga0070679_1000648563 428
249 3300025921 Ga0207652_10217931 Ga0207652_102179311 428

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

62

381

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.8818 34 413
8ex6-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1*) 0.8591 40 413
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.8568 34 413
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8567 37 416
6vs2-assembly1.cif.gz_A protein d 0.8562 41 412
ID Description Score Start End Superfamily
af_P43531_29_411_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9916 34 415 1.20.1250.20
af_P43531_29_411_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9865 34 415 1.20.1250.20
af_P9WJX7_21_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9322 42 219 1.20.1250.20
af_P25744_212_408_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.931 41 216 1.20.1250.20
af_P76628_9_385_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9274 42 415 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6A7XYP7-F1-model_v4 MFS transporter 0.9954 26 418 GO:0005886
GO:0022857
AF-A0A7U6LXR6-F1-model_v4 MFS transporter 0.9946 30 413 GO:0005886
GO:0022857
AF-A0A089KWU6-F1-model_v4 Membrane protein 0.9945 30 416 GO:0005886
GO:0022857
AF-A0A7U0JS31-F1-model_v4 deleted 0.9942 29 413
AF-A0A178U306-F1-model_v4 deleted 0.9942 28 416

Feature Viewer

pLDDT pTM Quality
88.79 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map