F361002

General Info

Members Datasets Scaffolds Average Seq Length
249 166 498 177

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0370918|Ga0495628_0370918_494_1027
Length 177
Sequence MPLVVFLKGVNVGGHRTFRPSQIAAKLAKFGVVSVGAAGTFVVGKPVTEARLRAELRRLLPFDTEVMICPGEEILQLVNEQPFAQELCGPNIVRFVSVLAEQPRLLLALPLDLPAGHEWLVRIAGVRERFALGQYKRTMKTISVLGQIEKRLGGSITTRNWNTFEKIAKVLRMHLPG

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.8
Rhizosphere 98.39
Stem 0
Stem Tuber 0
Unclassified 40.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0370918 3300046516 Bacteria 1050
2 JGI26145J50221_1001229 3300003371 Unclassified 2035
3 Ga0065707_10126751 3300005295 Bacteria 1997
4 Ga0065707_10564244 3300005295 Unclassified 712
5 Ga0070676_10325566 3300005328 Bacteria 1049
6 Ga0070676_10558031 3300005328 Unclassified 821
7 Ga0070676_10718213 3300005328 Unclassified 731
8 Ga0070690_100145611 3300005330 Bacteria 1612
9 Ga0070690_100436664 3300005330 Unclassified 968
10 Ga0070677_10011935 3300005333 Unclassified 3006
11 Ga0068869_100200076 3300005334 Bacteria 1575
12 Ga0070689_100133274 3300005340 Bacteria 1994
13 Ga0070669_100292370 3300005353 Bacteria 1308
14 Ga0070675_101014229 3300005354 Unclassified 762
15 Ga0070674_100000114 3300005356 Bacteria 37732
16 Ga0070674_100217673 3300005356 Unclassified 1484
17 Ga0070673_100101952 3300005364 Unclassified 2365
18 Ga0070703_10118703 3300005406 Unclassified 957
19 Ga0070709_10000058 3300005434 Bacteria 85194
20 Ga0070701_10213361 3300005438 Bacteria 1147
21 Ga0070705_100457318 3300005440 Unclassified 959
22 Ga0068867_100049006 3300005459 Unclassified 3109
23 Ga0070706_100028177 3300005467 Bacteria 5170
24 Ga0070706_100178655 3300005467 Bacteria 1982
25 Ga0070706_100317710 3300005467 Unclassified 1452
26 Ga0070707_100350370 3300005468 Unclassified 1434
27 Ga0070707_100480755 3300005468 Unclassified 1203
28 Ga0070698_100002554 3300005471 Bacteria 20032
29 Ga0070698_100026991 3300005471 Bacteria 5971
30 Ga0070698_100470866 3300005471 Bacteria 1193
31 Ga0070699_100000535 3300005518 Bacteria 35890
32 Ga0070699_100000820 3300005518 Bacteria 28792
33 Ga0070699_100004049 3300005518 Bacteria 12955
34 Ga0070697_100008258 3300005536 Bacteria 8124
35 Ga0070697_100056815 3300005536 Bacteria 3184
36 Ga0070672_100952347 3300005543 Bacteria 760
37 Ga0070686_100757697 3300005544 Unclassified 779
38 Ga0070696_100014980 3300005546 Bacteria 5206
39 Ga0070696_100105861 3300005546 Unclassified 2021
40 Ga0070704_100028540 3300005549 Unclassified 3714
41 Ga0070704_100094408 3300005549 Unclassified 2238
42 Ga0070704_100196828 3300005549 Bacteria 1624
43 Ga0070704_100771444 3300005549 Bacteria 857
44 Ga0070664_101555177 3300005564 Bacteria 626
45 Ga0068857_100007582 3300005577 Bacteria 9340
46 Ga0068854_100707754 3300005578 Unclassified 870
47 Ga0070702_100377456 3300005615 Bacteria 1007
48 Ga0068859_100214355 3300005617 Unclassified 2012
49 Ga0068859_100628771 3300005617 Bacteria 1166
50 Ga0068864_101121536 3300005618 Bacteria 783
51 Ga0068861_100585725 3300005719 Unclassified 1022
52 Ga0068863_100366973 3300005841 Bacteria 1404
53 Ga0068858_100003179 3300005842 Bacteria 16414
54 Ga0068858_100183892 3300005842 Unclassified 1974
55 Ga0068860_100329916 3300005843 Bacteria 1499
56 Ga0068860_100431355 3300005843 Bacteria 1308
57 Ga0068860_100684705 3300005843 Unclassified 1035
58 Ga0070717_10084887 3300006028 Unclassified 2664
59 Ga0075432_10083802 3300006058 Unclassified 1159
60 Ga0070716_100049101 3300006173 Bacteria 2389
61 Ga0097621_100098007 3300006237 Unclassified 2462
62 Ga0097621_100172733 3300006237 Bacteria 1864
63 Ga0068871_100565728 3300006358 Bacteria 1031
64 Ga0068871_100614849 3300006358 Unclassified 989
65 Ga0075428_100081659 3300006844 Bacteria 3527
66 Ga0075428_100753505 3300006844 Bacteria 1036
67 Ga0075428_101036072 3300006844 Bacteria 868
68 Ga0075431_100018322 3300006847 Bacteria 7127
69 Ga0075431_100441821 3300006847 Bacteria 1298
70 Ga0075431_100449623 3300006847 Bacteria 1284
71 Ga0075433_10290723 3300006852 Bacteria 1447
72 Ga0075434_100089094 3300006871 Unclassified 3087
73 Ga0075434_100244026 3300006871 Bacteria 1816
74 Ga0075434_100307491 3300006871 Bacteria 1605
75 Ga0075434_100620486 3300006871 Unclassified 1100
76 Ga0075429_100110034 3300006880 Bacteria 2408
77 Ga0075429_100127689 3300006880 Bacteria 2224
78 Ga0075429_100160340 3300006880 Unclassified 1970
79 Ga0068865_100779286 3300006881 Bacteria 823
80 Ga0075436_100106982 3300006914 Unclassified 1951
81 Ga0075436_100488091 3300006914 Bacteria 900
82 Ga0097620_100214346 3300006931 Unclassified 2012
83 Ga0097620_100628798 3300006931 Bacteria 1166
84 Ga0075435_100405681 3300007076 Unclassified 1173
85 Ga0075435_100486340 3300007076 Bacteria 1066
86 Ga0099794_10373452 3300007265 Unclassified 743
87 Ga0099794_10431306 3300007265 Unclassified 690
88 Ga0111539_10431421 3300009094 Bacteria 1534
89 Ga0111539_10490882 3300009094 Bacteria 1430
90 Ga0111539_10534555 3300009094 Unclassified 1366
91 Ga0105245_10005629 3300009098 Bacteria 11010
92 Ga0105247_10003760 3300009101 Bacteria 9843
93 Ga0114129_10021223 3300009147 Bacteria 9222
94 Ga0114129_10082925 3300009147 Bacteria 4454
95 Ga0114129_10492582 3300009147 Bacteria 1602
96 Ga0114129_10585128 3300009147 Bacteria 1448
97 Ga0114129_12135541 3300009147 Unclassified 675
98 Ga0105241_10797915 3300009174 Bacteria 870
99 Ga0105242_10245293 3300009176 Unclassified 1612
100 Ga0105248_10010387 3300009177 Bacteria 10252
101 Ga0105248_10078629 3300009177 Bacteria 3708
102 Ga0105248_10571790 3300009177 Unclassified 1275
103 Ga0105249_10227799 3300009553 Unclassified 1837
104 Ga0105249_10994537 3300009553 Unclassified 907
105 Ga0105249_11648866 3300009553 Unclassified 714
106 Ga0099796_10044463 3300010159 Bacteria 1517
107 Ga0157373_10578230 3300013100 Unclassified 816
108 Ga0157378_12003569 3300013297 Unclassified 629
109 Ga0163162_10007769 3300013306 Bacteria 10451
110 Ga0163162_10187641 3300013306 Bacteria 2195
111 Ga0163163_10000056 3300014325 Bacteria 125232
112 Ga0157380_10021303 3300014326 Bacteria 4860
113 Ga0157380_10811698 3300014326 Unclassified 953
114 Ga0157380_12192912 3300014326 Unclassified 616
115 Ga0157379_10009510 3300014968 Bacteria 8465
116 Ga0163161_11192456 3300017792 Unclassified 658
117 Ga0213875_10003489 3300021388 Bacteria 8946
118 Ga0207653_10256463 3300025885 Unclassified 671
119 Ga0207682_10007841 3300025893 Unclassified 4242
120 Ga0207710_10022242 3300025900 Bacteria 2721
121 Ga0207699_10000065 3300025906 Bacteria 85512
122 Ga0207645_10060265 3300025907 Bacteria 2423
123 Ga0207684_10015582 3300025910 Bacteria 6541
124 Ga0207684_10128385 3300025910 Bacteria 2176
125 Ga0207681_10656575 3300025923 Bacteria 870
126 Ga0207687_10003248 3300025927 Bacteria 11011
127 Ga0207690_10603101 3300025932 Unclassified 896
128 Ga0207686_10163747 3300025934 Unclassified 1562
129 Ga0207709_10771428 3300025935 Bacteria 774
130 Ga0207670_10154248 3300025936 Bacteria 1707
131 Ga0207669_10000700 3300025937 Bacteria 14478
132 Ga0207669_10061757 3300025937 Unclassified 2305
133 Ga0207669_10696546 3300025937 Unclassified 835
134 Ga0207665_10036654 3300025939 Bacteria 3262
135 Ga0207691_10277490 3300025940 Bacteria 1442
136 Ga0207711_10042326 3300025941 Bacteria 3881
137 Ga0207711_10142815 3300025941 Bacteria 2155
138 Ga0207689_10414274 3300025942 Unclassified 1124
139 Ga0207689_10677671 3300025942 Bacteria 869
140 Ga0207651_10094872 3300025960 Unclassified 2195
141 Ga0207651_10645107 3300025960 Unclassified 929
142 Ga0207703_10049649 3300026035 Bacteria 3392
143 Ga0207703_10118963 3300026035 Bacteria 2265
144 Ga0207703_10147282 3300026035 Bacteria 2049
145 Ga0207708_10501181 3300026075 Bacteria 1018
146 Ga0207641_10326579 3300026088 Bacteria 1456
147 Ga0207674_10027992 3300026116 Bacteria 5956
148 Ga0207675_100238516 3300026118 Bacteria 1757
149 Ga0207675_100329776 3300026118 Bacteria 1491
150 Ga0207675_100413260 3300026118 Unclassified 1331
151 Ga0209996_1008345 3300027395 Unclassified 1356
152 Ga0210000_1034777 3300027462 Unclassified 793
153 Ga0209995_1004842 3300027471 Unclassified 2162
154 Ga0209968_1001506 3300027526 Bacteria 3544
155 Ga0209982_1001276 3300027552 Bacteria 3401
156 Ga0209970_1001271 3300027614 Unclassified 4453
157 Ga0210002_1001015 3300027617 Bacteria 3887
158 Ga0209983_1001699 3300027665 Unclassified 4865
159 Ga0209971_1001851 3300027682 Bacteria 5178
160 Ga0209966_1007271 3300027695 Unclassified 1938
161 Ga0209974_10001171 3300027876 Bacteria 9355
162 Ga0268264_10443637 3300028381 Bacteria 1256
163 Ga0307412_10129667 3300031911 Bacteria 1830
164 Ga0307409_100052630 3300031995 Bacteria 3123
165 Ga0307409_100673327 3300031995 Bacteria 1031
166 Ga0307416_100217763 3300032002 Bacteria 1828
167 Ga0307416_100219345 3300032002 Bacteria 1822
168 Ga0307416_100456053 3300032002 Bacteria 1332
169 Ga0307415_100266028 3300032126 Bacteria 1402
170 Ga0373936_0204033 3300035113 Bacteria 873
171 Ga0373956_0135369 3300035119 Bacteria 1155
172 Ga0373957_0001333 3300035120 Bacteria 6633
173 Ga0373955_0058712 3300035172 Bacteria 2117
174 Ga0373947_0262782 3300035725 Bacteria 1144
175 Ga0373947_0318212 3300035725 Unclassified 1040
176 Ga0373937_0058103 3300036401 Bacteria 3553
177 Ga0373937_0666875 3300036401 Unclassified 986
178 Ga0395900_0460375 3300037418 Unclassified 1227
179 Ga0436364_0001534 3300037853 Bacteria 19907
180 Ga0439431_0095520 3300041997 Unclassified 813
181 Ga0439435_0064089 3300042436 Bacteria 1076
182 Ga0453683_0085925 3300044673 Unclassified 1971
183 Ga0495592_0065967 3300046454 Bacteria 2649
184 Ga0495653_0197899 3300046463 Unclassified 1366
185 Ga0495580_0488574 3300046472 Bacteria 823
186 Ga0495594_0049684 3300046499 Bacteria 2306
187 Ga0495608_0046745 3300046511 Bacteria 2879
188 Ga0495628_0002012 3300046516 Bacteria 18422
189 Ga0495628_0124434 3300046516 Bacteria 1976
190 Ga0495652_0161376 3300046529 Bacteria 1740
191 Ga0495656_0285163 3300046615 Unclassified 843
192 Ga0495659_0102986 3300046664 Unclassified 1108
193 Ga0495588_0034046 3300046674 Bacteria 2577
194 Ga0495657_0239269 3300046675 Unclassified 1096
195 Ga0495599_0041515 3300046678 Bacteria 2888
196 Ga0495613_0345789 3300046689 Unclassified 1022
197 Ga0495600_0013951 3300046809 Bacteria 5063
198 Ga0495636_0149013 3300047318 Unclassified 1049
199 Ga0495680_0407049 3300047322 Bacteria 938
200 Ga0495675_0002178 3300047444 Bacteria 11684
201 Ga0495602_0450948 3300048088 Unclassified 908
202 Ga0496110_0010031 3300048913 Bacteria 7685
203 Ga0496111_0788098 3300048914 Bacteria 688
204 Ga0501036_0329437 3300049572 Bacteria 1276
205 Ga0501039_0530483 3300049575 Bacteria 924
206 Ga0501040_0059331 3300049576 Unclassified 2629
207 Ga0501040_0245826 3300049576 Bacteria 1276
208 Ga0501040_0304769 3300049576 Unclassified 1139
209 Ga0501041_0089671 3300049577 Unclassified 1898
210 Ga0501042_0013357 3300049578 Bacteria 5587
211 Ga0501042_0724009 3300049578 Bacteria 724
212 Ga0501046_0400738 3300049580 Unclassified 991
213 Ga0501071_0019639 3300049587 Bacteria 4690
214 Ga0501072_0102624 3300049588 Unclassified 2273
215 Ga0501075_0379022 3300049591 Unclassified 1078
216 Ga0501076_0928626 3300049592 Unclassified 717
217 Ga0501077_0556503 3300049593 Unclassified 736
218 Ga0501079_0258370 3300049741 Unclassified 1361
219 Ga0501045_0035121 3300049824 Bacteria 3640
220 nmdc:mga05p37_341929_c1 3300050507 Bacteria 1764
221 nmdc:mga05p37_362034_c1 3300050507 Unclassified 1705
222 nmdc:mga05p37_4007_c1 3300050507 Bacteria 17218
223 nmdc:mga05p37_589584_c1 3300050507 Bacteria 1257
224 nmdc:mga09592_17357_c1 3300050508 Bacteria 5896
225 nmdc:mga06r32_17679_c1 3300050510 Bacteria 6513
226 nmdc:mga06r32_177275_c1 3300050510 Bacteria 2116
227 nmdc:mga06r32_998514_c1 3300050510 Bacteria 790
228 nmdc:mga08y16_231750_c1 3300050511 Bacteria 1910
229 nmdc:mga08y16_320269_c1 3300050511 Unclassified 1596
230 nmdc:mga08y16_6365_c1 3300050511 Bacteria 12384
231 nmdc:mga0n895_223785_c1 3300050512 Bacteria 1910
232 nmdc:mga0n895_34082_c1 3300050512 Unclassified 4899
233 nmdc:mga0n895_476129_c1 3300050512 Unclassified 1260
234 nmdc:mga0rr50_205200_c1 3300050513 Unclassified 1622
235 nmdc:mga0rr50_53211_c1 3300050513 Unclassified 2094
236 nmdc:mga08x19_294757_c1 3300050514 Unclassified 1126
237 nmdc:mga0a205_606762_c1 3300050515 Bacteria 947
238 Ga0495595_0004519 3300053084 Bacteria 5598
239 Ga0495619_0166636 3300053085 Unclassified 1523
240 Ga0501084_0108752 3300054114 Unclassified 2329
241 Ga0501084_0647089 3300054114 Unclassified 892
242 Ga0590071_005604 3300059421 Bacteria 3019
243 Ga0590071_010442 3300059421 Unclassified 2175
244 Ga0590075_019694 3300059424 Unclassified 1676
245 Ga0590077_018195 3300059426 Unclassified 1483
246 Ga0501082_0144999 3300060353 Bacteria 2061
247 Ga0501082_0185707 3300060353 Unclassified 1809
248 Ga0530510_0126154 3300061734 Unclassified 1881
249 Ga0530510_0421744 3300061734 Unclassified 1007
250 Ga0495628_0370918
251 JGI26145J50221_1001229
252 Ga0065707_10126751
253 Ga0065707_10564244
254 Ga0070676_10325566
255 Ga0070676_10558031
256 Ga0070676_10718213
257 Ga0070690_100145611
258 Ga0070690_100436664
259 Ga0070677_10011935
260 Ga0068869_100200076
261 Ga0070689_100133274
262 Ga0070669_100292370
263 Ga0070675_101014229
264 Ga0070674_100000114
265 Ga0070674_100217673
266 Ga0070673_100101952
267 Ga0070703_10118703
268 Ga0070709_10000058
269 Ga0070701_10213361
270 Ga0070705_100457318
271 Ga0068867_100049006
272 Ga0070706_100028177
273 Ga0070706_100178655
274 Ga0070706_100317710
275 Ga0070707_100350370
276 Ga0070707_100480755
277 Ga0070698_100002554
278 Ga0070698_100026991
279 Ga0070698_100470866
280 Ga0070699_100000535
281 Ga0070699_100000820
282 Ga0070699_100004049
283 Ga0070697_100008258
284 Ga0070697_100056815
285 Ga0070672_100952347
286 Ga0070686_100757697
287 Ga0070696_100014980
288 Ga0070696_100105861
289 Ga0070704_100028540
290 Ga0070704_100094408
291 Ga0070704_100196828
292 Ga0070704_100771444
293 Ga0070664_101555177
294 Ga0068857_100007582
295 Ga0068854_100707754
296 Ga0070702_100377456
297 Ga0068859_100214355
298 Ga0068859_100628771
299 Ga0068864_101121536
300 Ga0068861_100585725
301 Ga0068863_100366973
302 Ga0068858_100003179
303 Ga0068858_100183892
304 Ga0068860_100329916
305 Ga0068860_100431355
306 Ga0068860_100684705
307 Ga0070717_10084887
308 Ga0075432_10083802
309 Ga0070716_100049101
310 Ga0097621_100098007
311 Ga0097621_100172733
312 Ga0068871_100565728
313 Ga0068871_100614849
314 Ga0075428_100081659
315 Ga0075428_100753505
316 Ga0075428_101036072
317 Ga0075431_100018322
318 Ga0075431_100441821
319 Ga0075431_100449623
320 Ga0075433_10290723
321 Ga0075434_100089094
322 Ga0075434_100244026
323 Ga0075434_100307491
324 Ga0075434_100620486
325 Ga0075429_100110034
326 Ga0075429_100127689
327 Ga0075429_100160340
328 Ga0068865_100779286
329 Ga0075436_100106982
330 Ga0075436_100488091
331 Ga0097620_100214346
332 Ga0097620_100628798
333 Ga0075435_100405681
334 Ga0075435_100486340
335 Ga0099794_10373452
336 Ga0099794_10431306
337 Ga0111539_10431421
338 Ga0111539_10490882
339 Ga0111539_10534555
340 Ga0105245_10005629
341 Ga0105247_10003760
342 Ga0114129_10021223
343 Ga0114129_10082925
344 Ga0114129_10492582
345 Ga0114129_10585128
346 Ga0114129_12135541
347 Ga0105241_10797915
348 Ga0105242_10245293
349 Ga0105248_10010387
350 Ga0105248_10078629
351 Ga0105248_10571790
352 Ga0105249_10227799
353 Ga0105249_10994537
354 Ga0105249_11648866
355 Ga0099796_10044463
356 Ga0157373_10578230
357 Ga0157378_12003569
358 Ga0163162_10007769
359 Ga0163162_10187641
360 Ga0163163_10000056
361 Ga0157380_10021303
362 Ga0157380_10811698
363 Ga0157380_12192912
364 Ga0157379_10009510
365 Ga0163161_11192456
366 Ga0213875_10003489
367 Ga0207653_10256463
368 Ga0207682_10007841
369 Ga0207710_10022242
370 Ga0207699_10000065
371 Ga0207645_10060265
372 Ga0207684_10015582
373 Ga0207684_10128385
374 Ga0207681_10656575
375 Ga0207687_10003248
376 Ga0207690_10603101
377 Ga0207686_10163747
378 Ga0207709_10771428
379 Ga0207670_10154248
380 Ga0207669_10000700
381 Ga0207669_10061757
382 Ga0207669_10696546
383 Ga0207665_10036654
384 Ga0207691_10277490
385 Ga0207711_10042326
386 Ga0207711_10142815
387 Ga0207689_10414274
388 Ga0207689_10677671
389 Ga0207651_10094872
390 Ga0207651_10645107
391 Ga0207703_10049649
392 Ga0207703_10118963
393 Ga0207703_10147282
394 Ga0207708_10501181
395 Ga0207641_10326579
396 Ga0207674_10027992
397 Ga0207675_100238516
398 Ga0207675_100329776
399 Ga0207675_100413260
400 Ga0209996_1008345
401 Ga0210000_1034777
402 Ga0209995_1004842
403 Ga0209968_1001506
404 Ga0209982_1001276
405 Ga0209970_1001271
406 Ga0210002_1001015
407 Ga0209983_1001699
408 Ga0209971_1001851
409 Ga0209966_1007271
410 Ga0209974_10001171
411 Ga0268264_10443637
412 Ga0307412_10129667
413 Ga0307409_100052630
414 Ga0307409_100673327
415 Ga0307416_100217763
416 Ga0307416_100219345
417 Ga0307416_100456053
418 Ga0307415_100266028
419 Ga0373936_0204033
420 Ga0373956_0135369
421 Ga0373957_0001333
422 Ga0373955_0058712
423 Ga0373947_0262782
424 Ga0373947_0318212
425 Ga0373937_0058103
426 Ga0373937_0666875
427 Ga0395900_0460375
428 Ga0436364_0001534
429 Ga0439431_0095520
430 Ga0439435_0064089
431 Ga0453683_0085925
432 Ga0495592_0065967
433 Ga0495653_0197899
434 Ga0495580_0488574
435 Ga0495594_0049684
436 Ga0495608_0046745
437 Ga0495628_0002012
438 Ga0495628_0124434
439 Ga0495652_0161376
440 Ga0495656_0285163
441 Ga0495659_0102986
442 Ga0495588_0034046
443 Ga0495657_0239269
444 Ga0495599_0041515
445 Ga0495613_0345789
446 Ga0495600_0013951
447 Ga0495636_0149013
448 Ga0495680_0407049
449 Ga0495675_0002178
450 Ga0495602_0450948
451 Ga0496110_0010031
452 Ga0496111_0788098
453 Ga0501036_0329437
454 Ga0501039_0530483
455 Ga0501040_0059331
456 Ga0501040_0245826
457 Ga0501040_0304769
458 Ga0501041_0089671
459 Ga0501042_0013357
460 Ga0501042_0724009
461 Ga0501046_0400738
462 Ga0501071_0019639
463 Ga0501072_0102624
464 Ga0501075_0379022
465 Ga0501076_0928626
466 Ga0501077_0556503
467 Ga0501079_0258370
468 Ga0501045_0035121
469 nmdc:mga05p37_341929_c1
470 nmdc:mga05p37_362034_c1
471 nmdc:mga05p37_4007_c1
472 nmdc:mga05p37_589584_c1
473 nmdc:mga09592_17357_c1
474 nmdc:mga06r32_17679_c1
475 nmdc:mga06r32_177275_c1
476 nmdc:mga06r32_998514_c1
477 nmdc:mga08y16_231750_c1
478 nmdc:mga08y16_320269_c1
479 nmdc:mga08y16_6365_c1
480 nmdc:mga0n895_223785_c1
481 nmdc:mga0n895_34082_c1
482 nmdc:mga0n895_476129_c1
483 nmdc:mga0rr50_205200_c1
484 nmdc:mga0rr50_53211_c1
485 nmdc:mga08x19_294757_c1
486 nmdc:mga0a205_606762_c1
487 Ga0495595_0004519
488 Ga0495619_0166636
489 Ga0501084_0108752
490 Ga0501084_0647089
491 Ga0590071_005604
492 Ga0590071_010442
493 Ga0590075_019694
494 Ga0590077_018195
495 Ga0501082_0144999
496 Ga0501082_0185707
497 Ga0530510_0126154
498 Ga0530510_0421744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08002

DUF1697

Protein of unknown function (DUF1697)

1

109

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vdf-assembly3.cif.gz_F crystal structure of cu(i)-loaded yeast atx1: crystal form ii 0.6352 2 69
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.6252 2 171
7zc3-assembly1.cif.gz_A crystal structure of human copper chaperone atox1 bound to zinc ion by cxxc motif 0.6228 1 70
1kvj-assembly1.cif.gz_A solution structure of the cu(i) bound form of the first heavy metal binding motif of the menkes protein 0.6224 2 70
7a8w-assembly2.cif.gz_EEE complex of rice blast (magnaporthe oryzae) effector protein avr-pikc with an engineered hma domain of pikp-1 from rice (oryza sativa) 0.6155 2 70
ID Description Score Start End Superfamily
af_Q54C13_1_90_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8092 2 78 3.30.70.1280
2hiyB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.7149 2 80 3.30.70.1280
af_Q54C13_1_90_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.7016 2 78 3.30.70.1280
af_Q10357_2_72_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6779 1 70 3.30.70.100
af_Q9FVS0_32_104_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.656 2 70 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A524HME6-F1-model_v4 DUF1697 domain-containing protein 0.9819 1 175
AF-A0A2V8FG13-F1-model_v4 DUF1697 domain-containing protein 0.9802 1 171
AF-A0A3D0QFJ1-F1-model_v4 DUF1697 domain-containing protein 0.9773 1 175
AF-A0A524HME6-F1-model_v4 DUF1697 domain-containing protein 0.9764 1 175
AF-A0A2V8HKV8-F1-model_v4 DUF1697 domain-containing protein 0.9758 1 175

Map