F360811

General Info

Members Datasets Scaffolds Average Seq Length
249 184 498 401

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10001811|Ga0207712_1000181113
Length 399
Sequence MTDPAIDAPLHLAAALDGAGWHPAAWREPGARPKELLTPGYWLDQVLEAERGLLDFVTIEDSLGLQSSRFDGPDERTDQVRGRLDAVLIASRVAPLTSHIGLVPTATVSHTEPFHISKAIATLDFTSEGRAGWRVQTSRPAEHAHFGRRTPFQFGIADIDKPEVQAAIAESFDEAADFVEVVRRLWDSWEDDAEIRDVATGRFIDREKLHYIDFEGRWFSVRGPSIVPRPPQGQPVVSALAHATVPYRLGARAADVVYVTPRDEAGAAAIVAEIRAEQATAGRAGETVHVFGDLVVFLDDTRKGRLDEVAGEEYTSDALVFTGTAAELADLLQSWQRAGLSGYRLRPGAVPHDLEAITRELLPELQRRRAFRTAYEASTLRGLLGLHRPANRYATATAR

Samples

Sample ID Description Type Environment
1 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
26 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
27 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
28 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
29 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
41 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
42 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
43 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
44 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
45 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
46 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
49 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
50 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
51 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
52 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
56 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
57 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
58 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
59 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
69 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
77 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
82 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
83 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
84 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
85 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
94 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
101 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
102 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
103 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
104 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
105 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
138 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
139 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 2508501039 Frankia saprophytica CN3 Isolate Nodule
142 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
143 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
144 2643221647 Streptomyces sp. Root369 Isolate Unclassified
145 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
146 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
147 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
148 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
149 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
150 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
151 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
152 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
153 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
154 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
155 2862574272 Streptomyces sp. AcE210 Isolate Nodule
156 2867428634 Streptomyces sp. RP5T Isolate Unclassified
157 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
158 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
159 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
160 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
161 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
162 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
163 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
164 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
165 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
166 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
167 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
168 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
169 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
170 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
171 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
172 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
173 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
174 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
175 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
176 8002775197 Frankia nepalensis CN7 Isolate Nodule
177 8002784119 Frankia sp. AgB1.9 Isolate Nodule
178 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
179 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
180 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
181 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
182 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
183 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
184 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.12
Metatranscriptomes 0
Isolates 18.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.21
Nodule 3.61
Rhizoplane 6.02
Rhizosphere 72.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207712_10001811 3300025961 Bacteria 14124
2 rootL2_10004557 3300003322 Bacteria 3655
3 rootL2_10016936 3300003322 Bacteria 3547
4 rootL2_10087630 3300003322 Bacteria 2160
5 Ga0070680_100015670 3300005336 Bacteria 5949
6 Ga0070675_100031043 3300005354 Bacteria 4317
7 Ga0070667_100060705 3300005367 Bacteria 3200
8 Ga0070710_10097543 3300005437 Bacteria 1744
9 Ga0070681_10187557 3300005458 Bacteria 1988
10 Ga0070679_100058714 3300005530 Bacteria 3834
11 Ga0070684_100220712 3300005535 Bacteria 1730
12 Ga0068853_100032894 3300005539 Bacteria 4396
13 Ga0070672_100156386 3300005543 Bacteria 1888
14 Ga0070693_100032243 3300005547 Bacteria 2879
15 Ga0068855_100253291 3300005563 Bacteria 1963
16 Ga0068854_100069927 3300005578 Bacteria 2564
17 Ga0068859_100000155 3300005617 Bacteria 65623
18 Ga0068862_100000009 3300005844 Bacteria 298620
19 Ga0075363_100044414 3300006048 Bacteria 2354
20 Ga0075367_10019299 3300006178 Bacteria 3779
21 Ga0097620_100000155 3300006931 Bacteria 65623
22 Ga0105251_10042687 3300009011 Bacteria 2199
23 Ga0105248_10002363 3300009177 Bacteria 20948
24 Ga0157372_10154890 3300013307 Bacteria 2646
25 Ga0163163_10006960 3300014325 Bacteria 9939
26 Ga0163163_10040463 3300014325 Bacteria 4551
27 Ga0182008_10001543 3300014497 Bacteria 15331
28 Ga0182007_10001533 3300015262 Bacteria 12341
29 Ga0183367_1001 3300015688 Bacteria 1225545
30 Ga0224572_1002169 3300024225 Bacteria 3110
31 Ga0209758_1008173 3300025297 Bacteria 6864
32 Ga0207692_10005670 3300025898 Bacteria 5013
33 Ga0207707_10158437 3300025912 Bacteria 1979
34 Ga0207657_10010032 3300025919 Bacteria 9476
35 Ga0207700_10116823 3300025928 Bacteria 2156
36 Ga0207711_10003175 3300025941 Bacteria 14327
37 Ga0207639_10048282 3300026041 Bacteria 3221
38 Ga0207641_10354512 3300026088 Bacteria 1399
39 Ga0268265_10000050 3300028380 Bacteria 175787
40 Ga0307517_10027975 3300028786 Bacteria 6744
41 Ga0307515_10000046 3300028794 Bacteria 293319
42 Ga0265338_10000127 3300028800 Bacteria 139864
43 Ga0307511_10000197 3300030521 Bacteria 60223
44 Ga0307512_10002234 3300030522 Bacteria 25185
45 Ga0265340_10000456 3300031247 Bacteria 22126
46 Ga0265340_10004871 3300031247 Bacteria 7469
47 Ga0265340_10005579 3300031247 Bacteria 6979
48 Ga0307513_10022732 3300031456 Bacteria 7357
49 Ga0307513_10050097 3300031456 Bacteria 4518
50 Ga0307509_10147980 3300031507 Bacteria 2270
51 Ga0307508_10001707 3300031616 Bacteria 24387
52 Ga0307508_10014248 3300031616 Bacteria 7251
53 Ga0307508_10027693 3300031616 Bacteria 5128
54 Ga0307508_10053846 3300031616 Bacteria 3569
55 Ga0307514_10002938 3300031649 Bacteria 16955
56 Ga0307516_10014986 3300031730 Bacteria 8174
57 Ga0307516_10084399 3300031730 Bacteria 3015
58 Ga0307518_10039097 3300031838 Bacteria 3449
59 Ga0307518_10129775 3300031838 Bacteria 1773
60 Ga0307507_10000008 3300033179 Bacteria 266336
61 Ga0307507_10039077 3300033179 Bacteria 4796
62 Ga0307507_10043685 3300033179 Bacteria 4443
63 Ga0307510_10030047 3300033180 Bacteria 6168
64 Ga0373962_0007144 3300035242 Bacteria 2729
65 Ga0373925_0002077 3300037068 Bacteria 16471
66 Ga0395898_0003182 3300037466 Bacteria 18486
67 Ga0395901_0027401 3300038443 Bacteria 5855
68 Ga0439455_0001434 3300042012 Bacteria 3983
69 Ga0450903_000051 3300042138 Bacteria 23526
70 Ga0439458_0001298 3300042157 Bacteria 6313
71 Ga0466969_0035756 3300044656 Bacteria 2511
72 Ga0466972_0012212 3300044658 Bacteria 4317
73 Ga0466972_0014614 3300044658 Bacteria 3930
74 Ga0466965_0000500 3300044683 Bacteria 13974
75 Ga0466966_0023212 3300044684 Bacteria 4063
76 Ga0466966_0073082 3300044684 Bacteria 2145
77 Ga0466961_0001316 3300044693 Bacteria 15322
78 Ga0466961_0013505 3300044693 Bacteria 5229
79 Ga0466961_0014297 3300044693 Bacteria 5095
80 Ga0466963_0000099 3300044694 Bacteria 30941
81 Ga0466963_0024738 3300044694 Bacteria 3823
82 Ga0466964_0004665 3300044706 Bacteria 5066
83 Ga0466971_0000918 3300044719 Bacteria 12087
84 Ga0466970_0000762 3300044765 Bacteria 15626
85 Ga0466970_0014529 3300044765 Bacteria 4044
86 Ga0466957_0004941 3300044842 Bacteria 7461
87 Ga0466959_0000584 3300045049 Bacteria 21250
88 Ga0466959_0067599 3300045049 Bacteria 2590
89 Ga0466958_0013450 3300045836 Bacteria 4659
90 Ga0466967_0020877 3300045976 Bacteria 5306
91 Ga0495592_0004511 3300046454 Bacteria 10194
92 Ga0495603_0004385 3300046455 Bacteria 8411
93 Ga0495603_0006054 3300046455 Bacteria 7232
94 Ga0495629_0015627 3300046459 Bacteria 5450
95 Ga0495629_0022692 3300046459 Bacteria 4473
96 Ga0495629_0050182 3300046459 Bacteria 2923
97 Ga0495651_0004627 3300046462 Bacteria 10519
98 Ga0495580_0059413 3300046472 Bacteria 2687
99 Ga0495639_0005133 3300046475 Bacteria 5626
100 Ga0495662_0002756 3300046476 Bacteria 8883
101 Ga0495662_0011430 3300046476 Bacteria 4339
102 Ga0495662_0056849 3300046476 Bacteria 1889
103 Ga0495662_0084440 3300046476 Bacteria 1545
104 Ga0495664_0001030 3300046477 Bacteria 14422
105 Ga0495594_0129037 3300046499 Bacteria 1431
106 Ga0495652_0028222 3300046529 Bacteria 4940
107 Ga0495587_0005719 3300046536 Bacteria 8102
108 Ga0495645_0022094 3300046543 Bacteria 4603
109 Ga0495634_0027595 3300046642 Bacteria 3949
110 Ga0495634_0078618 3300046642 Bacteria 2160
111 Ga0495611_0052985 3300046648 Bacteria 1831
112 Ga0495625_0009237 3300046660 Bacteria 8276
113 Ga0495635_0001226 3300046663 Bacteria 17160
114 Ga0495588_0007920 3300046674 Bacteria 4855
115 Ga0495588_0021353 3300046674 Bacteria 3189
116 Ga0495588_0024747 3300046674 Bacteria 2985
117 Ga0495657_0002354 3300046675 Bacteria 15897
118 Ga0495657_0005114 3300046675 Bacteria 10412
119 Ga0495657_0181184 3300046675 Bacteria 1293
120 Ga0495599_0094080 3300046678 Bacteria 1869
121 Ga0495646_0005676 3300046680 Bacteria 7903
122 Ga0495658_0057234 3300046683 Bacteria 2226
123 Ga0495613_0000676 3300046689 Bacteria 26970
124 Ga0495613_0014681 3300046689 Bacteria 5812
125 Ga0495613_0064837 3300046689 Bacteria 2670
126 Ga0495624_0019638 3300046690 Bacteria 4506
127 Ga0495624_0056880 3300046690 Bacteria 2460
128 Ga0495671_0013240 3300046692 Bacteria 4477
129 Ga0495600_0063846 3300046809 Bacteria 2406
130 Ga0495581_0006064 3300047315 Bacteria 7006
131 Ga0495581_0017697 3300047315 Bacteria 4141
132 Ga0495581_0096267 3300047315 Bacteria 1719
133 Ga0495636_0045351 3300047318 Bacteria 1832
134 Ga0495676_0031663 3300047321 Bacteria 4469
135 Ga0495676_0034861 3300047321 Bacteria 4216
136 Ga0495676_0053195 3300047321 Bacteria 3228
137 Ga0495676_0191063 3300047321 Bacteria 1428
138 Ga0495680_0041708 3300047322 Bacteria 3647
139 Ga0495687_000555 3300047443 Bacteria 44116
140 Ga0495687_021193 3300047443 Bacteria 3151
141 Ga0495675_0005513 3300047444 Bacteria 7722
142 Ga0495685_006764 3300047447 Bacteria 3768
143 Ga0495681_0000525 3300047470 Bacteria 29234
144 Ga0495593_0001048 3300047673 Bacteria 16212
145 Ga0495593_0015081 3300047673 Bacteria 4389
146 Ga0495614_0005978 3300048089 Bacteria 5481
147 Ga0496102_0040266 3300048905 Bacteria 4226
148 Ga0496104_0009432 3300048907 Bacteria 8680
149 Ga0496105_0000311 3300048908 Bacteria 31946
150 Ga0496106_0071172 3300048909 Bacteria 2657
151 Ga0496108_0005511 3300048911 Bacteria 10236
152 Ga0496108_0091010 3300048911 Bacteria 2593
153 Ga0496109_0000449 3300048912 Bacteria 35266
154 Ga0496109_0013106 3300048912 Bacteria 7172
155 Ga0496109_0101663 3300048912 Bacteria 2668
156 Ga0496110_0004354 3300048913 Bacteria 10960
157 Ga0496111_0000133 3300048914 Bacteria 32723
158 Ga0496113_0030443 3300048916 Bacteria 3907
159 Ga0496114_0066544 3300048917 Bacteria 3021
160 Ga0496115_0109231 3300048918 Bacteria 2271
161 Ga0496121_0051113 3300048924 Bacteria 3484
162 Ga0496126_0005999 3300048929 Bacteria 13649
163 Ga0496126_0274898 3300048929 Bacteria 1397
164 Ga0501031_0021855 3300049568 Bacteria 4168
165 Ga0501032_0004942 3300049569 Bacteria 9970
166 Ga0501032_0079227 3300049569 Bacteria 2187
167 Ga0501033_0006153 3300049570 Bacteria 9413
168 Ga0501034_0008268 3300049571 Bacteria 11013
169 Ga0501034_0102326 3300049571 Bacteria 2858
170 Ga0501037_0003176 3300049573 Bacteria 11929
171 Ga0501037_0062387 3300049573 Bacteria 2717
172 Ga0501038_0001853 3300049574 Bacteria 19530
173 Ga0501038_0031710 3300049574 Bacteria 4668
174 Ga0501039_0221868 3300049575 Bacteria 1486
175 Ga0501042_0006638 3300049578 Bacteria 7536
176 Ga0501043_0002013 3300049579 Bacteria 17357
177 Ga0501043_0103417 3300049579 Bacteria 2238
178 Ga0501046_0005521 3300049580 Bacteria 11293
179 Ga0501046_0014685 3300049580 Bacteria 6596
180 Ga0501046_0156141 3300049580 Bacteria 1718
181 Ga0501047_0008812 3300049581 Bacteria 9519
182 Ga0501047_0023428 3300049581 Bacteria 5927
183 Ga0501047_0039581 3300049581 Bacteria 4559
184 Ga0501047_0042474 3300049581 Bacteria 4393
185 Ga0501047_0045600 3300049581 Bacteria 4239
186 Ga0501047_0068380 3300049581 Bacteria 3421
187 Ga0501048_0045292 3300049582 Bacteria 3142
188 Ga0501070_0154232 3300049586 Bacteria 1894
189 Ga0501073_0133861 3300049589 Bacteria 1718
190 Ga0501035_0001861 3300049822 Bacteria 21258
191 Ga0501035_0033087 3300049822 Bacteria 4701
192 Ga0501035_0217979 3300049822 Bacteria 1630
193 Ga0501044_0000150 3300049823 Bacteria 85886
194 Ga0501044_0076485 3300049823 Bacteria 3397
195 Ga0501044_0085969 3300049823 Bacteria 3177
196 nmdc:mga03n38_623_c1 3300050490 Bacteria 9074
197 nmdc:mga07m45_127746_c1 3300050496 Bacteria 1470
198 Ga0500640_000489 3300053095 Bacteria 9805
199 Ga0500560_000941 3300053107 Bacteria 4615
200 Ga0500572_011573 3300053111 Bacteria 2139
201 Ga0466962_0004196 3300061719 Bacteria 6900
202 Ga0466962_0007781 3300061719 Bacteria 5137
203 2508674864 2508501039 Bacteria 9978592
204 2585318976 2582581314 Bacteria 11452267
205 2616693457 2616644814 Bacteria 11555299
206 2644270465 2643221647 Bacteria 10741251
207 2644440843 2643221678 Bacteria 9540101
208 2676202567 2675902999 Bacteria 9438463
209 2676204889 2675902999 Bacteria 9438463
210 2676474753 2675903058 Bacteria 6822861
211 2731909068 2731639228 Bacteria 4187555
212 2774847143 2773857921 Bacteria 9435764
213 2774849464 2773857921 Bacteria 9435764
214 2785373322 2784746768 Bacteria 10036182
215 2793978989 2791355406 Bacteria 11364898
216 2808845432 2808606359 Bacteria 9866990
217 2808917195 2808606375 Bacteria 9466072
218 2827631079 2827628540 Bacteria 6858585
219 2862580943 2862574272 Bacteria 10567477
220 2867433390 2867428634 Bacteria 9590268
221 2877677591 2877676314 Bacteria 9512378
222 2912728850 2912723979 Bacteria 8557534
223 2919472802 2919468124 Bacteria 9133025
224 2946045242 2946041624 Bacteria 4191385
225 2954004109 2954002825 Bacteria 9173742
226 2954382346 2954380949 Bacteria 10050426
227 2954680741 2954673503 Bacteria 9685905
228 2954683412 2954682443 Bacteria 9862841
229 2954693166 2954691527 Bacteria 10720516
230 2954708263 2954701450 Bacteria 10834262
231 2954712834 2954711539 Bacteria 10867210
232 2954722791 2954721474 Bacteria 10456478
233 2954739037 2954731030 Bacteria 10243860
234 2954741703 2954740390 Bacteria 10229294
235 2954757895 2954749733 Bacteria 10366972
236 2954760682 2954759201 Bacteria 9358192
237 3006328390 3006321560 Bacteria 8247479
238 3006397538 3006393351 Bacteria 6615579
239 3006494543 3006493962 Bacteria 8825450
240 8002780477 8002775197 Bacteria 10728764
241 8002791577 8002784119 Bacteria 9788632
242 8008564286 8008558824 Bacteria 10610750
243 8008575792 8008574985 Bacteria 7815457
244 8047902646 8047893842 Bacteria 11723082
245 8048128154 8048127548 Bacteria 11053136
246 8048131898 8048127548 Bacteria 11053136
247 8048370444 8048369669 Bacteria 11666822
248 8048388978 8048379754 Bacteria 11877923
249 8056836180 8056829672 Bacteria 9045328
250 Ga0207712_10001811
251 rootL2_10004557
252 rootL2_10016936
253 rootL2_10087630
254 Ga0070680_100015670
255 Ga0070675_100031043
256 Ga0070667_100060705
257 Ga0070710_10097543
258 Ga0070681_10187557
259 Ga0070679_100058714
260 Ga0070684_100220712
261 Ga0068853_100032894
262 Ga0070672_100156386
263 Ga0070693_100032243
264 Ga0068855_100253291
265 Ga0068854_100069927
266 Ga0068859_100000155
267 Ga0068862_100000009
268 Ga0075363_100044414
269 Ga0075367_10019299
270 Ga0097620_100000155
271 Ga0105251_10042687
272 Ga0105248_10002363
273 Ga0157372_10154890
274 Ga0163163_10006960
275 Ga0163163_10040463
276 Ga0182008_10001543
277 Ga0182007_10001533
278 Ga0183367_1001
279 Ga0224572_1002169
280 Ga0209758_1008173
281 Ga0207692_10005670
282 Ga0207707_10158437
283 Ga0207657_10010032
284 Ga0207700_10116823
285 Ga0207711_10003175
286 Ga0207639_10048282
287 Ga0207641_10354512
288 Ga0268265_10000050
289 Ga0307517_10027975
290 Ga0307515_10000046
291 Ga0265338_10000127
292 Ga0307511_10000197
293 Ga0307512_10002234
294 Ga0265340_10000456
295 Ga0265340_10004871
296 Ga0265340_10005579
297 Ga0307513_10022732
298 Ga0307513_10050097
299 Ga0307509_10147980
300 Ga0307508_10001707
301 Ga0307508_10014248
302 Ga0307508_10027693
303 Ga0307508_10053846
304 Ga0307514_10002938
305 Ga0307516_10014986
306 Ga0307516_10084399
307 Ga0307518_10039097
308 Ga0307518_10129775
309 Ga0307507_10000008
310 Ga0307507_10039077
311 Ga0307507_10043685
312 Ga0307510_10030047
313 Ga0373962_0007144
314 Ga0373925_0002077
315 Ga0395898_0003182
316 Ga0395901_0027401
317 Ga0439455_0001434
318 Ga0450903_000051
319 Ga0439458_0001298
320 Ga0466969_0035756
321 Ga0466972_0012212
322 Ga0466972_0014614
323 Ga0466965_0000500
324 Ga0466966_0023212
325 Ga0466966_0073082
326 Ga0466961_0001316
327 Ga0466961_0013505
328 Ga0466961_0014297
329 Ga0466963_0000099
330 Ga0466963_0024738
331 Ga0466964_0004665
332 Ga0466971_0000918
333 Ga0466970_0000762
334 Ga0466970_0014529
335 Ga0466957_0004941
336 Ga0466959_0000584
337 Ga0466959_0067599
338 Ga0466958_0013450
339 Ga0466967_0020877
340 Ga0495592_0004511
341 Ga0495603_0004385
342 Ga0495603_0006054
343 Ga0495629_0015627
344 Ga0495629_0022692
345 Ga0495629_0050182
346 Ga0495651_0004627
347 Ga0495580_0059413
348 Ga0495639_0005133
349 Ga0495662_0002756
350 Ga0495662_0011430
351 Ga0495662_0056849
352 Ga0495662_0084440
353 Ga0495664_0001030
354 Ga0495594_0129037
355 Ga0495652_0028222
356 Ga0495587_0005719
357 Ga0495645_0022094
358 Ga0495634_0027595
359 Ga0495634_0078618
360 Ga0495611_0052985
361 Ga0495625_0009237
362 Ga0495635_0001226
363 Ga0495588_0007920
364 Ga0495588_0021353
365 Ga0495588_0024747
366 Ga0495657_0002354
367 Ga0495657_0005114
368 Ga0495657_0181184
369 Ga0495599_0094080
370 Ga0495646_0005676
371 Ga0495658_0057234
372 Ga0495613_0000676
373 Ga0495613_0014681
374 Ga0495613_0064837
375 Ga0495624_0019638
376 Ga0495624_0056880
377 Ga0495671_0013240
378 Ga0495600_0063846
379 Ga0495581_0006064
380 Ga0495581_0017697
381 Ga0495581_0096267
382 Ga0495636_0045351
383 Ga0495676_0031663
384 Ga0495676_0034861
385 Ga0495676_0053195
386 Ga0495676_0191063
387 Ga0495680_0041708
388 Ga0495687_000555
389 Ga0495687_021193
390 Ga0495675_0005513
391 Ga0495685_006764
392 Ga0495681_0000525
393 Ga0495593_0001048
394 Ga0495593_0015081
395 Ga0495614_0005978
396 Ga0496102_0040266
397 Ga0496104_0009432
398 Ga0496105_0000311
399 Ga0496106_0071172
400 Ga0496108_0005511
401 Ga0496108_0091010
402 Ga0496109_0000449
403 Ga0496109_0013106
404 Ga0496109_0101663
405 Ga0496110_0004354
406 Ga0496111_0000133
407 Ga0496113_0030443
408 Ga0496114_0066544
409 Ga0496115_0109231
410 Ga0496121_0051113
411 Ga0496126_0005999
412 Ga0496126_0274898
413 Ga0501031_0021855
414 Ga0501032_0004942
415 Ga0501032_0079227
416 Ga0501033_0006153
417 Ga0501034_0008268
418 Ga0501034_0102326
419 Ga0501037_0003176
420 Ga0501037_0062387
421 Ga0501038_0001853
422 Ga0501038_0031710
423 Ga0501039_0221868
424 Ga0501042_0006638
425 Ga0501043_0002013
426 Ga0501043_0103417
427 Ga0501046_0005521
428 Ga0501046_0014685
429 Ga0501046_0156141
430 Ga0501047_0008812
431 Ga0501047_0023428
432 Ga0501047_0039581
433 Ga0501047_0042474
434 Ga0501047_0045600
435 Ga0501047_0068380
436 Ga0501048_0045292
437 Ga0501070_0154232
438 Ga0501073_0133861
439 Ga0501035_0001861
440 Ga0501035_0033087
441 Ga0501035_0217979
442 Ga0501044_0000150
443 Ga0501044_0076485
444 Ga0501044_0085969
445 nmdc:mga03n38_623_c1
446 nmdc:mga07m45_127746_c1
447 Ga0500640_000489
448 Ga0500560_000941
449 Ga0500572_011573
450 Ga0466962_0004196
451 Ga0466962_0007781
452 2508674864
453 2585318976
454 2616693457
455 2644270465
456 2644440843
457 2676202567
458 2676204889
459 2676474753
460 2731909068
461 2774847143
462 2774849464
463 2785373322
464 2793978989
465 2808845432
466 2808917195
467 2827631079
468 2862580943
469 2867433390
470 2877677591
471 2912728850
472 2919472802
473 2946045242
474 2954004109
475 2954382346
476 2954680741
477 2954683412
478 2954693166
479 2954708263
480 2954712834
481 2954722791
482 2954739037
483 2954741703
484 2954757895
485 2954760682
486 3006328390
487 3006397538
488 3006494543
489 8002780477
490 8002791577
491 8008564286
492 8008575792
493 8047902646
494 8048128154
495 8048131898
496 8048370444
497 8048388978
498 8056836180

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

21

361

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m41-assembly1.cif.gz_A crystal structure of escherichia coli alkanesulfonate monooxygenase ssud at 2.3 a resolution 0.8516 5 370
5tlc-assembly1.cif.gz_D crystal structure of bdsa from bacillus subtilis wu-s2b 0.8355 6 392
7jv3-assembly2.cif.gz_F crystal structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens 0.835 5 362
5xkd-assembly1.cif.gz_B crystal structure of dibenzothiophene sulfone monooxygenase bdsa in complex with fmn at 2.4 angstrom 0.8344 5 394
3b9n-assembly2.cif.gz_B crystal structure of long-chain alkane monooxygenase (lada) 0.8326 4 390
ID Description Score Start End Superfamily
1m41A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8516 5 370 3.20.20.30
5tlcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8355 6 392 3.20.20.30
5tlcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8294 6 392 3.20.20.30
5w4zA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8255 4 390 3.20.20.30
1m41A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8177 5 370 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A5P2UVZ6-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9607 2 403 GO:0004497
GO:0016705
AF-A0A4D4KQ35-F1-model_v4 Luciferase-like domain-containing protein 0.9583 164 398 GO:0016705
AF-A0A2N0EJI5-F1-model_v4 deleted 0.9564 1 398
AF-I7G7F2-F1-model_v4 FMNH2-utilizing oxygenase 0.9542 10 398 GO:0004497
GO:0016705
AF-A0A246BGP9-F1-model_v4 deleted 0.9525 6 371

Map