F360848

General Info

Members Datasets Scaffolds Average Seq Length
249 89 498 448

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100146472|Ga0307408_1001464721
Length 481
Sequence VYSRSSAACVVEVRIVTKRLPCPPAPGPLEDYAAQFDALFARLAQRRGLRAYLQGLLLPRDRNKTMTALAGAEPIVGAQHAAVQGLQWFLTESSWDHEQVNQRRLELLGGDPATAPHDQGVLVIDDTGDRKAGTKTAHVARQYLGSVGKTDNGIVAVTSLWASERVYWPAHVIPYTPASRLPKSKRDPGFRTKPQLAAELVAAARAAKVPFRAVVADCFYGDNAGFTEALGRAGVAYVLAVKPRKGVWAPAEEAHTPQEAAGQLAWSSPEQPGDWTPVTRRFRDGHTETWWAADAALPAAGWGPDRRLRLVVATTDPATLPKLTTWYLLTNLARLKRQRMRAPFAPADLAEVVRLYSLRNWVEHGYKQVKGELGWADFQVRSDRAIRRHWLLVCCAFSFCWRAWFAEHPAQPAPAEPQATAPPGAARGETTVHQDEHVRGRGVVAGHATPGARLADPVGRARALVAGVVDRAPAGPAAAAA

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
10 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
11 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
12 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
13 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
14 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
15 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
16 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
17 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
18 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
19 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
20 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
21 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
22 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
23 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
24 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
25 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
26 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
27 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
28 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
29 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
30 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
31 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
32 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
33 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
34 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
35 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
36 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
37 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
38 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
39 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
40 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
41 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
42 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
43 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
44 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
45 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
46 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
47 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
48 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
49 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
50 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
51 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
52 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
65 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
66 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
67 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
68 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
69 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
70 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
71 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
72 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
73 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
74 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
75 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
76 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
77 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
80 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
81 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
82 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
83 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
84 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
85 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
86 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
87 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
88 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
89 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.61
Rhizosphere 96.79
Stem 0
Stem Tuber 0
Unclassified 5.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100146472 3300031548 Bacteria 1859
2 JGI25406J46586_10039572 3300003203 Bacteria 1679
3 JGI25406J46586_10043114 3300003203 Bacteria 1573
4 JGI25406J46586_10044069 3300003203 Bacteria 1547
5 JGI25407J50210_10024420 3300003373 Bacteria 1568
6 Ga0070670_100204859 3300005331 Unclassified 1714
7 Ga0070677_10057524 3300005333 Unclassified 1594
8 Ga0068853_100291178 3300005539 Bacteria 1507
9 Ga0081538_10026530 3300005981 Bacteria 4048
10 Ga0081539_10073597 3300005985 Bacteria 1822
11 Ga0075429_100114966 3300006880 Bacteria 2352
12 Ga0114129_10386070 3300009147 Bacteria 1848
13 Ga0114129_10405020 3300009147 Bacteria 1797
14 Ga0163161_10069523 3300017792 Bacteria 2574
15 Ga0307408_100073378 3300031548 Bacteria 2536
16 Ga0307408_100209127 3300031548 Bacteria 1584
17 Ga0307405_10040032 3300031731 Bacteria 2836
18 Ga0307405_10070132 3300031731 Bacteria 2249
19 Ga0307405_10078454 3300031731 Bacteria 2149
20 Ga0307405_10095757 3300031731 Bacteria 1977
21 Ga0307405_10148026 3300031731 Bacteria 1647
22 Ga0307405_10149727 3300031731 Bacteria 1639
23 Ga0307405_10150307 3300031731 Bacteria 1636
24 Ga0307405_10166445 3300031731 Bacteria 1567
25 Ga0307405_10167985 3300031731 Bacteria 1561
26 Ga0307413_10004726 3300031824 Bacteria 5979
27 Ga0307413_10066487 3300031824 Bacteria 2249
28 Ga0307413_10068559 3300031824 Bacteria 2222
29 Ga0307413_10075582 3300031824 Bacteria 2138
30 Ga0307413_10102821 3300031824 Bacteria 1892
31 Ga0307413_10122142 3300031824 Bacteria 1766
32 Ga0307413_10149338 3300031824 Bacteria 1626
33 Ga0307410_10006865 3300031852 Bacteria 6182
34 Ga0307410_10009786 3300031852 Bacteria 5396
35 Ga0307410_10056681 3300031852 Bacteria 2665
36 Ga0307410_10118800 3300031852 Bacteria 1924
37 Ga0307410_10147100 3300031852 Bacteria 1749
38 Ga0307410_10167462 3300031852 Bacteria 1652
39 Ga0307410_10167463 3300031852 Bacteria 1652
40 Ga0307410_10170468 3300031852 Bacteria 1639
41 Ga0307406_10064428 3300031901 Bacteria 2378
42 Ga0307406_10183159 3300031901 Bacteria 1526
43 Ga0307406_10188578 3300031901 Bacteria 1507
44 Ga0307407_10031666 3300031903 Bacteria 2867
45 Ga0307407_10034984 3300031903 Bacteria 2755
46 Ga0307407_10046854 3300031903 Bacteria 2449
47 Ga0307407_10053427 3300031903 Bacteria 2324
48 Ga0307407_10146741 3300031903 Bacteria 1528
49 Ga0307412_10051304 3300031911 Bacteria 2725
50 Ga0307412_10099465 3300031911 Bacteria 2054
51 Ga0307412_10099611 3300031911 Bacteria 2052
52 Ga0307412_10161707 3300031911 Bacteria 1664
53 Ga0307409_100108193 3300031995 Bacteria 2324
54 Ga0307409_100175133 3300031995 Bacteria 1892
55 Ga0307409_100177561 3300031995 Bacteria 1881
56 Ga0307409_100205811 3300031995 Bacteria 1764
57 Ga0307409_100222860 3300031995 Bacteria 1703
58 Ga0307409_100238960 3300031995 Bacteria 1652
59 Ga0307409_100266375 3300031995 Bacteria 1575
60 Ga0307416_100059006 3300032002 Bacteria 3115
61 Ga0307416_100138585 3300032002 Bacteria 2206
62 Ga0307416_100187705 3300032002 Bacteria 1945
63 Ga0307416_100238906 3300032002 Bacteria 1758
64 Ga0307416_100267959 3300032002 Bacteria 1674
65 Ga0307416_100280571 3300032002 Bacteria 1642
66 Ga0307416_100296343 3300032002 Bacteria 1604
67 Ga0307416_100299460 3300032002 Bacteria 1597
68 Ga0307416_100303813 3300032002 Bacteria 1587
69 Ga0307416_100327574 3300032002 Bacteria 1537
70 Ga0307416_100335094 3300032002 Unclassified 1522
71 Ga0307414_10060253 3300032004 Bacteria 2683
72 Ga0307414_10079641 3300032004 Bacteria 2392
73 Ga0307414_10129635 3300032004 Bacteria 1955
74 Ga0307414_10213955 3300032004 Bacteria 1577
75 Ga0307411_10069806 3300032005 Bacteria 2374
76 Ga0307411_10081520 3300032005 Bacteria 2228
77 Ga0307411_10118563 3300032005 Bacteria 1909
78 Ga0307411_10129536 3300032005 Bacteria 1841
79 Ga0307411_10158987 3300032005 Bacteria 1689
80 Ga0307415_100001373 3300032126 Bacteria 11603
81 Ga0307415_100009100 3300032126 Bacteria 5546
82 Ga0307415_100017141 3300032126 Bacteria 4336
83 Ga0307415_100018908 3300032126 Bacteria 4171
84 Ga0307415_100035886 3300032126 Bacteria 3242
85 Ga0307415_100047032 3300032126 Bacteria 2902
86 Ga0307415_100081503 3300032126 Bacteria 2311
87 Ga0307415_100085488 3300032126 Bacteria 2266
88 Ga0307415_100098726 3300032126 Bacteria 2135
89 Ga0307415_100107907 3300032126 Bacteria 2058
90 Ga0307415_100163394 3300032126 Bacteria 1728
91 Ga0307415_100188469 3300032126 Bacteria 1625
92 Ga0307415_100195362 3300032126 Bacteria 1600
93 Ga0307415_100204601 3300032126 Bacteria 1569
94 Ga0307415_100204861 3300032126 Bacteria 1568
95 Ga0307415_100215685 3300032126 Bacteria 1534
96 Ga0395899_0038001 3300037312 Bacteria 3608
97 Ga0395899_0061471 3300037312 Bacteria 2767
98 Ga0395899_0063071 3300037312 Bacteria 2727
99 Ga0395899_0063449 3300037312 Bacteria 2718
100 Ga0395899_0086642 3300037312 Unclassified 2274
101 Ga0395899_0100681 3300037312 Bacteria 2086
102 Ga0395899_0117089 3300037312 Bacteria 1911
103 Ga0395899_0130252 3300037312 Bacteria 1796
104 Ga0395899_0140528 3300037312 Bacteria 1718
105 Ga0395899_0157973 3300037312 Bacteria 1603
106 Ga0395900_0027813 3300037418 Bacteria 5793
107 Ga0395900_0061824 3300037418 Bacteria 3850
108 Ga0395900_0071057 3300037418 Bacteria 3577
109 Ga0395900_0074937 3300037418 Bacteria 3478
110 Ga0395900_0092970 3300037418 Bacteria 3098
111 Ga0395900_0101146 3300037418 Bacteria 2960
112 Ga0395900_0109827 3300037418 Bacteria 2833
113 Ga0395900_0116511 3300037418 Bacteria 2741
114 Ga0395900_0129718 3300037418 Bacteria 2584
115 Ga0395900_0143503 3300037418 Unclassified 2443
116 Ga0395900_0201571 3300037418 Bacteria 2013
117 Ga0395900_0228103 3300037418 Bacteria 1874
118 Ga0395900_0245818 3300037418 Unclassified 1793
119 Ga0395900_0251968 3300037418 Bacteria 1766
120 Ga0395900_0279266 3300037418 Bacteria 1662
121 Ga0395900_0303341 3300037418 Bacteria 1582
122 Ga0395900_0311093 3300037418 Bacteria 1558
123 Ga0395898_0012699 3300037466 Bacteria 8701
124 Ga0395898_0014202 3300037466 Bacteria 8190
125 Ga0395898_0025879 3300037466 Bacteria 5907
126 Ga0395898_0039092 3300037466 Bacteria 4698
127 Ga0395898_0053162 3300037466 Bacteria 3955
128 Ga0395898_0096093 3300037466 Bacteria 2846
129 Ga0395898_0113834 3300037466 Bacteria 2592
130 Ga0395898_0161722 3300037466 Bacteria 2141
131 Ga0395898_0176745 3300037466 Bacteria 2040
132 Ga0395898_0192523 3300037466 Bacteria 1948
133 Ga0395898_0194025 3300037466 Bacteria 1940
134 Ga0395898_0217128 3300037466 Bacteria 1824
135 Ga0395898_0234617 3300037466 Bacteria 1749
136 Ga0395898_0237482 3300037466 Bacteria 1738
137 Ga0395898_0243946 3300037466 Unclassified 1713
138 Ga0395898_0264197 3300037466 Bacteria 1641
139 Ga0395898_0276904 3300037466 Bacteria 1600
140 Ga0395898_0284446 3300037466 Bacteria 1577
141 Ga0395905_0052087 3300037471 Bacteria 3833
142 Ga0395905_0072142 3300037471 Bacteria 3237
143 Ga0395905_0078614 3300037471 Bacteria 3091
144 Ga0395905_0078943 3300037471 Bacteria 3084
145 Ga0395905_0092081 3300037471 Bacteria 2842
146 Ga0395905_0146100 3300037471 Bacteria 2225
147 Ga0395905_0152219 3300037471 Bacteria 2176
148 Ga0395905_0164239 3300037471 Bacteria 2086
149 Ga0395905_0171257 3300037471 Bacteria 2039
150 Ga0395905_0171279 3300037471 Bacteria 2039
151 Ga0395905_0235542 3300037471 Bacteria 1711
152 Ga0395905_0245269 3300037471 Bacteria 1673
153 Ga0395905_0247477 3300037471 Bacteria 1665
154 Ga0395905_0252213 3300037471 Bacteria 1648
155 Ga0395905_0253293 3300037471 Bacteria 1644
156 Ga0395905_0302686 3300037471 Bacteria 1486
157 Ga0395901_0037505 3300038443 Bacteria 5012
158 Ga0395901_0051340 3300038443 Bacteria 4287
159 Ga0395901_0063641 3300038443 Bacteria 3839
160 Ga0395901_0067815 3300038443 Bacteria 3716
161 Ga0395901_0070039 3300038443 Bacteria 3653
162 Ga0395901_0084315 3300038443 Bacteria 3321
163 Ga0395901_0106384 3300038443 Bacteria 2944
164 Ga0395901_0126617 3300038443 Bacteria 2684
165 Ga0395901_0175582 3300038443 Bacteria 2247
166 Ga0395901_0219904 3300038443 Bacteria 1985
167 Ga0395901_0220118 3300038443 Bacteria 1984
168 Ga0395901_0242053 3300038443 Bacteria 1881
169 Ga0395901_0242063 3300038443 Bacteria 1881
170 Ga0395901_0268868 3300038443 Bacteria 1773
171 Ga0395901_0301058 3300038443 Bacteria 1662
172 Ga0395901_0301742 3300038443 Bacteria 1660
173 Ga0395901_0302449 3300038443 Bacteria 1658
174 Ga0395901_0314736 3300038443 Unclassified 1620
175 Ga0395901_0315464 3300038443 Bacteria 1618
176 Ga0395901_0325597 3300038443 Unclassified 1589
177 Ga0395901_0333927 3300038443 Bacteria 1566
178 Ga0439443_004604 3300042003 Bacteria 1806
179 Ga0439448_0022187 3300042005 Bacteria 1971
180 Ga0439450_007076 3300042008 Bacteria 2043
181 Ga0439450_015512 3300042008 Bacteria 1561
182 Ga0439451_009566 3300042009 Bacteria 1961
183 Ga0439451_018279 3300042009 Bacteria 1414
184 Ga0439454_004089 3300042011 Bacteria 1660
185 Ga0439455_0000850 3300042012 Bacteria 4676
186 Ga0439456_012815 3300042013 Bacteria 1741
187 Ga0439464_0014055 3300042439 Bacteria 2149
188 Ga0439440_0011754 3300042993 Bacteria 1851
189 Ga0439440_0012256 3300042993 Bacteria 1820
190 Ga0439440_0018103 3300042993 Bacteria 1557
191 Ga0466966_0087317 3300044684 Bacteria 1938
192 Ga0466968_0005266 3300044735 Bacteria 4846
193 Ga0466957_0092410 3300044842 Bacteria 1897
194 Ga0466959_0203026 3300045049 Bacteria 1379
195 Ga0495643_0078766 3300046522 Bacteria 1719
196 Ga0495597_0062229 3300046542 Unclassified 1624
197 Ga0495661_0006312 3300046665 Bacteria 8337
198 Ga0495687_057151 3300047443 Unclassified 1624
199 Ga0496108_0169360 3300048911 Unclassified 1889
200 Ga0496109_0199789 3300048912 Bacteria 1879
201 Ga0496110_0189742 3300048913 Unclassified 1866
202 Ga0496114_0219840 3300048917 Unclassified 1667
203 Ga0501031_0020340 3300049568 Bacteria 4326
204 Ga0501032_0052618 3300049569 Bacteria 2743
205 Ga0501033_0033791 3300049570 Bacteria 3839
206 Ga0501034_0291884 3300049571 Bacteria 1568
207 Ga0501036_0222834 3300049572 Bacteria 1583
208 Ga0501037_0094447 3300049573 Bacteria 2162
209 Ga0501038_0026008 3300049574 Bacteria 5213
210 Ga0501039_0102950 3300049575 Bacteria 2228
211 Ga0501040_0130235 3300049576 Bacteria 1768
212 Ga0501041_0100340 3300049577 Bacteria 1791
213 Ga0501042_0176622 3300049578 Bacteria 1540
214 Ga0501043_0063307 3300049579 Bacteria 2904
215 Ga0501046_0181881 3300049580 Bacteria 1571
216 Ga0501047_0217843 3300049581 Bacteria 1765
217 Ga0501048_0124513 3300049582 Bacteria 1822
218 Ga0501068_0059633 3300049584 Bacteria 2317
219 Ga0501070_0180280 3300049586 Bacteria 1738
220 Ga0501071_0149029 3300049587 Bacteria 1744
221 Ga0501072_0070178 3300049588 Bacteria 2766
222 Ga0501073_0056496 3300049589 Bacteria 2745
223 Ga0501074_0006083 3300049590 Bacteria 8716
224 Ga0501075_0017623 3300049591 Bacteria 5157
225 Ga0501076_0079704 3300049592 Bacteria 2627
226 Ga0501077_0090377 3300049593 Bacteria 1940
227 Ga0501079_0106420 3300049741 Bacteria 2176
228 Ga0501079_0131849 3300049741 Bacteria 1945
229 Ga0501080_0219874 3300049742 Bacteria 1738
230 Ga0501081_0062314 3300049743 Bacteria 2586
231 Ga0501083_0123135 3300049744 Bacteria 1700
232 Ga0501035_0095855 3300049822 Bacteria 2607
233 Ga0501044_0096469 3300049823 Bacteria 2978
234 Ga0501045_0008939 3300049824 Bacteria 6996
235 nmdc:mga05p37_149604_c1 3300050507 Bacteria 2857
236 nmdc:mga05p37_340807_c1 3300050507 Bacteria 1768
237 nmdc:mga09592_103641_c1 3300050508 Bacteria 2438
238 nmdc:mga09592_32294_c1 3300050508 Bacteria 4365
239 nmdc:mga0qj67_38388_c1 3300050509 Bacteria 3757
240 nmdc:mga06r32_221854_c1 3300050510 Bacteria 1879
241 nmdc:mga0n895_314396_c1 3300050512 Bacteria 1587
242 Ga0501084_0006671 3300054114 Bacteria 9492
243 Ga0590075_020493 3300059424 Bacteria 1646
244 Ga0501082_0005675 3300060353 Bacteria 10831
245 Ga0530510_0126942 3300061734 Bacteria 1875
246 2644029561 2643221603 Bacteria 6147767
247 2644029564 2643221603 Bacteria 6147767
248 2644029608 2643221603 Bacteria 6147767
249 2644030213 2643221603 Bacteria 6147767
250 Ga0307408_100146472
251 JGI25406J46586_10039572
252 JGI25406J46586_10043114
253 JGI25406J46586_10044069
254 JGI25407J50210_10024420
255 Ga0070670_100204859
256 Ga0070677_10057524
257 Ga0068853_100291178
258 Ga0081538_10026530
259 Ga0081539_10073597
260 Ga0075429_100114966
261 Ga0114129_10386070
262 Ga0114129_10405020
263 Ga0163161_10069523
264 Ga0307408_100073378
265 Ga0307408_100209127
266 Ga0307405_10040032
267 Ga0307405_10070132
268 Ga0307405_10078454
269 Ga0307405_10095757
270 Ga0307405_10148026
271 Ga0307405_10149727
272 Ga0307405_10150307
273 Ga0307405_10166445
274 Ga0307405_10167985
275 Ga0307413_10004726
276 Ga0307413_10066487
277 Ga0307413_10068559
278 Ga0307413_10075582
279 Ga0307413_10102821
280 Ga0307413_10122142
281 Ga0307413_10149338
282 Ga0307410_10006865
283 Ga0307410_10009786
284 Ga0307410_10056681
285 Ga0307410_10118800
286 Ga0307410_10147100
287 Ga0307410_10167462
288 Ga0307410_10167463
289 Ga0307410_10170468
290 Ga0307406_10064428
291 Ga0307406_10183159
292 Ga0307406_10188578
293 Ga0307407_10031666
294 Ga0307407_10034984
295 Ga0307407_10046854
296 Ga0307407_10053427
297 Ga0307407_10146741
298 Ga0307412_10051304
299 Ga0307412_10099465
300 Ga0307412_10099611
301 Ga0307412_10161707
302 Ga0307409_100108193
303 Ga0307409_100175133
304 Ga0307409_100177561
305 Ga0307409_100205811
306 Ga0307409_100222860
307 Ga0307409_100238960
308 Ga0307409_100266375
309 Ga0307416_100059006
310 Ga0307416_100138585
311 Ga0307416_100187705
312 Ga0307416_100238906
313 Ga0307416_100267959
314 Ga0307416_100280571
315 Ga0307416_100296343
316 Ga0307416_100299460
317 Ga0307416_100303813
318 Ga0307416_100327574
319 Ga0307416_100335094
320 Ga0307414_10060253
321 Ga0307414_10079641
322 Ga0307414_10129635
323 Ga0307414_10213955
324 Ga0307411_10069806
325 Ga0307411_10081520
326 Ga0307411_10118563
327 Ga0307411_10129536
328 Ga0307411_10158987
329 Ga0307415_100001373
330 Ga0307415_100009100
331 Ga0307415_100017141
332 Ga0307415_100018908
333 Ga0307415_100035886
334 Ga0307415_100047032
335 Ga0307415_100081503
336 Ga0307415_100085488
337 Ga0307415_100098726
338 Ga0307415_100107907
339 Ga0307415_100163394
340 Ga0307415_100188469
341 Ga0307415_100195362
342 Ga0307415_100204601
343 Ga0307415_100204861
344 Ga0307415_100215685
345 Ga0395899_0038001
346 Ga0395899_0061471
347 Ga0395899_0063071
348 Ga0395899_0063449
349 Ga0395899_0086642
350 Ga0395899_0100681
351 Ga0395899_0117089
352 Ga0395899_0130252
353 Ga0395899_0140528
354 Ga0395899_0157973
355 Ga0395900_0027813
356 Ga0395900_0061824
357 Ga0395900_0071057
358 Ga0395900_0074937
359 Ga0395900_0092970
360 Ga0395900_0101146
361 Ga0395900_0109827
362 Ga0395900_0116511
363 Ga0395900_0129718
364 Ga0395900_0143503
365 Ga0395900_0201571
366 Ga0395900_0228103
367 Ga0395900_0245818
368 Ga0395900_0251968
369 Ga0395900_0279266
370 Ga0395900_0303341
371 Ga0395900_0311093
372 Ga0395898_0012699
373 Ga0395898_0014202
374 Ga0395898_0025879
375 Ga0395898_0039092
376 Ga0395898_0053162
377 Ga0395898_0096093
378 Ga0395898_0113834
379 Ga0395898_0161722
380 Ga0395898_0176745
381 Ga0395898_0192523
382 Ga0395898_0194025
383 Ga0395898_0217128
384 Ga0395898_0234617
385 Ga0395898_0237482
386 Ga0395898_0243946
387 Ga0395898_0264197
388 Ga0395898_0276904
389 Ga0395898_0284446
390 Ga0395905_0052087
391 Ga0395905_0072142
392 Ga0395905_0078614
393 Ga0395905_0078943
394 Ga0395905_0092081
395 Ga0395905_0146100
396 Ga0395905_0152219
397 Ga0395905_0164239
398 Ga0395905_0171257
399 Ga0395905_0171279
400 Ga0395905_0235542
401 Ga0395905_0245269
402 Ga0395905_0247477
403 Ga0395905_0252213
404 Ga0395905_0253293
405 Ga0395905_0302686
406 Ga0395901_0037505
407 Ga0395901_0051340
408 Ga0395901_0063641
409 Ga0395901_0067815
410 Ga0395901_0070039
411 Ga0395901_0084315
412 Ga0395901_0106384
413 Ga0395901_0126617
414 Ga0395901_0175582
415 Ga0395901_0219904
416 Ga0395901_0220118
417 Ga0395901_0242053
418 Ga0395901_0242063
419 Ga0395901_0268868
420 Ga0395901_0301058
421 Ga0395901_0301742
422 Ga0395901_0302449
423 Ga0395901_0314736
424 Ga0395901_0315464
425 Ga0395901_0325597
426 Ga0395901_0333927
427 Ga0439443_004604
428 Ga0439448_0022187
429 Ga0439450_007076
430 Ga0439450_015512
431 Ga0439451_009566
432 Ga0439451_018279
433 Ga0439454_004089
434 Ga0439455_0000850
435 Ga0439456_012815
436 Ga0439464_0014055
437 Ga0439440_0011754
438 Ga0439440_0012256
439 Ga0439440_0018103
440 Ga0466966_0087317
441 Ga0466968_0005266
442 Ga0466957_0092410
443 Ga0466959_0203026
444 Ga0495643_0078766
445 Ga0495597_0062229
446 Ga0495661_0006312
447 Ga0495687_057151
448 Ga0496108_0169360
449 Ga0496109_0199789
450 Ga0496110_0189742
451 Ga0496114_0219840
452 Ga0501031_0020340
453 Ga0501032_0052618
454 Ga0501033_0033791
455 Ga0501034_0291884
456 Ga0501036_0222834
457 Ga0501037_0094447
458 Ga0501038_0026008
459 Ga0501039_0102950
460 Ga0501040_0130235
461 Ga0501041_0100340
462 Ga0501042_0176622
463 Ga0501043_0063307
464 Ga0501046_0181881
465 Ga0501047_0217843
466 Ga0501048_0124513
467 Ga0501068_0059633
468 Ga0501070_0180280
469 Ga0501071_0149029
470 Ga0501072_0070178
471 Ga0501073_0056496
472 Ga0501074_0006083
473 Ga0501075_0017623
474 Ga0501076_0079704
475 Ga0501077_0090377
476 Ga0501079_0106420
477 Ga0501079_0131849
478 Ga0501080_0219874
479 Ga0501081_0062314
480 Ga0501083_0123135
481 Ga0501035_0095855
482 Ga0501044_0096469
483 Ga0501045_0008939
484 nmdc:mga05p37_149604_c1
485 nmdc:mga05p37_340807_c1
486 nmdc:mga09592_103641_c1
487 nmdc:mga09592_32294_c1
488 nmdc:mga0qj67_38388_c1
489 nmdc:mga06r32_221854_c1
490 nmdc:mga0n895_314396_c1
491 Ga0501084_0006671
492 Ga0590075_020493
493 Ga0501082_0005675
494 Ga0530510_0126942
495 2644029561
496 2644029564
497 2644029608
498 2644030213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13546

DDE_5

DDE superfamily endonuclease

35

302

0.86

PF01609

DDE_Tnp_1

Transposase DDE domain

116

399

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5aun-assembly1.cif.gz_B crystal structure of the hypab-ni complex 0.7055 176 226
3dez-assembly1.cif.gz_A crystal structure of orotate phosphoribosyltransferase from streptococcus mutans 0.6958 183 224
8dl5-assembly1.cif.gz_B crystal structure of plp-dependent mannich cyclase lolt 0.6858 176 226
2qgh-assembly1.cif.gz_A-2 crystal structure of diaminopimelate decarboxylase from helicobacter pylori complexed with l-lysine 0.6747 178 224
5kc8-assembly1.cif.gz_A-2 crystal structure of the amino-terminal domain (atd) of iglur delta-2 (glud2) 0.6668 179 236
ID Description Score Start End Superfamily
5auqC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7314 176 220 3.40.50.300
af_A0A0P0WFS1_170_279_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.715 177 228 3.90.550.10
5kc8A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7047 179 226 3.40.50.2300
af_A0A0P0V7K5_238_386_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7002 104 218 3.30.420.10
4rv4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.697 182 222 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A6B1MSX4-F1-model_v4 deleted 0.917 1 102
AF-A0A176L5R0-F1-model_v4 deleted 0.8896 225 350
AF-A0A6B1MPF4-F1-model_v4 deleted 0.8668 213 293
AF-A0A6J4MBK4-F1-model_v4 Mobile element protein 0.8654 1 397
AF-A0A124HVS6-F1-model_v4 Transposase IS701-like DDE domain-containing protein 0.863 1 120

Map