F360909

General Info

Members Datasets Scaffolds Average Seq Length
249 163 498 170

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0019172|Ga0395905_0019172_4352_4885
Length 177
Sequence MTATTRSELMAFLDKVGADHRTTDHPAVFRVGEGEAIKDEIPGAHTKNLFLKDAKGQLWLISAEGHAVIDLKRLHPVIGSARLSFGSAELMAETLGVTPGSVTAFALINDRTAHRVRFVLDRTLAEAELVNFHPLTNTATTTISQAGFRKFLAAVGVAPLVVDFAAMRVVEAPAAAR

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
17 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
26 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
28 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
30 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
31 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
51 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
52 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
53 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
54 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
60 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
61 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
62 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
65 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
66 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
67 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
68 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
69 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
70 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
73 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
74 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
75 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
76 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
77 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
78 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
79 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
80 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
81 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
82 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
85 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
86 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
87 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
88 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
91 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
92 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
93 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
117 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
118 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
119 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
120 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
121 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
122 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
123 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
124 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
125 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
126 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
127 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
128 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
129 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
130 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
133 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
134 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
135 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
136 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
137 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
138 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
139 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
140 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
141 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
142 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
143 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
144 2643221583 Caulobacter sp. Root655 Isolate Unclassified
145 2643221584 Caulobacter sp. Root656 Isolate Unclassified
146 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
147 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
148 2643221640 Caulobacter sp. Root342 Isolate Unclassified
149 2643221642 Caulobacter sp. Root343 Isolate Unclassified
150 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
151 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
152 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
153 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
154 2818991435 Caulobacter henricii 536 Isolate Unclassified
155 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
156 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
157 2849560528 Caulobacter zeae 410 Isolate Unclassified
158 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
159 2851153111 Caulobacter radicis 736 Isolate Unclassified
160 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
161 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
162 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
163 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.16
Metatranscriptomes 0
Isolates 10.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.91
Nodule 0
Rhizoplane 2.81
Rhizosphere 56.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0019172 3300037471 Bacteria 6487
2 rootL2_10065417 3300003322 Bacteria 4688
3 rootL2_10174697 3300003322 Bacteria 1196
4 Ga0055526_1062060 3300003771 Bacteria 792
5 Ga0055536_1015836 3300003781 Bacteria 2557
6 Ga0055536_1020227 3300003781 Bacteria 2063
7 Ga0055528_1009094 3300003790 Bacteria 4188
8 Ga0055530_10014973 3300003791 Bacteria 2557
9 Ga0055530_10019376 3300003791 Bacteria 2063
10 Ga0055540_1045181 3300003792 Bacteria 931
11 Ga0055531_10000947 3300003794 Bacteria 23329
12 Ga0055531_10006144 3300003794 Bacteria 6874
13 Ga0065165_1001692 3300005262 Bacteria 22261
14 Ga0065715_10473623 3300005293 Bacteria 804
15 Ga0070658_10531959 3300005327 Bacteria 1016
16 Ga0070659_100014206 3300005366 Bacteria 5945
17 Ga0070705_100864810 3300005440 Bacteria 724
18 Ga0070663_100317867 3300005455 Bacteria 1251
19 Ga0068856_100721848 3300005614 Bacteria 1017
20 Ga0075369_10075030 3300006186 Bacteria 1493
21 Ga0075366_10225169 3300006195 Bacteria 1142
22 Ga0075370_10037880 3300006353 Bacteria 2712
23 Ga0075370_10116418 3300006353 Bacteria 1554
24 Ga0068871_100439428 3300006358 Bacteria 1168
25 Ga0105245_10442415 3300009098 Bacteria 1307
26 Ga0105239_11205418 3300010375 Bacteria 872
27 Ga0157373_10000801 3300013100 Bacteria 24325
28 Ga0157369_10648898 3300013105 Bacteria 1088
29 Ga0182008_10231332 3300014497 Bacteria 948
30 Ga0213872_10035171 3300021361 Bacteria 2291
31 Ga0209565_1000183 3300025263 Bacteria 76983
32 Ga0209673_1001961 3300025273 Bacteria 16105
33 Ga0209676_1000713 3300025292 Bacteria 45996
34 Ga0209676_1003719 3300025292 Bacteria 9084
35 Ga0209564_1003434 3300025295 Bacteria 10857
36 Ga0209564_1053676 3300025295 Bacteria 958
37 Ga0209758_1002141 3300025297 Bacteria 20813
38 Ga0209758_1004255 3300025297 Bacteria 12107
39 Ga0209050_1002591 3300025298 Bacteria 14992
40 Ga0209050_1007241 3300025298 Bacteria 6291
41 Ga0209050_1019749 3300025298 Bacteria 2543
42 Ga0209256_1001520 3300025299 Bacteria 23400
43 Ga0209256_1006003 3300025299 Bacteria 6654
44 Ga0209256_1006940 3300025299 Bacteria 5784
45 Ga0209256_1007750 3300025299 Bacteria 5196
46 Ga0209051_1013720 3300025303 Bacteria 3833
47 Ga0209257_1000282 3300025304 Bacteria 113789
48 Ga0209257_1000352 3300025304 Bacteria 94530
49 Ga0209257_1012368 3300025304 Bacteria 3958
50 Ga0207690_10547912 3300025932 Bacteria 940
51 Ga0207689_10072852 3300025942 Bacteria 2822
52 Ga0207668_10267358 3300025972 Bacteria 1396
53 Ga0207658_10470195 3300025986 Bacteria 1116
54 Ga0207639_10011488 3300026041 Bacteria 6153
55 Ga0207678_10694283 3300026067 Bacteria 895
56 Ga0207702_10321352 3300026078 Bacteria 1474
57 Ga0265337_1014554 3300028556 Bacteria 2606
58 Ga0307515_10041561 3300028794 Bacteria 7223
59 Ga0307515_10057851 3300028794 Bacteria 5601
60 Ga0307515_10079623 3300028794 Bacteria 4288
61 Ga0265331_10180940 3300031250 Bacteria 952
62 Ga0265327_10000287 3300031251 Bacteria 99268
63 Ga0265327_10006150 3300031251 Bacteria 9712
64 Ga0307513_10003286 3300031456 Bacteria 22017
65 Ga0307513_10174402 3300031456 Bacteria 2023
66 Ga0307408_100660427 3300031548 Bacteria 936
67 Ga0307406_10053410 3300031901 Bacteria 2574
68 Ga0307412_11550631 3300031911 Bacteria 604
69 Ga0307510_10212743 3300033180 Bacteria 1454
70 Ga0373946_0546485 3300035171 Bacteria 597
71 Ga0373927_0000111 3300035695 Bacteria 62031
72 Ga0373947_0868473 3300035725 Bacteria 616
73 Ga0373925_0000209 3300037068 Bacteria 64086
74 Ga0373925_0085319 3300037068 Bacteria 2407
75 Ga0395899_0349016 3300037312 Bacteria 990
76 Ga0395899_0582831 3300037312 Bacteria 715
77 Ga0395900_0083605 3300037418 Bacteria 3279
78 Ga0395898_0062040 3300037466 Bacteria 3631
79 Ga0395905_0066277 3300037471 Bacteria 3382
80 Ga0395905_0087863 3300037471 Bacteria 2914
81 Ga0395905_0222313 3300037471 Bacteria 1767
82 Ga0395905_0222851 3300037471 Bacteria 1765
83 Ga0395901_0046138 3300038443 Bacteria 4525
84 Ga0395901_0368230 3300038443 Bacteria 1481
85 Ga0436361_0022994 3300039447 Bacteria 2360
86 Ga0436361_1172597 3300039447 Bacteria 1038
87 Ga0450912_018302 3300042116 Bacteria 661
88 Ga0439446_0002368 3300042156 Bacteria 4513
89 Ga0439459_0002365 3300042438 Bacteria 2900
90 Ga0466968_0207540 3300044735 Bacteria 919
91 Ga0495627_000654 3300046453 Bacteria 26690
92 Ga0495590_0018262 3300046457 Bacteria 2511
93 Ga0495638_0000230 3300046460 Bacteria 76565
94 Ga0495638_0000688 3300046460 Bacteria 36751
95 Ga0495638_0001674 3300046460 Bacteria 19617
96 Ga0495638_0002962 3300046460 Bacteria 13549
97 Ga0495638_0004141 3300046460 Bacteria 11075
98 Ga0495638_0303430 3300046460 Bacteria 859
99 Ga0495650_0000207 3300046471 Bacteria 127568
100 Ga0495650_0037827 3300046471 Bacteria 2096
101 Ga0495585_0037628 3300046492 Bacteria 2725
102 Ga0495607_0303111 3300046501 Bacteria 751
103 Ga0495583_0000025 3300046506 Bacteria 263775
104 Ga0495583_0285968 3300046506 Bacteria 657
105 Ga0495606_0034009 3300046507 Bacteria 3505
106 Ga0495606_0081980 3300046507 Bacteria 2004
107 Ga0495610_0000140 3300046512 Bacteria 80219
108 Ga0495610_0002440 3300046512 Bacteria 15640
109 Ga0495610_0006540 3300046512 Bacteria 7985
110 Ga0495610_0145597 3300046512 Bacteria 1015
111 Ga0495616_0000105 3300046513 Bacteria 72439
112 Ga0495616_0163120 3300046513 Bacteria 1001
113 Ga0495620_0145273 3300046515 Bacteria 926
114 Ga0495631_0006312 3300046518 Bacteria 6134
115 Ga0495637_0010464 3300046520 Bacteria 4483
116 Ga0495643_0041220 3300046522 Bacteria 2518
117 Ga0495643_0102392 3300046522 Bacteria 1466
118 Ga0495648_0000039 3300046524 Bacteria 185430
119 Ga0495648_0026991 3300046524 Bacteria 3854
120 Ga0495648_0083974 3300046524 Bacteria 1803
121 Ga0495663_0061882 3300046525 Bacteria 1178
122 Ga0495654_0000016 3300046530 Bacteria 306416
123 Ga0495654_0127172 3300046530 Bacteria 1147
124 Ga0495654_0179696 3300046530 Bacteria 917
125 Ga0495597_0019332 3300046542 Bacteria 3188
126 Ga0495597_0069348 3300046542 Bacteria 1522
127 Ga0495597_0216461 3300046542 Bacteria 762
128 Ga0495668_0000040 3300046616 Bacteria 230681
129 Ga0495668_0001804 3300046616 Bacteria 19521
130 Ga0495668_0033508 3300046616 Bacteria 2885
131 Ga0495668_0038359 3300046616 Bacteria 2677
132 Ga0495668_0058733 3300046616 Bacteria 2122
133 Ga0495625_0000043 3300046660 Bacteria 205715
134 Ga0495625_0002055 3300046660 Bacteria 22587
135 Ga0495625_0006044 3300046660 Bacteria 10871
136 Ga0495625_0032838 3300046660 Bacteria 3843
137 Ga0495625_0064856 3300046660 Bacteria 2575
138 Ga0495625_0141648 3300046660 Bacteria 1621
139 Ga0495659_0075755 3300046664 Bacteria 1268
140 Ga0495670_0296476 3300046691 Bacteria 866
141 Ga0495671_0520923 3300046692 Bacteria 567
142 Ga0495589_0016002 3300046794 Bacteria 3855
143 Ga0495660_0003096 3300046810 Bacteria 10368
144 Ga0495660_0143082 3300046810 Bacteria 1188
145 Ga0495672_0001651 3300047320 Bacteria 21680
146 Ga0495683_0056841 3300047323 Bacteria 1946
147 Ga0495679_013119 3300047446 Bacteria 3124
148 Ga0495673_0000148 3300047469 Bacteria 124135
149 Ga0495673_0000223 3300047469 Bacteria 84150
150 Ga0495673_0003725 3300047469 Bacteria 9903
151 Ga0495681_0042290 3300047470 Bacteria 2206
152 Ga0495681_0059817 3300047470 Bacteria 1760
153 Ga0495681_0091614 3300047470 Bacteria 1341
154 Ga0495686_0001955 3300047472 Bacteria 20498
155 Ga0495686_0017397 3300047472 Bacteria 4845
156 Ga0495686_0024569 3300047472 Bacteria 3957
157 Ga0495686_0173896 3300047472 Bacteria 1251
158 Ga0495686_0363899 3300047472 Bacteria 783
159 Ga0495686_0453959 3300047472 Bacteria 680
160 Ga0496101_0105055 3300048904 Bacteria 2119
161 Ga0496106_0004003 3300048909 Bacteria 11016
162 Ga0496107_0009429 3300048910 Bacteria 6773
163 Ga0496113_0605849 3300048916 Bacteria 877
164 Ga0496114_0833825 3300048917 Bacteria 802
165 Ga0496115_0003294 3300048918 Bacteria 11596
166 Ga0496115_0425734 3300048918 Bacteria 1075
167 Ga0496121_0008019 3300048924 Bacteria 12597
168 Ga0496121_0478150 3300048924 Bacteria 796
169 Ga0496121_0621328 3300048924 Bacteria 663
170 Ga0496122_0198376 3300048925 Bacteria 1176
171 Ga0496123_0233725 3300048926 Bacteria 918
172 Ga0496124_0019539 3300048927 Bacteria 6299
173 Ga0496125_0037050 3300048928 Bacteria 4246
174 Ga0496125_0123245 3300048928 Bacteria 1843
175 Ga0496126_0219546 3300048929 Bacteria 1597
176 Ga0495678_001042 3300049459 Bacteria 23497
177 Ga0501033_0001194 3300049570 Bacteria 23444
178 Ga0501033_0155474 3300049570 Bacteria 1648
179 Ga0501034_0015644 3300049571 Bacteria 7793
180 Ga0501037_0006806 3300049573 Bacteria 8357
181 Ga0501037_0173420 3300049573 Bacteria 1532
182 Ga0501047_0568783 3300049581 Bacteria 957
183 Ga0501238_002086 3300049671 Bacteria 2355
184 Ga0501035_0026275 3300049822 Bacteria 5328
185 Ga0501044_0012942 3300049823 Bacteria 9031
186 Ga0501044_0052905 3300049823 Bacteria 4180
187 Ga0501044_0526816 3300049823 Bacteria 1081
188 Ga0501044_0747046 3300049823 Bacteria 861
189 nmdc:mga07m45_521440_c1 3300050496 Bacteria 688
190 nmdc:mga07m45_77321_c1 3300050496 Bacteria 1898
191 nmdc:mga0sz30_49459_c1 3300050516 Bacteria 1781
192 Ga0500578_0000041 3300053086 Bacteria 129580
193 Ga0500578_0081036 3300053086 Bacteria 2064
194 Ga0500578_0288929 3300053086 Bacteria 976
195 Ga0500644_0000984 3300053088 Bacteria 8874
196 Ga0500646_0013396 3300053090 Bacteria 2122
197 Ga0500641_0001351 3300053096 Bacteria 8719
198 Ga0500641_0018617 3300053096 Bacteria 2615
199 Ga0500554_002712 3300053102 Bacteria 3523
200 Ga0500556_0000688 3300053104 Bacteria 20792
201 Ga0500562_000786 3300053108 Bacteria 7753
202 Ga0500594_0000437 3300053118 Bacteria 9204
203 Ga0500608_001004 3300053122 Bacteria 10128
204 Ga0500618_000022 3300053125 Bacteria 157907
205 Ga0500658_0003982 3300053134 Bacteria 5546
206 Ga0500559_0000054 3300053136 Bacteria 90695
207 Ga0500559_0002343 3300053136 Bacteria 9908
208 Ga0500559_0002849 3300053136 Bacteria 8736
209 Ga0500559_0330400 3300053136 Bacteria 714
210 Ga0500564_001058 3300053138 Bacteria 9075
211 Ga0500577_0003995 3300053142 Bacteria 3862
212 Ga0500616_0058887 3300053153 Bacteria 1996
213 Ga0500616_0084919 3300053153 Bacteria 1583
214 Ga0500616_0170226 3300053153 Bacteria 990
215 Ga0500622_0010718 3300053156 Bacteria 5016
216 Ga0500622_0010795 3300053156 Bacteria 4995
217 Ga0500622_0011138 3300053156 Bacteria 4910
218 Ga0500622_0044758 3300053156 Bacteria 2293
219 Ga0500627_0062046 3300053158 Bacteria 1645
220 Ga0500645_003371 3300053730 Bacteria 6535
221 Ga0500609_000550 3300053731 Bacteria 5666
222 Ga0500599_039432 3300053736 Bacteria 725
223 2511120590 2510917020 Bacteria 5657507
224 2585150165 2582581279 Bacteria 4980720
225 2585154560 2582581280 Bacteria 5994497
226 2585198551 2582581293 Bacteria 5907401
227 2587919841 2585428106 Bacteria 5179711
228 2643750380 2643221545 Bacteria 5083237
229 2643780322 2643221552 Bacteria 5708754
230 2643926937 2643221583 Bacteria 5218014
231 2643932162 2643221584 Bacteria 5511711
232 2644001161 2643221598 Bacteria 4578346
233 2644087568 2643221614 Bacteria 4260023
234 2644223532 2643221640 Bacteria 5258820
235 2644236379 2643221642 Bacteria 5357871
236 2644344388 2643221661 Bacteria 4267604
237 2644366927 2643221666 Bacteria 4265935
238 2644507269 2643221691 Bacteria 5093099
239 2792461242 2791355048 Bacteria 5832535
240 2819538349 2818991435 Bacteria 5433759
241 2819649401 2818991454 Bacteria 5563326
242 2843745311 2843744320 Bacteria 5659202
243 2849564588 2849560528 Bacteria 5393480
244 2849577699 2849573788 Bacteria 5421256
245 2851155675 2851153111 Bacteria 5542585
246 2857505909 2857504554 Bacteria 5369913
247 2884963731 2884960567 Bacteria 5437054
248 2898331083 2898329390 Bacteria 5168154
249 2928531982 2928531327 Bacteria 5101314
250 Ga0395905_0019172
251 rootL2_10065417
252 rootL2_10174697
253 Ga0055526_1062060
254 Ga0055536_1015836
255 Ga0055536_1020227
256 Ga0055528_1009094
257 Ga0055530_10014973
258 Ga0055530_10019376
259 Ga0055540_1045181
260 Ga0055531_10000947
261 Ga0055531_10006144
262 Ga0065165_1001692
263 Ga0065715_10473623
264 Ga0070658_10531959
265 Ga0070659_100014206
266 Ga0070705_100864810
267 Ga0070663_100317867
268 Ga0068856_100721848
269 Ga0075369_10075030
270 Ga0075366_10225169
271 Ga0075370_10037880
272 Ga0075370_10116418
273 Ga0068871_100439428
274 Ga0105245_10442415
275 Ga0105239_11205418
276 Ga0157373_10000801
277 Ga0157369_10648898
278 Ga0182008_10231332
279 Ga0213872_10035171
280 Ga0209565_1000183
281 Ga0209673_1001961
282 Ga0209676_1000713
283 Ga0209676_1003719
284 Ga0209564_1003434
285 Ga0209564_1053676
286 Ga0209758_1002141
287 Ga0209758_1004255
288 Ga0209050_1002591
289 Ga0209050_1007241
290 Ga0209050_1019749
291 Ga0209256_1001520
292 Ga0209256_1006003
293 Ga0209256_1006940
294 Ga0209256_1007750
295 Ga0209051_1013720
296 Ga0209257_1000282
297 Ga0209257_1000352
298 Ga0209257_1012368
299 Ga0207690_10547912
300 Ga0207689_10072852
301 Ga0207668_10267358
302 Ga0207658_10470195
303 Ga0207639_10011488
304 Ga0207678_10694283
305 Ga0207702_10321352
306 Ga0265337_1014554
307 Ga0307515_10041561
308 Ga0307515_10057851
309 Ga0307515_10079623
310 Ga0265331_10180940
311 Ga0265327_10000287
312 Ga0265327_10006150
313 Ga0307513_10003286
314 Ga0307513_10174402
315 Ga0307408_100660427
316 Ga0307406_10053410
317 Ga0307412_11550631
318 Ga0307510_10212743
319 Ga0373946_0546485
320 Ga0373927_0000111
321 Ga0373947_0868473
322 Ga0373925_0000209
323 Ga0373925_0085319
324 Ga0395899_0349016
325 Ga0395899_0582831
326 Ga0395900_0083605
327 Ga0395898_0062040
328 Ga0395905_0066277
329 Ga0395905_0087863
330 Ga0395905_0222313
331 Ga0395905_0222851
332 Ga0395901_0046138
333 Ga0395901_0368230
334 Ga0436361_0022994
335 Ga0436361_1172597
336 Ga0450912_018302
337 Ga0439446_0002368
338 Ga0439459_0002365
339 Ga0466968_0207540
340 Ga0495627_000654
341 Ga0495590_0018262
342 Ga0495638_0000230
343 Ga0495638_0000688
344 Ga0495638_0001674
345 Ga0495638_0002962
346 Ga0495638_0004141
347 Ga0495638_0303430
348 Ga0495650_0000207
349 Ga0495650_0037827
350 Ga0495585_0037628
351 Ga0495607_0303111
352 Ga0495583_0000025
353 Ga0495583_0285968
354 Ga0495606_0034009
355 Ga0495606_0081980
356 Ga0495610_0000140
357 Ga0495610_0002440
358 Ga0495610_0006540
359 Ga0495610_0145597
360 Ga0495616_0000105
361 Ga0495616_0163120
362 Ga0495620_0145273
363 Ga0495631_0006312
364 Ga0495637_0010464
365 Ga0495643_0041220
366 Ga0495643_0102392
367 Ga0495648_0000039
368 Ga0495648_0026991
369 Ga0495648_0083974
370 Ga0495663_0061882
371 Ga0495654_0000016
372 Ga0495654_0127172
373 Ga0495654_0179696
374 Ga0495597_0019332
375 Ga0495597_0069348
376 Ga0495597_0216461
377 Ga0495668_0000040
378 Ga0495668_0001804
379 Ga0495668_0033508
380 Ga0495668_0038359
381 Ga0495668_0058733
382 Ga0495625_0000043
383 Ga0495625_0002055
384 Ga0495625_0006044
385 Ga0495625_0032838
386 Ga0495625_0064856
387 Ga0495625_0141648
388 Ga0495659_0075755
389 Ga0495670_0296476
390 Ga0495671_0520923
391 Ga0495589_0016002
392 Ga0495660_0003096
393 Ga0495660_0143082
394 Ga0495672_0001651
395 Ga0495683_0056841
396 Ga0495679_013119
397 Ga0495673_0000148
398 Ga0495673_0000223
399 Ga0495673_0003725
400 Ga0495681_0042290
401 Ga0495681_0059817
402 Ga0495681_0091614
403 Ga0495686_0001955
404 Ga0495686_0017397
405 Ga0495686_0024569
406 Ga0495686_0173896
407 Ga0495686_0363899
408 Ga0495686_0453959
409 Ga0496101_0105055
410 Ga0496106_0004003
411 Ga0496107_0009429
412 Ga0496113_0605849
413 Ga0496114_0833825
414 Ga0496115_0003294
415 Ga0496115_0425734
416 Ga0496121_0008019
417 Ga0496121_0478150
418 Ga0496121_0621328
419 Ga0496122_0198376
420 Ga0496123_0233725
421 Ga0496124_0019539
422 Ga0496125_0037050
423 Ga0496125_0123245
424 Ga0496126_0219546
425 Ga0495678_001042
426 Ga0501033_0001194
427 Ga0501033_0155474
428 Ga0501034_0015644
429 Ga0501037_0006806
430 Ga0501037_0173420
431 Ga0501047_0568783
432 Ga0501238_002086
433 Ga0501035_0026275
434 Ga0501044_0012942
435 Ga0501044_0052905
436 Ga0501044_0526816
437 Ga0501044_0747046
438 nmdc:mga07m45_521440_c1
439 nmdc:mga07m45_77321_c1
440 nmdc:mga0sz30_49459_c1
441 Ga0500578_0000041
442 Ga0500578_0081036
443 Ga0500578_0288929
444 Ga0500644_0000984
445 Ga0500646_0013396
446 Ga0500641_0001351
447 Ga0500641_0018617
448 Ga0500554_002712
449 Ga0500556_0000688
450 Ga0500562_000786
451 Ga0500594_0000437
452 Ga0500608_001004
453 Ga0500618_000022
454 Ga0500658_0003982
455 Ga0500559_0000054
456 Ga0500559_0002343
457 Ga0500559_0002849
458 Ga0500559_0330400
459 Ga0500564_001058
460 Ga0500577_0003995
461 Ga0500616_0058887
462 Ga0500616_0084919
463 Ga0500616_0170226
464 Ga0500622_0010718
465 Ga0500622_0010795
466 Ga0500622_0011138
467 Ga0500622_0044758
468 Ga0500627_0062046
469 Ga0500645_003371
470 Ga0500609_000550
471 Ga0500599_039432
472 2511120590
473 2585150165
474 2585154560
475 2585198551
476 2587919841
477 2643750380
478 2643780322
479 2643926937
480 2643932162
481 2644001161
482 2644087568
483 2644223532
484 2644236379
485 2644344388
486 2644366927
487 2644507269
488 2792461242
489 2819538349
490 2819649401
491 2843745311
492 2849564588
493 2849577699
494 2851155675
495 2857505909
496 2884963731
497 2898331083
498 2928531982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

25

151

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vxb-assembly1.cif.gz_A crystal structure of caulobacter crescentus proxp-ala at 1.69 angstrom 0.9897 1 167
5vxb-assembly1.cif.gz_A crystal structure of caulobacter crescentus proxp-ala at 1.69 angstrom 0.9838 1 167
1vki-assembly1.cif.gz_A crystal structure of a putative oligo-nucleotide binding protein (atu3699, agr_l_2275) from agrobacterium tumefaciens str. c58 at 1.60 a resolution 0.9534 2 161
1vki-assembly1.cif.gz_A crystal structure of a putative oligo-nucleotide binding protein (atu3699, agr_l_2275) from agrobacterium tumefaciens str. c58 at 1.60 a resolution 0.9202 2 161
1wdv-assembly2.cif.gz_B crystal structure of hypothetical protein ape2540 0.7998 7 160
ID Description Score Start End Superfamily
1vjfA00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9799 2 168 3.90.960.10
1vjfA00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9739 2 168 3.90.960.10
af_Q6PFS2_19_184_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9584 4 161 3.90.960.10
1vkiA00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9534 2 161 3.90.960.10
af_A0A0G2L4U2_9_155_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9482 26 161 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A2N5DR94-F1-model_v4 DNA-binding protein 0.9939 1 168 GO:0002161
GO:0003677
AF-A0A3S9VKH0-F1-model_v4 Prolyl-tRNA synthetase associated domain-containing protein 0.9936 1 168 GO:0002161
GO:0004812
AF-A0A2T5XJ24-F1-model_v4 deleted 0.9884 1 163
AF-A0A7W0BR59-F1-model_v4 deleted 0.988 2 164
AF-A0A7W9CK76-F1-model_v4 Ala-tRNA(Pro) deacylase (EC 3.1.1.-) 0.9879 2 161 GO:0002161

Map