F360844

General Info

Members Datasets Scaffolds Average Seq Length
249 184 499 133

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10471037|Ga0307513_104710372
Length 141
Sequence MMFRRPILYALEVRDHIMIAHSLPGEFFGPAQGLHGATFIVDVAFFRETLDAHNVVVDIGRASEALSAVLKSLNYANLDAVPALAGQLTTTEFLCRHIFDEMVSRIKAGRLGPDAEGLASLRVTLHESHVARAWFEGPVSA

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
163 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
164 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
165 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
166 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
167 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
169 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
173 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
174 2643221576 Nocardioides sp. Root614 Isolate Unclassified
175 2643221590 Nocardioides sp. Root682 Isolate Unclassified
176 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
177 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
178 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
179 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
180 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
181 641522639 Methylobacterium sp. 4-46 Isolate Nodule
182 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
183 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
184 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.18
Metatranscriptomes 0
Isolates 4.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.84
Nodule 0.8
Rhizoplane 0.8
Rhizosphere 80.72
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10471037 3300031456 Bacteria 977
2 rootL2_10270381 3300003322 Bacteria 1886
3 rootH1_10114680 3300003316 Bacteria 1087
4 rootH1_10114680 3300003323 Bacteria 2212
5 Ga0070683_100348187 3300005329 Bacteria 1411
6 Ga0070682_100023472 3300005337 Bacteria 3661
7 Ga0070673_100168627 3300005364 Bacteria 1867
8 Ga0070659_100486771 3300005366 Unclassified 1050
9 Ga0070667_100070509 3300005367 Bacteria 2975
10 Ga0070714_100000141 3300005435 Bacteria 57518
11 Ga0070713_100898256 3300005436 Bacteria 852
12 Ga0070710_11297934 3300005437 Bacteria 541
13 Ga0070711_101622909 3300005439 Unclassified 566
14 Ga0070705_100024330 3300005440 Bacteria 3267
15 Ga0070708_100696091 3300005445 Bacteria 957
16 Ga0070708_101548634 3300005445 Bacteria 617
17 Ga0070662_100318736 3300005457 Bacteria 1267
18 Ga0070662_100742180 3300005457 Bacteria 832
19 Ga0070681_10121675 3300005458 Bacteria 2544
20 Ga0070681_10162507 3300005458 Bacteria 2157
21 Ga0070706_100121118 3300005467 Bacteria 2439
22 Ga0070707_100646459 3300005468 Bacteria 1020
23 Ga0070698_100144703 3300005471 Bacteria 2327
24 Ga0070679_100040512 3300005530 Bacteria 4634
25 Ga0070679_100347568 3300005530 Bacteria 1431
26 Ga0070697_100011439 3300005536 Bacteria 6936
27 Ga0070697_100478237 3300005536 Bacteria 1087
28 Ga0068853_100661442 3300005539 Bacteria 995
29 Ga0070686_100089331 3300005544 Bacteria 2058
30 Ga0070695_100004938 3300005545 Bacteria 7866
31 Ga0070696_100090453 3300005546 Bacteria 2178
32 Ga0070693_100008183 3300005547 Bacteria 5138
33 Ga0070664_100170089 3300005564 Bacteria 1933
34 Ga0068857_100456702 3300005577 Bacteria 1195
35 Ga0068856_101496581 3300005614 Bacteria 689
36 Ga0068852_100371472 3300005616 Bacteria 1401
37 Ga0068852_101824493 3300005616 Unclassified 630
38 Ga0068859_101035241 3300005617 Bacteria 902
39 Ga0068859_102274362 3300005617 Bacteria 598
40 Ga0068864_100091175 3300005618 Bacteria 2688
41 Ga0068858_100105381 3300005842 Bacteria 2631
42 Ga0068862_100313916 3300005844 Bacteria 1445
43 Ga0081540_1002000 3300005983 Bacteria 17009
44 Ga0075365_10066816 3300006038 Bacteria 2413
45 Ga0075365_10172991 3300006038 Bacteria 1508
46 Ga0075368_10030347 3300006042 Bacteria 2093
47 Ga0075363_100410425 3300006048 Bacteria 797
48 Ga0075364_10125027 3300006051 Bacteria 1724
49 Ga0075364_10345457 3300006051 Bacteria 1014
50 Ga0070715_10204389 3300006163 Bacteria 1005
51 Ga0070716_100111340 3300006173 Bacteria 1697
52 Ga0070712_100378973 3300006175 Bacteria 1164
53 Ga0075367_10079721 3300006178 Bacteria 1979
54 Ga0075370_10164181 3300006353 Bacteria 1304
55 Ga0068871_100194394 3300006358 Bacteria 1749
56 Ga0068865_100228536 3300006881 Bacteria 1458
57 Ga0075436_100054004 3300006914 Bacteria 2773
58 Ga0097620_101035405 3300006931 Bacteria 902
59 Ga0097620_102274914 3300006931 Bacteria 598
60 Ga0075435_100018061 3300007076 Bacteria 5352
61 Ga0075435_100826546 3300007076 Bacteria 807
62 Ga0105240_10022570 3300009093 Bacteria 8340
63 Ga0111539_10792939 3300009094 Unclassified 1102
64 Ga0105245_10009245 3300009098 Bacteria 8594
65 Ga0105241_10193951 3300009174 Bacteria 1692
66 Ga0105248_10242918 3300009177 Bacteria 2027
67 Ga0105248_10597684 3300009177 Bacteria 1245
68 Ga0105238_10012628 3300009551 Bacteria 8526
69 Ga0105238_10088933 3300009551 Bacteria 3075
70 Ga0105238_10504101 3300009551 Bacteria 1211
71 Ga0105238_11316790 3300009551 Bacteria 748
72 Ga0105249_10003005 3300009553 Bacteria 14544
73 Ga0105239_10254723 3300010375 Bacteria 1972
74 Ga0105239_10659861 3300010375 Unclassified 1195
75 Ga0105239_13634640 3300010375 Bacteria 501
76 Ga0105246_10738176 3300011119 Bacteria 867
77 Ga0157373_10024928 3300013100 Bacteria 4330
78 Ga0157370_10010941 3300013104 Bacteria 9524
79 Ga0157372_10016479 3300013307 Bacteria 7930
80 Ga0157375_10888488 3300013308 Unclassified 1036
81 Ga0163163_10342329 3300014325 Bacteria 1551
82 Ga0157379_10939525 3300014968 Bacteria 822
83 Ga0157376_11566706 3300014969 Bacteria 693
84 Ga0213874_10345796 3300021377 Bacteria 569
85 Ga0207685_10215092 3300025905 Bacteria 911
86 Ga0207654_11019744 3300025911 Bacteria 602
87 Ga0207707_10027101 3300025912 Bacteria 5010
88 Ga0207707_10058981 3300025912 Bacteria 3339
89 Ga0207707_10509027 3300025912 Bacteria 1026
90 Ga0207695_10095093 3300025913 Bacteria 2985
91 Ga0207693_10334757 3300025915 Bacteria 1185
92 Ga0207660_10108934 3300025917 Bacteria 2081
93 Ga0207652_10436376 3300025921 Bacteria 1181
94 Ga0207694_10000942 3300025924 Bacteria 25665
95 Ga0207694_10078365 3300025924 Bacteria 2590
96 Ga0207694_10760902 3300025924 Bacteria 818
97 Ga0207687_10024462 3300025927 Bacteria 4035
98 Ga0207700_10690462 3300025928 Bacteria 911
99 Ga0207664_10111746 3300025929 Bacteria 2273
100 Ga0207706_10662471 3300025933 Bacteria 893
101 Ga0207704_10327541 3300025938 Bacteria 1184
102 Ga0207665_10135836 3300025939 Bacteria 1750
103 Ga0207665_11095125 3300025939 Bacteria 635
104 Ga0207711_10305235 3300025941 Bacteria 1469
105 Ga0207667_10890518 3300025949 Bacteria 882
106 Ga0207658_10477574 3300025986 Bacteria 1107
107 Ga0207703_10069797 3300026035 Bacteria 2899
108 Ga0207703_11974669 3300026035 Bacteria 560
109 Ga0207639_10023424 3300026041 Bacteria 4459
110 Ga0207639_10074302 3300026041 Bacteria 2669
111 Ga0207641_10327697 3300026088 Bacteria 1454
112 Ga0207676_10217206 3300026095 Bacteria 1700
113 Ga0207674_10052436 3300026116 Bacteria 4160
114 Ga0207698_11516468 3300026142 Unclassified 686
115 Ga0209813_10033061 3300027866 Bacteria 1536
116 Ga0268265_10547266 3300028380 Bacteria 1098
117 Ga0268264_11051777 3300028381 Bacteria 821
118 Ga0265326_10067757 3300028558 Bacteria 1009
119 Ga0265318_10140263 3300028577 Bacteria 888
120 Ga0265330_10035786 3300031235 Bacteria 2215
121 Ga0265328_10000006 3300031239 Bacteria 227698
122 Ga0265328_10000055 3300031239 Bacteria 72155
123 Ga0265328_10001005 3300031239 Bacteria 12948
124 Ga0265328_10004405 3300031239 Bacteria 6117
125 Ga0265328_10006267 3300031239 Bacteria 5051
126 Ga0265328_10013426 3300031239 Bacteria 3243
127 Ga0265328_10038267 3300031239 Bacteria 1771
128 Ga0265328_10045940 3300031239 Bacteria 1606
129 Ga0265328_10063285 3300031239 Bacteria 1358
130 Ga0265328_10181911 3300031239 Bacteria 795
131 Ga0265328_10188616 3300031239 Bacteria 781
132 Ga0265325_10084163 3300031241 Bacteria 1577
133 Ga0265329_10020202 3300031242 Bacteria 2252
134 Ga0265340_10155512 3300031247 Bacteria 1041
135 Ga0265339_10071215 3300031249 Bacteria 1853
136 Ga0265331_10000178 3300031250 Bacteria 77277
137 Ga0265331_10000661 3300031250 Bacteria 29792
138 Ga0265331_10000990 3300031250 Bacteria 22356
139 Ga0265331_10003829 3300031250 Bacteria 9542
140 Ga0265327_10052591 3300031251 Bacteria 2120
141 Ga0265327_10064304 3300031251 Bacteria 1860
142 Ga0265327_10065934 3300031251 Bacteria 1829
143 Ga0265327_10068830 3300031251 Bacteria 1778
144 Ga0265327_10085726 3300031251 Bacteria 1546
145 Ga0265327_10171255 3300031251 Bacteria 997
146 Ga0265316_10000350 3300031344 Bacteria 51827
147 Ga0265316_10044284 3300031344 Bacteria 3540
148 Ga0265316_10195196 3300031344 Bacteria 1502
149 Ga0265316_10281362 3300031344 Bacteria 1215
150 Ga0307513_10005957 3300031456 Bacteria 16000
151 Ga0265313_10000374 3300031595 Bacteria 48486
152 Ga0265314_10046816 3300031711 Bacteria 3049
153 Ga0265342_10025756 3300031712 Bacteria 3692
154 Ga0265342_10180585 3300031712 Bacteria 1156
155 Ga0265342_10303956 3300031712 Bacteria 839
156 Ga0307405_11784682 3300031731 Bacteria 547
157 Ga0307410_10535168 3300031852 Bacteria 969
158 Ga0307412_11315801 3300031911 Bacteria 651
159 Ga0307409_100238812 3300031995 Bacteria 1653
160 Ga0307409_101115499 3300031995 Bacteria 810
161 Ga0307416_100387894 3300032002 Bacteria 1430
162 Ga0307510_10127443 3300033180 Bacteria 2230
163 Ga0373923_0081564 3300035111 Bacteria 1404
164 Ga0373957_0339933 3300035120 Bacteria 640
165 Ga0373955_0691227 3300035172 Bacteria 626
166 Ga0373927_0202699 3300035695 Bacteria 1303
167 Ga0373933_0153228 3300035724 Bacteria 1461
168 Ga0373933_0392295 3300035724 Bacteria 905
169 Ga0373937_0140896 3300036401 Bacteria 2256
170 Ga0373925_0091224 3300037068 Bacteria 2330
171 Ga0395899_0005419 3300037312 Bacteria 9904
172 Ga0395899_0068279 3300037312 Bacteria 2607
173 Ga0395900_0013284 3300037418 Bacteria 8418
174 Ga0395900_0104984 3300037418 Bacteria 2903
175 Ga0395900_0174343 3300037418 Bacteria 2188
176 Ga0395900_1094822 3300037418 Bacteria 714
177 Ga0395898_0007521 3300037466 Bacteria 11580
178 Ga0395898_0210920 3300037466 Bacteria 1853
179 Ga0436364_0372295 3300037853 Bacteria 780
180 Ga0395901_0861474 3300038443 Bacteria 890
181 Ga0436365_0580784 3300039437 Bacteria 1719
182 Ga0439448_0066531 3300042005 Bacteria 1196
183 Ga0466966_0394911 3300044684 Bacteria 831
184 Ga0466957_0222438 3300044842 Bacteria 1247
185 Ga0466957_0554553 3300044842 Bacteria 801
186 Ga0466957_0863638 3300044842 Bacteria 645
187 Ga0451576_2135911 3300045051 Bacteria 576
188 Ga0466967_0402420 3300045976 Bacteria 1332
189 Ga0495623_0331694 3300046679 Bacteria 833
190 Ga0495647_0217332 3300046681 Bacteria 843
191 Ga0495658_0508172 3300046683 Bacteria 771
192 Ga0495670_0504032 3300046691 Bacteria 657
193 Ga0495581_0888023 3300047315 Bacteria 509
194 Ga0495604_0881608 3300047317 Bacteria 560
195 Ga0496101_1035781 3300048904 Bacteria 645
196 Ga0496119_0487783 3300048922 Bacteria 575
197 Ga0496121_0109027 3300048924 Bacteria 2117
198 Ga0496126_0509324 3300048929 Bacteria 961
199 Ga0501031_0388207 3300049568 Bacteria 903
200 Ga0501048_1268059 3300049582 Bacteria 530
201 Ga0501071_0788691 3300049587 Bacteria 732
202 Ga0501072_0855055 3300049588 Bacteria 711
203 Ga0501075_0208032 3300049591 Bacteria 1492
204 Ga0501076_0008515 3300049592 Bacteria 7519
205 Ga0501077_0031093 3300049593 Bacteria 3396
206 Ga0501077_1073824 3300049593 Bacteria 518
207 Ga0501079_0012756 3300049741 Bacteria 6420
208 Ga0501080_0509937 3300049742 Bacteria 1074
209 Ga0501081_0041582 3300049743 Bacteria 3148
210 Ga0501045_0693013 3300049824 Bacteria 752
211 nmdc:mga03n38_212812_c1 3300050490 Bacteria 1005
212 nmdc:mga03n38_354446_c1 3300050490 Bacteria 799
213 nmdc:mga00v17_407614_c1 3300050491 Bacteria 883
214 nmdc:mga0yw44_54449_c1 3300050492 Bacteria 2431
215 nmdc:mga0yw44_98073_c1 3300050492 Bacteria 1862
216 nmdc:mga06z11_119163_c1 3300050494 Bacteria 1471
217 nmdc:mga04h51_48650_c1 3300050495 Bacteria 1414
218 nmdc:mga0rr50_18443_c1 3300050513 Bacteria 4689
219 nmdc:mga0rr50_707891_c1 3300050513 Bacteria 859
220 nmdc:mga08x19_1168270_c1 3300050514 Bacteria 546
221 nmdc:mga08x19_24_c1 3300050514 Bacteria 245940
222 Ga0495601_0995180 3300053077 Bacteria 527
223 Ga0495619_0066830 3300053085 Bacteria 2400
224 Ga0500644_0143483 3300053088 Bacteria 951
225 Ga0500646_0039166 3300053090 Bacteria 1329
226 Ga0500646_0067777 3300053090 Bacteria 1064
227 Ga0500646_0406093 3300053090 Bacteria 504
228 Ga0500556_0264480 3300053104 Bacteria 676
229 Ga0500562_067239 3300053108 Unclassified 966
230 Ga0500642_0038860 3300053130 Bacteria 2043
231 Ga0500652_308615 3300053131 Bacteria 610
232 Ga0500588_0010671 3300053146 Bacteria 2227
233 Ga0500622_0001546 3300053156 Bacteria 18210
234 Ga0500633_0299556 3300053160 Bacteria 592
235 Ga0501084_0060923 3300054114 Bacteria 3159
236 Ga0501082_0010758 3300060353 Bacteria 7877
237 Ga0501082_1383544 3300060353 Bacteria 615
238 Ga0530510_0098228 3300061734 Bacteria 2141
239 2600377078 2600254933 Bacteria 4750527
240 2643892041 2643221576 Bacteria 5214352
241 2643961093 2643221590 Bacteria 5214697
242 2821126654 2821123053 Bacteria 7836056
243 2891090479 2891088606 Bacteria 4762464
244 2894242488 2894232714 Bacteria 8834183
245 2899276619 2899275550 Bacteria 3958688
246 2917558422 2917554339 Bacteria 4987857
247 641644921 641522639 Bacteria 7737025
248 8002062662 8002060224 Bacteria 4026565
249 8045866222 8045864390 Bacteria 5043873
250 8054564046 8054563764 Bacteria 5592885
251 Ga0307513_10471037
252 rootL2_10270381
253 rootH1_10114680
254 Ga0070683_100348187
255 Ga0070682_100023472
256 Ga0070673_100168627
257 Ga0070659_100486771
258 Ga0070667_100070509
259 Ga0070714_100000141
260 Ga0070713_100898256
261 Ga0070710_11297934
262 Ga0070711_101622909
263 Ga0070705_100024330
264 Ga0070708_100696091
265 Ga0070708_101548634
266 Ga0070662_100318736
267 Ga0070662_100742180
268 Ga0070681_10121675
269 Ga0070681_10162507
270 Ga0070706_100121118
271 Ga0070707_100646459
272 Ga0070698_100144703
273 Ga0070679_100040512
274 Ga0070679_100347568
275 Ga0070697_100011439
276 Ga0070697_100478237
277 Ga0068853_100661442
278 Ga0070686_100089331
279 Ga0070695_100004938
280 Ga0070696_100090453
281 Ga0070693_100008183
282 Ga0070664_100170089
283 Ga0068857_100456702
284 Ga0068856_101496581
285 Ga0068852_100371472
286 Ga0068852_101824493
287 Ga0068859_101035241
288 Ga0068859_102274362
289 Ga0068864_100091175
290 Ga0068858_100105381
291 Ga0068862_100313916
292 Ga0081540_1002000
293 Ga0075365_10066816
294 Ga0075365_10172991
295 Ga0075368_10030347
296 Ga0075363_100410425
297 Ga0075364_10125027
298 Ga0075364_10345457
299 Ga0070715_10204389
300 Ga0070716_100111340
301 Ga0070712_100378973
302 Ga0075367_10079721
303 Ga0075370_10164181
304 Ga0068871_100194394
305 Ga0068865_100228536
306 Ga0075436_100054004
307 Ga0097620_101035405
308 Ga0097620_102274914
309 Ga0075435_100018061
310 Ga0075435_100826546
311 Ga0105240_10022570
312 Ga0111539_10792939
313 Ga0105245_10009245
314 Ga0105241_10193951
315 Ga0105248_10242918
316 Ga0105248_10597684
317 Ga0105238_10012628
318 Ga0105238_10088933
319 Ga0105238_10504101
320 Ga0105238_11316790
321 Ga0105249_10003005
322 Ga0105239_10254723
323 Ga0105239_10659861
324 Ga0105239_13634640
325 Ga0105246_10738176
326 Ga0157373_10024928
327 Ga0157370_10010941
328 Ga0157372_10016479
329 Ga0157375_10888488
330 Ga0163163_10342329
331 Ga0157379_10939525
332 Ga0157376_11566706
333 Ga0213874_10345796
334 Ga0207685_10215092
335 Ga0207654_11019744
336 Ga0207707_10027101
337 Ga0207707_10058981
338 Ga0207707_10509027
339 Ga0207695_10095093
340 Ga0207693_10334757
341 Ga0207660_10108934
342 Ga0207652_10436376
343 Ga0207694_10000942
344 Ga0207694_10078365
345 Ga0207694_10760902
346 Ga0207687_10024462
347 Ga0207700_10690462
348 Ga0207664_10111746
349 Ga0207706_10662471
350 Ga0207704_10327541
351 Ga0207665_10135836
352 Ga0207665_11095125
353 Ga0207711_10305235
354 Ga0207667_10890518
355 Ga0207658_10477574
356 Ga0207703_10069797
357 Ga0207703_11974669
358 Ga0207639_10023424
359 Ga0207639_10074302
360 Ga0207641_10327697
361 Ga0207676_10217206
362 Ga0207674_10052436
363 Ga0207698_11516468
364 Ga0209813_10033061
365 Ga0268265_10547266
366 Ga0268264_11051777
367 Ga0265326_10067757
368 Ga0265318_10140263
369 Ga0265330_10035786
370 Ga0265328_10000006
371 Ga0265328_10000055
372 Ga0265328_10001005
373 Ga0265328_10004405
374 Ga0265328_10006267
375 Ga0265328_10013426
376 Ga0265328_10038267
377 Ga0265328_10045940
378 Ga0265328_10063285
379 Ga0265328_10181911
380 Ga0265328_10188616
381 Ga0265325_10084163
382 Ga0265329_10020202
383 Ga0265340_10155512
384 Ga0265339_10071215
385 Ga0265331_10000178
386 Ga0265331_10000661
387 Ga0265331_10000990
388 Ga0265331_10003829
389 Ga0265327_10052591
390 Ga0265327_10064304
391 Ga0265327_10065934
392 Ga0265327_10068830
393 Ga0265327_10085726
394 Ga0265327_10171255
395 Ga0265316_10000350
396 Ga0265316_10044284
397 Ga0265316_10195196
398 Ga0265316_10281362
399 Ga0307513_10005957
400 Ga0265313_10000374
401 Ga0265314_10046816
402 Ga0265342_10025756
403 Ga0265342_10180585
404 Ga0265342_10303956
405 Ga0307405_11784682
406 Ga0307410_10535168
407 Ga0307412_11315801
408 Ga0307409_100238812
409 Ga0307409_101115499
410 Ga0307416_100387894
411 Ga0307510_10127443
412 Ga0373923_0081564
413 Ga0373957_0339933
414 Ga0373955_0691227
415 Ga0373927_0202699
416 Ga0373933_0153228
417 Ga0373933_0392295
418 Ga0373937_0140896
419 Ga0373925_0091224
420 Ga0395899_0005419
421 Ga0395899_0068279
422 Ga0395900_0013284
423 Ga0395900_0104984
424 Ga0395900_0174343
425 Ga0395900_1094822
426 Ga0395898_0007521
427 Ga0395898_0210920
428 Ga0436364_0372295
429 Ga0395901_0861474
430 Ga0436365_0580784
431 Ga0439448_0066531
432 Ga0466966_0394911
433 Ga0466957_0222438
434 Ga0466957_0554553
435 Ga0466957_0863638
436 Ga0451576_2135911
437 Ga0466967_0402420
438 Ga0495623_0331694
439 Ga0495647_0217332
440 Ga0495658_0508172
441 Ga0495670_0504032
442 Ga0495581_0888023
443 Ga0495604_0881608
444 Ga0496101_1035781
445 Ga0496119_0487783
446 Ga0496121_0109027
447 Ga0496126_0509324
448 Ga0501031_0388207
449 Ga0501048_1268059
450 Ga0501071_0788691
451 Ga0501072_0855055
452 Ga0501075_0208032
453 Ga0501076_0008515
454 Ga0501077_0031093
455 Ga0501077_1073824
456 Ga0501079_0012756
457 Ga0501080_0509937
458 Ga0501081_0041582
459 Ga0501045_0693013
460 nmdc:mga03n38_212812_c1
461 nmdc:mga03n38_354446_c1
462 nmdc:mga00v17_407614_c1
463 nmdc:mga0yw44_54449_c1
464 nmdc:mga0yw44_98073_c1
465 nmdc:mga06z11_119163_c1
466 nmdc:mga04h51_48650_c1
467 nmdc:mga0rr50_18443_c1
468 nmdc:mga0rr50_707891_c1
469 nmdc:mga08x19_1168270_c1
470 nmdc:mga08x19_24_c1
471 Ga0495601_0995180
472 Ga0495619_0066830
473 Ga0500644_0143483
474 Ga0500646_0039166
475 Ga0500646_0067777
476 Ga0500646_0406093
477 Ga0500556_0264480
478 Ga0500562_067239
479 Ga0500642_0038860
480 Ga0500652_308615
481 Ga0500588_0010671
482 Ga0500622_0001546
483 Ga0500633_0299556
484 Ga0501084_0060923
485 Ga0501082_0010758
486 Ga0501082_1383544
487 Ga0530510_0098228
488 2600377078
489 2643892041
490 2643961093
491 2821126654
492 2891090479
493 2894242488
494 2899276619
495 2917558422
496 641644921
497 8002062662
498 8045866222
499 8054564046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

10

138

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9895 2 132
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9675 2 132
2dtt-assembly2.cif.gz_E crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8204 2 131
2g64-assembly1.cif.gz_A structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase 0.8184 2 130
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8131 2 131
ID Description Score Start End Superfamily
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9876 2 132 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.828 1 130 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8212 1 130 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8184 2 130 3.30.479.10
af_Q58668_4_160_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8176 9 132 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A7K2MGU2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9959 1 87 GO:0046872
GO:0070497
AF-A0A136PI54-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9946 1 105 GO:0046872
GO:0070497
AF-A0A1Q4BKH9-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9933 1 131 GO:0046872
GO:0070497
AF-A0A255XXJ8-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9922 1 133 GO:0046872
GO:0070497
AF-A0A2W4LP22-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9921 1 132 GO:0046872
GO:0070497

Map