F361174

General Info

Members Datasets Scaffolds Average Seq Length
249 176 498 316

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2626541554|2626635406
Length 375
Sequence PCLYEFNLTLNVAMRPVLPPLRAGWSVDRVGSTTIGILLNSKGDESVKVVVTGGAGFIGAHLTRALXAAGAEVVVIDDLSTGAVSNLAGLPVKLVIGSVTDRSLVEEACTGAGSIVHLAARPSVERSLLDPMATHTVNATGTLTVLDVAQRAETHVVVASSSSVYGGAGPLPRAEDAPTLPRSPYAASKLAAEGYALAYQAGFGLPVLAXRLFNVFGPYQSVGHAYAAVVPTFIEAALAGRPLTLHGDGRQTRDFTYVAGVAGMLCDAAVRRVSHPRPVNIAFGTRTDLLTVIGELERIVGRRLSVHHSAPRTGDVRDSQADATTMXRLFPDATGLDLAASLEATVAWYADRTGTTPGAGPGTGAVPGAPAAERL

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
136 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
159 2626541554 Frankia sp. AvcI.1 Isolate Nodule
160 2508501039 Frankia saprophytica CN3 Isolate Nodule
161 2527291627 Frankia casuarinae Thr Isolate Nodule
162 2527291629 Frankia sp. BMG5.23 Isolate Nodule
163 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
164 2576861822 Frankia sp. CeD Isolate Nodule
165 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
166 2619618881 Frankia sp. ACN1ag Isolate Unclassified
167 2619619003 Frankia sp. CpI1-P Isolate Nodule
168 2684623036 Frankia sp. CgIM4 Isolate Nodule
169 2710264753 Frankia sp. KB5 Isolate Nodule
170 2773857924 Frankia sp. CgIS1 Isolate Nodule
171 2855683550 Micromonospora sp. RP3T Isolate Unclassified
172 637000116 Frankia casuarinae CcI3 Isolate Nodule
173 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
174 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
175 8054920844 Frankia tisae Agncl-8 Isolate Nodule
176 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.77
Metatranscriptomes 0
Isolates 7.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.41
Nodule 5.22
Rhizoplane 1.61
Rhizosphere 88.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10015790 3300003203 Bacteria 3171
2 Ga0070658_10095359 3300005327 Bacteria 2456
3 Ga0070683_100028231 3300005329 Bacteria 5070
4 Ga0070690_100037633 3300005330 Bacteria 3050
5 Ga0070677_10004020 3300005333 Bacteria 4775
6 Ga0068869_100035293 3300005334 Bacteria 3543
7 Ga0068869_100064845 3300005334 Bacteria 2688
8 Ga0070666_10002243 3300005335 Bacteria 11680
9 Ga0070680_100041915 3300005336 Bacteria 3712
10 Ga0068868_100024861 3300005338 Bacteria 4548
11 Ga0068868_100461628 3300005338 Bacteria 1106
12 Ga0070660_100004879 3300005339 Bacteria 9269
13 Ga0070689_100020049 3300005340 Bacteria 4955
14 Ga0070687_100002066 3300005343 Bacteria 7387
15 Ga0070661_100042762 3300005344 Bacteria 3307
16 Ga0070669_100003805 3300005353 Bacteria 10904
17 Ga0070675_100091975 3300005354 Bacteria 2542
18 Ga0070673_100078411 3300005364 Bacteria 2672
19 Ga0070659_100079666 3300005366 Bacteria 2614
20 Ga0070700_100041608 3300005441 Bacteria 2817
21 Ga0070678_100024221 3300005456 Bacteria 4059
22 Ga0070662_100003746 3300005457 Bacteria 9517
23 Ga0070681_10066636 3300005458 Bacteria 3569
24 Ga0070685_10004802 3300005466 Bacteria 6844
25 Ga0070707_100039630 3300005468 Bacteria 4503
26 Ga0070698_100054208 3300005471 Bacteria 4072
27 Ga0070698_100219417 3300005471 Bacteria 1835
28 Ga0070699_100000185 3300005518 Bacteria 60797
29 Ga0070699_100008091 3300005518 Bacteria 9127
30 Ga0070699_100159051 3300005518 Bacteria 1999
31 Ga0070699_100451035 3300005518 Bacteria 1166
32 Ga0070672_100013776 3300005543 Bacteria 5717
33 Ga0070686_100017208 3300005544 Bacteria 4220
34 Ga0070696_100081207 3300005546 Bacteria 2297
35 Ga0070696_100109126 3300005546 Bacteria 1991
36 Ga0070665_100067664 3300005548 Bacteria 3581
37 Ga0070704_100000046 3300005549 Bacteria 40209
38 Ga0070704_100029524 3300005549 Bacteria 3663
39 Ga0070704_100051129 3300005549 Bacteria 2909
40 Ga0068855_100015946 3300005563 Bacteria 9037
41 Ga0068855_100037026 3300005563 Bacteria 5805
42 Ga0070664_100000547 3300005564 Bacteria 28718
43 Ga0070664_100085309 3300005564 Bacteria 2727
44 Ga0068856_100012577 3300005614 Bacteria 8192
45 Ga0068859_100030108 3300005617 Bacteria 5446
46 Ga0068864_100062264 3300005618 Bacteria 3233
47 Ga0068861_100002342 3300005719 Bacteria 12317
48 Ga0068861_100044029 3300005719 Bacteria 3354
49 Ga0068870_10002220 3300005840 Bacteria 8052
50 Ga0068863_100052267 3300005841 Bacteria 3873
51 Ga0068858_100035715 3300005842 Bacteria 4608
52 Ga0068858_100208379 3300005842 Bacteria 1850
53 Ga0068860_100113062 3300005843 Bacteria 2596
54 Ga0068862_100000107 3300005844 Bacteria 99656
55 Ga0081455_10000542 3300005937 Bacteria 49017
56 Ga0081455_10069899 3300005937 Bacteria 2917
57 Ga0081539_10000405 3300005985 Bacteria 92270
58 Ga0075368_10011347 3300006042 Bacteria 3241
59 Ga0075362_10108275 3300006177 Bacteria 1306
60 Ga0075367_10006577 3300006178 Bacteria 5884
61 Ga0075366_10018045 3300006195 Bacteria 4073
62 Ga0097621_100035450 3300006237 Bacteria 3987
63 Ga0075370_10031807 3300006353 Bacteria 2946
64 Ga0068871_100289068 3300006358 Bacteria 1436
65 Ga0075428_100036019 3300006844 Bacteria 5453
66 Ga0075431_100134205 3300006847 Bacteria 2552
67 Ga0075433_10001173 3300006852 Bacteria 19052
68 Ga0075433_10267349 3300006852 Bacteria 1516
69 Ga0075434_100049827 3300006871 Bacteria 4159
70 Ga0075434_100070235 3300006871 Bacteria 3492
71 Ga0075429_100001681 3300006880 Bacteria 18299
72 Ga0075429_100042717 3300006880 Bacteria 3944
73 Ga0075429_100087035 3300006880 Bacteria 2723
74 Ga0068865_100120852 3300006881 Bacteria 1947
75 Ga0075436_100089350 3300006914 Bacteria 2141
76 Ga0097620_100000039 3300006931 Bacteria 164260
77 Ga0097620_100030108 3300006931 Bacteria 5446
78 Ga0075435_100055192 3300007076 Bacteria 3208
79 Ga0105240_10023727 3300009093 Bacteria 8102
80 Ga0105240_10464934 3300009093 Bacteria 1413
81 Ga0111539_10109817 3300009094 Bacteria 3236
82 Ga0111539_10167086 3300009094 Bacteria 2571
83 Ga0105245_10240468 3300009098 Bacteria 1755
84 Ga0105245_10397155 3300009098 Bacteria 1377
85 Ga0105247_10000014 3300009101 Bacteria 285043
86 Ga0114129_10002050 3300009147 Bacteria 27658
87 Ga0114129_10014502 3300009147 Bacteria 11232
88 Ga0114129_10078198 3300009147 Bacteria 4602
89 Ga0114129_10094456 3300009147 Bacteria 4141
90 Ga0114129_10776447 3300009147 Bacteria 1224
91 Ga0105248_10106288 3300009177 Bacteria 3165
92 Ga0105248_10169023 3300009177 Bacteria 2464
93 Ga0105249_10001428 3300009553 Bacteria 20939
94 Ga0105249_10048440 3300009553 Bacteria 3874
95 Ga0105249_10071244 3300009553 Bacteria 3211
96 Ga0105246_10037818 3300011119 Bacteria 3240
97 Ga0157371_10059978 3300013102 Bacteria 2697
98 Ga0157369_10143287 3300013105 Bacteria 2527
99 Ga0157374_10026022 3300013296 Bacteria 5260
100 Ga0157374_10094491 3300013296 Bacteria 2857
101 Ga0157378_10008820 3300013297 Bacteria 8779
102 Ga0163162_10006404 3300013306 Bacteria 11399
103 Ga0163162_10173745 3300013306 Bacteria 2279
104 Ga0157375_10050362 3300013308 Bacteria 4085
105 Ga0157375_10276417 3300013308 Bacteria 1842
106 Ga0163163_10006458 3300014325 Bacteria 10255
107 Ga0163163_10032724 3300014325 Bacteria 5024
108 Ga0163163_10081789 3300014325 Bacteria 3232
109 Ga0157380_10015469 3300014326 Bacteria 5610
110 Ga0157377_10005868 3300014745 Bacteria 5810
111 Ga0157379_10005471 3300014968 Bacteria 10911
112 Ga0157379_10012848 3300014968 Bacteria 7322
113 Ga0157379_10013290 3300014968 Bacteria 7209
114 Ga0157376_10038071 3300014969 Bacteria 3911
115 Ga0157376_10114548 3300014969 Bacteria 2379
116 Ga0163161_10082258 3300017792 Bacteria 2372
117 Ga0207697_10004989 3300025315 Bacteria 6249
118 Ga0207682_10000749 3300025893 Bacteria 14982
119 Ga0207710_10000031 3300025900 Bacteria 285157
120 Ga0207688_10004360 3300025901 Bacteria 7714
121 Ga0207680_10186088 3300025903 Bacteria 1407
122 Ga0207645_10012235 3300025907 Bacteria 5827
123 Ga0207643_10000653 3300025908 Bacteria 21644
124 Ga0207705_10045108 3300025909 Bacteria 3169
125 Ga0207695_10025230 3300025913 Bacteria 6660
126 Ga0207695_10104082 3300025913 Bacteria 2829
127 Ga0207662_10004614 3300025918 Bacteria 7266
128 Ga0207657_10017232 3300025919 Bacteria 6937
129 Ga0207649_10020372 3300025920 Bacteria 3803
130 Ga0207652_10137486 3300025921 Bacteria 2183
131 Ga0207646_10030957 3300025922 Bacteria 4847
132 Ga0207646_10142346 3300025922 Bacteria 2160
133 Ga0207681_10012750 3300025923 Bacteria 5192
134 Ga0207659_10000371 3300025926 Bacteria 27010
135 Ga0207659_10068218 3300025926 Bacteria 2586
136 Ga0207659_10094215 3300025926 Bacteria 2243
137 Ga0207690_10043061 3300025932 Bacteria 2969
138 Ga0207706_10083666 3300025933 Bacteria 2805
139 Ga0207686_10023655 3300025934 Bacteria 3550
140 Ga0207670_10063037 3300025936 Bacteria 2535
141 Ga0207704_10024893 3300025938 Bacteria 3256
142 Ga0207691_10021194 3300025940 Bacteria 6140
143 Ga0207691_10024578 3300025940 Bacteria 5666
144 Ga0207691_10529069 3300025940 Bacteria 1000
145 Ga0207711_10017810 3300025941 Bacteria 5902
146 Ga0207711_10045004 3300025941 Bacteria 3771
147 Ga0207711_10114601 3300025941 Bacteria 2401
148 Ga0207689_10014875 3300025942 Bacteria 6604
149 Ga0207712_10036985 3300025961 Bacteria 3327
150 Ga0207677_10086097 3300026023 Bacteria 2270
151 Ga0207677_10381482 3300026023 Bacteria 1190
152 Ga0207703_10033551 3300026035 Bacteria 4070
153 Ga0207678_10018801 3300026067 Bacteria 6069
154 Ga0207708_10053771 3300026075 Bacteria 3069
155 Ga0207702_10015245 3300026078 Bacteria 6373
156 Ga0207641_10042989 3300026088 Bacteria 3792
157 Ga0207676_10109997 3300026095 Bacteria 2304
158 Ga0207676_10185118 3300026095 Bacteria 1827
159 Ga0207675_100001626 3300026118 Bacteria 22521
160 Ga0207675_100112642 3300026118 Bacteria 2568
161 Ga0207683_10007041 3300026121 Bacteria 9645
162 Ga0209968_1021992 3300027526 Bacteria 1038
163 Ga0209999_1011996 3300027543 Bacteria 1568
164 Ga0207428_10002296 3300027907 Bacteria 19173
165 Ga0207428_10036800 3300027907 Bacteria 3987
166 Ga0268266_10294041 3300028379 Bacteria 1513
167 Ga0268265_10000015 3300028380 Bacteria 322854
168 Ga0268265_10009184 3300028380 Bacteria 6681
169 Ga0268265_10059245 3300028380 Bacteria 2928
170 Ga0265316_10195729 3300031344 Bacteria 1500
171 Ga0307408_100013912 3300031548 Bacteria 5344
172 Ga0307405_10041958 3300031731 Bacteria 2782
173 Ga0307405_10104684 3300031731 Bacteria 1904
174 Ga0307413_10008099 3300031824 Bacteria 4936
175 Ga0307413_10013054 3300031824 Bacteria 4158
176 Ga0307413_10034216 3300031824 Bacteria 2902
177 Ga0307413_10159895 3300031824 Bacteria 1581
178 Ga0307406_10004435 3300031901 Bacteria 7639
179 Ga0307406_10321651 3300031901 Bacteria 1197
180 Ga0307407_10026829 3300031903 Bacteria 3056
181 Ga0307407_10052461 3300031903 Bacteria 2342
182 Ga0307407_10166285 3300031903 Bacteria 1448
183 Ga0307412_10020907 3300031911 Bacteria 3989
184 Ga0307409_100124701 3300031995 Bacteria 2188
185 Ga0307409_100185124 3300031995 Bacteria 1848
186 Ga0307409_100310459 3300031995 Bacteria 1471
187 Ga0307416_100392986 3300032002 Bacteria 1421
188 Ga0307414_10021089 3300032004 Bacteria 4078
189 Ga0307414_10145003 3300032004 Bacteria 1864
190 Ga0307411_10440795 3300032005 Bacteria 1087
191 Ga0307415_100114634 3300032126 Bacteria 2007
192 Ga0373951_0023667 3300035091 Bacteria 1420
193 Ga0373932_0014316 3300035112 Bacteria 1992
194 Ga0373937_0009536 3300036401 Bacteria 8444
195 Ga0439439_0025488 3300041406 Bacteria 1488
196 Ga0439462_0036647 3300042015 Bacteria 1305
197 Ga0450896_016586 3300042133 Bacteria 1059
198 Ga0466961_0017383 3300044693 Bacteria 4619
199 Ga0466961_0036248 3300044693 Bacteria 3166
200 Ga0466961_0048555 3300044693 Bacteria 2713
201 Ga0466963_0036600 3300044694 Bacteria 3201
202 Ga0466957_0059990 3300044842 Bacteria 2332
203 Ga0466958_0049759 3300045836 Bacteria 2536
204 Ga0495653_0021111 3300046463 Bacteria 5277
205 Ga0495635_0048476 3300046663 Bacteria 2929
206 Ga0495669_0081779 3300046684 Bacteria 1483
207 Ga0496108_0198624 3300048911 Bacteria 1740
208 Ga0496112_0156054 3300048915 Bacteria 2249
209 Ga0496112_0412244 3300048915 Bacteria 1290
210 Ga0496119_0000373 3300048922 Bacteria 61923
211 Ga0496120_0000156 3300048923 Bacteria 112926
212 Ga0501073_0360485 3300049589 Bacteria 1004
213 Ga0501080_0065364 3300049742 Bacteria 3383
214 nmdc:mga0k408_99747_c1 3300050493 Bacteria 1712
215 nmdc:mga05p37_146248_c1 3300050507 Bacteria 2894
216 nmdc:mga05p37_22268_c1 3300050507 Bacteria 7684
217 nmdc:mga05p37_63916_c1 3300050507 Bacteria 4529
218 nmdc:mga05p37_7052_c1 3300050507 Bacteria 13245
219 nmdc:mga09592_366852_c1 3300050508 Bacteria 1246
220 nmdc:mga09592_9647_c1 3300050508 Bacteria 7845
221 nmdc:mga06r32_123865_c1 3300050510 Bacteria 2551
222 nmdc:mga08y16_105125_c1 3300050511 Bacteria 2940
223 nmdc:mga0n895_134450_c1 3300050512 Bacteria 2499
224 nmdc:mga0n895_21149_c1 3300050512 Bacteria 6080
225 nmdc:mga0rr50_167432_c1 3300050513 Bacteria 1788
226 nmdc:mga0rr50_7572_c1 3300050513 Bacteria 6709
227 nmdc:mga0a205_245094_c1 3300050515 Bacteria 1672
228 nmdc:mga0a205_24848_c1 3300050515 Bacteria 5701
229 nmdc:mga0a205_259735_c1 3300050515 Bacteria 1615
230 nmdc:mga0a205_42302_c1 3300050515 Bacteria 4389
231 Ga0495595_0075814 3300053084 Bacteria 1596
232 2626635406 2626541554 Bacteria 7741902
233 2508677185 2508501039 Bacteria 9978592
234 2528203759 2527291627 Bacteria 5309833
235 2528213480 2527291629 Bacteria 5267418
236 2546948055 2546825537 Bacteria 5389291
237 2579748767 2576861822 Bacteria 5004595
238 2579853079 2579778521 Bacteria 7624758
239 2619855914 2619618881 Bacteria 7521104
240 2620348356 2619619003 Bacteria 7619552
241 2686541704 2684623036 Bacteria 5199090
242 2710603089 2710264753 Bacteria 5455564
243 2774864669 2773857924 Bacteria 5256821
244 2855683707 2855683550 Bacteria 7134265
245 637880797 637000116 Bacteria 5433628
246 8003836662 8003830390 Bacteria 6541657
247 8054920314 8054913762 Bacteria 7713009
248 8054921082 8054920844 Bacteria 7068637
249 8055163125 8055157932 Bacteria 6429399
250 JGI25406J46586_10015790
251 Ga0070658_10095359
252 Ga0070683_100028231
253 Ga0070690_100037633
254 Ga0070677_10004020
255 Ga0068869_100035293
256 Ga0068869_100064845
257 Ga0070666_10002243
258 Ga0070680_100041915
259 Ga0068868_100024861
260 Ga0068868_100461628
261 Ga0070660_100004879
262 Ga0070689_100020049
263 Ga0070687_100002066
264 Ga0070661_100042762
265 Ga0070669_100003805
266 Ga0070675_100091975
267 Ga0070673_100078411
268 Ga0070659_100079666
269 Ga0070700_100041608
270 Ga0070678_100024221
271 Ga0070662_100003746
272 Ga0070681_10066636
273 Ga0070685_10004802
274 Ga0070707_100039630
275 Ga0070698_100054208
276 Ga0070698_100219417
277 Ga0070699_100000185
278 Ga0070699_100008091
279 Ga0070699_100159051
280 Ga0070699_100451035
281 Ga0070672_100013776
282 Ga0070686_100017208
283 Ga0070696_100081207
284 Ga0070696_100109126
285 Ga0070665_100067664
286 Ga0070704_100000046
287 Ga0070704_100029524
288 Ga0070704_100051129
289 Ga0068855_100015946
290 Ga0068855_100037026
291 Ga0070664_100000547
292 Ga0070664_100085309
293 Ga0068856_100012577
294 Ga0068859_100030108
295 Ga0068864_100062264
296 Ga0068861_100002342
297 Ga0068861_100044029
298 Ga0068870_10002220
299 Ga0068863_100052267
300 Ga0068858_100035715
301 Ga0068858_100208379
302 Ga0068860_100113062
303 Ga0068862_100000107
304 Ga0081455_10000542
305 Ga0081455_10069899
306 Ga0081539_10000405
307 Ga0075368_10011347
308 Ga0075362_10108275
309 Ga0075367_10006577
310 Ga0075366_10018045
311 Ga0097621_100035450
312 Ga0075370_10031807
313 Ga0068871_100289068
314 Ga0075428_100036019
315 Ga0075431_100134205
316 Ga0075433_10001173
317 Ga0075433_10267349
318 Ga0075434_100049827
319 Ga0075434_100070235
320 Ga0075429_100001681
321 Ga0075429_100042717
322 Ga0075429_100087035
323 Ga0068865_100120852
324 Ga0075436_100089350
325 Ga0097620_100000039
326 Ga0097620_100030108
327 Ga0075435_100055192
328 Ga0105240_10023727
329 Ga0105240_10464934
330 Ga0111539_10109817
331 Ga0111539_10167086
332 Ga0105245_10240468
333 Ga0105245_10397155
334 Ga0105247_10000014
335 Ga0114129_10002050
336 Ga0114129_10014502
337 Ga0114129_10078198
338 Ga0114129_10094456
339 Ga0114129_10776447
340 Ga0105248_10106288
341 Ga0105248_10169023
342 Ga0105249_10001428
343 Ga0105249_10048440
344 Ga0105249_10071244
345 Ga0105246_10037818
346 Ga0157371_10059978
347 Ga0157369_10143287
348 Ga0157374_10026022
349 Ga0157374_10094491
350 Ga0157378_10008820
351 Ga0163162_10006404
352 Ga0163162_10173745
353 Ga0157375_10050362
354 Ga0157375_10276417
355 Ga0163163_10006458
356 Ga0163163_10032724
357 Ga0163163_10081789
358 Ga0157380_10015469
359 Ga0157377_10005868
360 Ga0157379_10005471
361 Ga0157379_10012848
362 Ga0157379_10013290
363 Ga0157376_10038071
364 Ga0157376_10114548
365 Ga0163161_10082258
366 Ga0207697_10004989
367 Ga0207682_10000749
368 Ga0207710_10000031
369 Ga0207688_10004360
370 Ga0207680_10186088
371 Ga0207645_10012235
372 Ga0207643_10000653
373 Ga0207705_10045108
374 Ga0207695_10025230
375 Ga0207695_10104082
376 Ga0207662_10004614
377 Ga0207657_10017232
378 Ga0207649_10020372
379 Ga0207652_10137486
380 Ga0207646_10030957
381 Ga0207646_10142346
382 Ga0207681_10012750
383 Ga0207659_10000371
384 Ga0207659_10068218
385 Ga0207659_10094215
386 Ga0207690_10043061
387 Ga0207706_10083666
388 Ga0207686_10023655
389 Ga0207670_10063037
390 Ga0207704_10024893
391 Ga0207691_10021194
392 Ga0207691_10024578
393 Ga0207691_10529069
394 Ga0207711_10017810
395 Ga0207711_10045004
396 Ga0207711_10114601
397 Ga0207689_10014875
398 Ga0207712_10036985
399 Ga0207677_10086097
400 Ga0207677_10381482
401 Ga0207703_10033551
402 Ga0207678_10018801
403 Ga0207708_10053771
404 Ga0207702_10015245
405 Ga0207641_10042989
406 Ga0207676_10109997
407 Ga0207676_10185118
408 Ga0207675_100001626
409 Ga0207675_100112642
410 Ga0207683_10007041
411 Ga0209968_1021992
412 Ga0209999_1011996
413 Ga0207428_10002296
414 Ga0207428_10036800
415 Ga0268266_10294041
416 Ga0268265_10000015
417 Ga0268265_10009184
418 Ga0268265_10059245
419 Ga0265316_10195729
420 Ga0307408_100013912
421 Ga0307405_10041958
422 Ga0307405_10104684
423 Ga0307413_10008099
424 Ga0307413_10013054
425 Ga0307413_10034216
426 Ga0307413_10159895
427 Ga0307406_10004435
428 Ga0307406_10321651
429 Ga0307407_10026829
430 Ga0307407_10052461
431 Ga0307407_10166285
432 Ga0307412_10020907
433 Ga0307409_100124701
434 Ga0307409_100185124
435 Ga0307409_100310459
436 Ga0307416_100392986
437 Ga0307414_10021089
438 Ga0307414_10145003
439 Ga0307411_10440795
440 Ga0307415_100114634
441 Ga0373951_0023667
442 Ga0373932_0014316
443 Ga0373937_0009536
444 Ga0439439_0025488
445 Ga0439462_0036647
446 Ga0450896_016586
447 Ga0466961_0017383
448 Ga0466961_0036248
449 Ga0466961_0048555
450 Ga0466963_0036600
451 Ga0466957_0059990
452 Ga0466958_0049759
453 Ga0495653_0021111
454 Ga0495635_0048476
455 Ga0495669_0081779
456 Ga0496108_0198624
457 Ga0496112_0156054
458 Ga0496112_0412244
459 Ga0496119_0000373
460 Ga0496120_0000156
461 Ga0501073_0360485
462 Ga0501080_0065364
463 nmdc:mga0k408_99747_c1
464 nmdc:mga05p37_146248_c1
465 nmdc:mga05p37_22268_c1
466 nmdc:mga05p37_63916_c1
467 nmdc:mga05p37_7052_c1
468 nmdc:mga09592_366852_c1
469 nmdc:mga09592_9647_c1
470 nmdc:mga06r32_123865_c1
471 nmdc:mga08y16_105125_c1
472 nmdc:mga0n895_134450_c1
473 nmdc:mga0n895_21149_c1
474 nmdc:mga0rr50_167432_c1
475 nmdc:mga0rr50_7572_c1
476 nmdc:mga0a205_245094_c1
477 nmdc:mga0a205_24848_c1
478 nmdc:mga0a205_259735_c1
479 nmdc:mga0a205_42302_c1
480 Ga0495595_0075814
481 2626635406
482 2508677185
483 2528203759
484 2528213480
485 2546948055
486 2579748767
487 2579853079
488 2619855914
489 2620348356
490 2686541704
491 2710603089
492 2774864669
493 2855683707
494 637880797
495 8003836662
496 8054920314
497 8054921082
498 8055163125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

49

282

0.94

PF05368

NmrA

NmrA-like family

49

127

0.93

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

50

285

0.85

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

50

332

0.85

PF04321

RmlD_sub_bind

RmlD substrate binding domain

47

283

0.8

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

49

275

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wjb-assembly1.cif.gz_A udp-glcnac c4-epimerase from pseudomonas protegens in complex with nad and udp-glcnac 0.962 1 302
6wja-assembly1.cif.gz_A udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac 0.9612 1 302
6pnl-assembly1.cif.gz_A structure of epimerase mth375 from the thermophilic pseudomurein-containing methanogen methanothermobacter thermautotrophicus 0.9479 3 310
6wjb-assembly1.cif.gz_A udp-glcnac c4-epimerase from pseudomonas protegens in complex with nad and udp-glcnac 0.9437 1 302
6wja-assembly1.cif.gz_A udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac 0.943 1 302
ID Description Score Start End Superfamily
3ru7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9647 2 167 3.40.50.720
af_P71662_1_248_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9566 2 33 3.50.50.60
1r6dA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9518 1 167 3.40.50.720
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9351 2 312 3.40.50.720
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9315 2 237 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A075I2N8-F1-model_v4 UDP-glucose 4-epimerase (GalE, GALE) (EC 5.1.3.2) 0.9796 49 149 GO:0003978
AF-A0A7V8WYH5-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9749 163 307
AF-A0A259D8D1-F1-model_v4 LPS biosynthesis protein WbpP 0.9723 2 181
AF-A0A7X7SLU6-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9715 2 175 GO:0016491
GO:0033499
AF-A0A1F8R7A1-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9676 70 303

Map