F360796

General Info

Members Datasets Scaffolds Average Seq Length
249 126 248 214

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10350356|Ga0207650_103503562
Length 203
Sequence MISSILGKKLGMTQVYDAQNVLVPVTVVEAGPCAVVQVKTTATDGYNAVQIGFSSKKSKNTSAAEKQHATKAGLTDAPRVLSEVRLTDAPTLKVGDIVNVTTFKGFQGVVKRFRVAGGPATHGSMFHRRIGSVGMRQTPGRVWKNQAMPGHMGQLQRTMQNLRVVKIVAEKNLILVKGAIPGANGDDVIVRSAIKGQPKAAKA

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
42 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
43 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
46 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
47 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
48 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
49 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
52 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
54 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
55 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
126 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.37
Metatranscriptomes 7.23
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 0
Rhizosphere 95.58
Stem 0
Stem Tuber 0
Unclassified 2.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006770J48903_1058165 3300003305 Bacteria 790
2 rootH2_10007835 3300003320 Bacteria 2679
3 rootH2_10029644 3300003320 Bacteria 5454
4 rootH1_10011452 3300003323 Bacteria 12825
5 Ga0058863_11438633 3300004799 Bacteria 1172
6 Ga0058861_10013825 3300004800 Bacteria 1910
7 Ga0070658_10116091 3300005327 Bacteria 2221
8 Ga0070683_100022160 3300005329 Bacteria 5676
9 Ga0068869_100000006 3300005334 Bacteria 87287
10 Ga0070713_100024466 3300005436 Bacteria 4704
11 Ga0070678_100393585 3300005456 Bacteria 1202
12 Ga0068867_100003491 3300005459 Bacteria 11055
13 Ga0070679_100035776 3300005530 Bacteria 4926
14 Ga0068853_100227011 3300005539 Bacteria 1707
15 Ga0070672_100488433 3300005543 Bacteria 1064
16 Ga0070665_100350848 3300005548 Bacteria 1481
17 Ga0068856_100000665 3300005614 Bacteria 37258
18 Ga0068856_100221671 3300005614 Bacteria 1907
19 Ga0068864_100162127 3300005618 Bacteria 2033
20 Ga0068864_100456255 3300005618 Bacteria 1223
21 Ga0068861_100585253 3300005719 Bacteria 1022
22 Ga0068863_100351567 3300005841 Bacteria 1435
23 Ga0068860_100444484 3300005843 Bacteria 1288
24 Ga0070717_10000003 3300006028 Bacteria 370103
25 Ga0075366_10486380 3300006195 Bacteria 763
26 Ga0097621_100012004 3300006237 Bacteria 6410
27 Ga0097621_100084887 3300006237 Bacteria 2641
28 Ga0068865_100014137 3300006881 Bacteria 5067
29 Ga0105240_11001546 3300009093 Bacteria 894
30 Ga0157374_10328862 3300013296 Bacteria 1516
31 Ga0157372_11363773 3300013307 Bacteria 818
32 Ga0157375_10910388 3300013308 Bacteria 1023
33 Ga0157376_10113294 3300014969 Bacteria 2391
34 Ga0206356_10157715 3300020070 Bacteria 2055
35 Ga0207652_10135674 3300025921 Bacteria 2198
36 Ga0207650_10350356 3300025925 Bacteria 1215
37 Ga0207700_10004440 3300025928 Bacteria 8272
38 Ga0207689_10000034 3300025942 Bacteria 95262
39 Ga0207661_10004001 3300025944 Bacteria 10300
40 Ga0207677_10038329 3300026023 Bacteria 3142
41 Ga0207702_10000449 3300026078 Bacteria 46527
42 Ga0207648_10008188 3300026089 Bacteria 10161
43 Ga0207683_10162700 3300026121 Bacteria 2018
44 Ga0265337_1000360 3300028556 Bacteria 24386
45 Ga0265337_1007967 3300028556 Bacteria 3903
46 Ga0265337_1043726 3300028556 Bacteria 1280
47 Ga0265337_1046245 3300028556 Bacteria 1236
48 Ga0265326_10028028 3300028558 Bacteria 1605
49 Ga0265326_10061032 3300028558 Bacteria 1067
50 Ga0265319_1000011 3300028563 Bacteria 184643
51 Ga0265319_1000330 3300028563 Bacteria 34865
52 Ga0265319_1003969 3300028563 Bacteria 7508
53 Ga0265319_1004456 3300028563 Bacteria 6926
54 Ga0265319_1008522 3300028563 Bacteria 4478
55 Ga0265319_1015237 3300028563 Bacteria 2987
56 Ga0265319_1019885 3300028563 Bacteria 2498
57 Ga0265319_1025087 3300028563 Bacteria 2137
58 Ga0265334_10004519 3300028573 Bacteria 6167
59 Ga0265334_10008998 3300028573 Bacteria 4237
60 Ga0265318_10000003 3300028577 Bacteria 333722
61 Ga0265318_10001100 3300028577 Bacteria 16981
62 Ga0265318_10004329 3300028577 Bacteria 6895
63 Ga0265318_10007376 3300028577 Bacteria 4975
64 Ga0265318_10007903 3300028577 Bacteria 4775
65 Ga0265318_10011233 3300028577 Bacteria 3864
66 Ga0265318_10047937 3300028577 Bacteria 1610
67 Ga0265318_10093518 3300028577 Bacteria 1107
68 Ga0265323_10000005 3300028653 Bacteria 196003
69 Ga0265323_10007136 3300028653 Bacteria 4662
70 Ga0265323_10024641 3300028653 Bacteria 2285
71 Ga0265323_10058515 3300028653 Bacteria 1345
72 Ga0265322_10000493 3300028654 Bacteria 15441
73 Ga0265322_10029403 3300028654 Bacteria 1570
74 Ga0265322_10042633 3300028654 Bacteria 1292
75 Ga0265322_10083976 3300028654 Bacteria 904
76 Ga0265336_10004610 3300028666 Bacteria 5175
77 Ga0265336_10018347 3300028666 Bacteria 2268
78 Ga0265336_10128752 3300028666 Bacteria 754
79 Ga0307515_10043659 3300028794 Bacteria 6959
80 Ga0265338_10000919 3300028800 Bacteria 49615
81 Ga0265338_10001708 3300028800 Bacteria 34832
82 Ga0265338_10008397 3300028800 Bacteria 12546
83 Ga0265338_10062065 3300028800 Bacteria 3270
84 Ga0265338_10148386 3300028800 Bacteria 1826
85 Ga0265338_10579208 3300028800 Bacteria 783
86 Ga0265324_10000257 3300029957 Bacteria 39341
87 Ga0265324_10006809 3300029957 Bacteria 4714
88 Ga0265324_10013735 3300029957 Bacteria 3013
89 Ga0265760_10127029 3300031090 Bacteria 822
90 Ga0265330_10032703 3300031235 Bacteria 2330
91 Ga0265330_10040360 3300031235 Bacteria 2073
92 Ga0265330_10064041 3300031235 Bacteria 1597
93 Ga0265332_10006700 3300031238 Bacteria 5218
94 Ga0265328_10038343 3300031239 Bacteria 1769
95 Ga0265328_10107157 3300031239 Bacteria 1037
96 Ga0265320_10000391 3300031240 Bacteria 35502
97 Ga0265320_10000430 3300031240 Bacteria 33126
98 Ga0265320_10001599 3300031240 Bacteria 16249
99 Ga0265320_10002219 3300031240 Bacteria 13630
100 Ga0265320_10002795 3300031240 Bacteria 12011
101 Ga0265320_10007332 3300031240 Bacteria 6849
102 Ga0265320_10013495 3300031240 Bacteria 4698
103 Ga0265320_10014735 3300031240 Bacteria 4436
104 Ga0265320_10025233 3300031240 Bacteria 3128
105 Ga0265320_10045039 3300031240 Bacteria 2169
106 Ga0265325_10017704 3300031241 Bacteria 3957
107 Ga0265325_10193844 3300031241 Bacteria 940
108 Ga0265340_10040439 3300031247 Bacteria 2297
109 Ga0265339_10093900 3300031249 Bacteria 1569
110 Ga0265339_10209625 3300031249 Bacteria 958
111 Ga0265339_10287069 3300031249 Bacteria 787
112 Ga0265331_10002422 3300031250 Bacteria 12651
113 Ga0265331_10008339 3300031250 Bacteria 5900
114 Ga0265331_10034217 3300031250 Bacteria 2508
115 Ga0265327_10000318 3300031251 Bacteria 92042
116 Ga0265327_10001385 3300031251 Bacteria 30940
117 Ga0265327_10004150 3300031251 Bacteria 13074
118 Ga0265327_10020236 3300031251 Bacteria 4061
119 Ga0265316_10001559 3300031344 Bacteria 24560
120 Ga0265316_10050844 3300031344 Bacteria 3258
121 Ga0265316_10051378 3300031344 Bacteria 3238
122 Ga0265316_10152909 3300031344 Bacteria 1728
123 Ga0265316_10248612 3300031344 Bacteria 1306
124 Ga0265316_10279042 3300031344 Bacteria 1221
125 Ga0265316_10302033 3300031344 Bacteria 1166
126 Ga0265316_10527972 3300031344 Bacteria 841
127 Ga0307408_100000009 3300031548 Bacteria 426576
128 Ga0265313_10000016 3300031595 Bacteria 154004
129 Ga0265313_10000667 3300031595 Bacteria 35343
130 Ga0265313_10003569 3300031595 Bacteria 12508
131 Ga0265313_10006543 3300031595 Bacteria 8218
132 Ga0265313_10007926 3300031595 Bacteria 7140
133 Ga0265313_10014640 3300031595 Bacteria 4622
134 Ga0265313_10046728 3300031595 Bacteria 2100
135 Ga0265313_10062877 3300031595 Bacteria 1732
136 Ga0307508_10000276 3300031616 Bacteria 63298
137 Ga0265314_10000612 3300031711 Bacteria 44102
138 Ga0265314_10003296 3300031711 Bacteria 15770
139 Ga0265314_10003698 3300031711 Bacteria 14661
140 Ga0265314_10006379 3300031711 Bacteria 10453
141 Ga0265314_10008489 3300031711 Bacteria 8789
142 Ga0265314_10053444 3300031711 Bacteria 2801
143 Ga0265314_10060541 3300031711 Bacteria 2584
144 Ga0265314_10076006 3300031711 Bacteria 2233
145 Ga0265314_10114192 3300031711 Bacteria 1711
146 Ga0265314_10124676 3300031711 Bacteria 1615
147 Ga0265342_10002267 3300031712 Bacteria 16808
148 Ga0265342_10048182 3300031712 Bacteria 2555
149 Ga0265342_10072163 3300031712 Bacteria 2010
150 Ga0265342_10097150 3300031712 Bacteria 1682
151 Ga0307413_10119263 3300031824 Bacteria 1783
152 Ga0307410_10000097 3300031852 Bacteria 30229
153 Ga0307412_10119599 3300031911 Bacteria 1894
154 Ga0307409_100000037 3300031995 Bacteria 47029
155 Ga0307416_100000018 3300032002 Bacteria 200227
156 Ga0307414_10873419 3300032004 Bacteria 823
157 Ga0373951_0011584 3300035091 Bacteria 1981
158 Ga0373935_0203167 3300035692 Bacteria 1370
159 Ga0373933_0285739 3300035724 Bacteria 1066
160 Ga0395905_0000064 3300037471 Bacteria 186494
161 Ga0451833_0433034 3300041491 Bacteria 1214
162 Ga0451577_0000025 3300042876 Bacteria 403632
163 Ga0451577_0100147 3300042876 Bacteria 2588
164 Ga0451577_0137736 3300042876 Bacteria 2192
165 Ga0451577_0175589 3300042876 Bacteria 1931
166 Ga0451577_0700126 3300042876 Bacteria 918
167 Ga0453683_0002272 3300044673 Bacteria 15175
168 Ga0453683_0219263 3300044673 Bacteria 1209
169 Ga0453684_0018447 3300044712 Bacteria 10709
170 Ga0453684_0027964 3300044712 Bacteria 8066
171 Ga0453684_0028551 3300044712 Bacteria 7956
172 Ga0453684_0149601 3300044712 Bacteria 2776
173 Ga0453684_0266732 3300044712 Bacteria 1959
174 Ga0453684_0897428 3300044712 Bacteria 949
175 Ga0451576_0001217 3300045051 Bacteria 45861
176 Ga0451576_0015256 3300045051 Bacteria 8518
177 Ga0451576_0023682 3300045051 Bacteria 6646
178 Ga0451576_0086632 3300045051 Bacteria 3257
179 Ga0451576_0115069 3300045051 Bacteria 2800
180 Ga0451576_0127151 3300045051 Bacteria 2655
181 Ga0451576_0306603 3300045051 Bacteria 1661
182 Ga0451576_0330626 3300045051 Bacteria 1595
183 Ga0466967_0008913 3300045976 Bacteria 7404
184 Ga0495592_0366078 3300046454 Bacteria 921
185 Ga0495582_0200992 3300046473 Bacteria 1138
186 Ga0495664_0146745 3300046477 Bacteria 1431
187 Ga0495630_0202208 3300046517 Bacteria 1516
188 Ga0495667_0214420 3300046559 Bacteria 1230
189 Ga0495599_0023358 3300046678 Bacteria 3866
190 Ga0495624_0253677 3300046690 Bacteria 1064
191 Ga0495636_0109964 3300047318 Bacteria 1212
192 Ga0495674_0840683 3300047319 Bacteria 712
193 Ga0495675_0282800 3300047444 Bacteria 989
194 Ga0495684_0333196 3300047471 Bacteria 1082
195 Ga0501308_000059 3300049128 Bacteria 4592
196 Ga0501309_000600 3300049129 Bacteria 3042
197 Ga0501304_000042 3300049160 Bacteria 4484
198 Ga0501305_000001 3300049161 Bacteria 19709
199 Ga0501305_007439 3300049161 Bacteria 1391
200 Ga0501307_000001 3300049162 Bacteria 10981
201 Ga0501312_000001 3300049528 Bacteria 18666
202 Ga0501312_000490 3300049528 Bacteria 3220
203 Ga0501312_051345 3300049528 Bacteria 696
204 Ga0501314_003585 3300049530 Bacteria 1255
205 Ga0501315_001895 3300049531 Bacteria 1882
206 Ga0501320_001059 3300049536 Bacteria 1884
207 Ga0501032_0000512 3300049569 Bacteria 31496
208 Ga0501032_0009679 3300049569 Bacteria 6981
209 Ga0501033_0006825 3300049570 Bacteria 8910
210 Ga0501033_0013322 3300049570 Bacteria 6266
211 Ga0501034_0113794 3300049571 Bacteria 2695
212 Ga0501034_0144754 3300049571 Bacteria 2354
213 Ga0501036_0021394 3300049572 Bacteria 5437
214 Ga0501036_0039645 3300049572 Bacteria 3986
215 Ga0501037_0012356 3300049573 Bacteria 6286
216 Ga0501037_0016748 3300049573 Bacteria 5392
217 Ga0501038_0016279 3300049574 Bacteria 6741
218 Ga0501038_0714426 3300049574 Bacteria 750
219 Ga0501039_0057736 3300049575 Bacteria 3005
220 Ga0501042_0012302 3300049578 Bacteria 5793
221 Ga0501042_0215565 3300049578 Bacteria 1385
222 Ga0501043_0019700 3300049579 Bacteria 5298
223 Ga0501043_0044187 3300049579 Bacteria 3503
224 Ga0501046_0005597 3300049580 Bacteria 11214
225 Ga0501046_0019206 3300049580 Bacteria 5668
226 Ga0501046_0034073 3300049580 Bacteria 4111
227 Ga0501047_0023398 3300049581 Bacteria 5931
228 Ga0501048_0009159 3300049582 Bacteria 7445
229 Ga0501048_0297501 3300049582 Bacteria 1148
230 Ga0501070_0091667 3300049586 Bacteria 2515
231 Ga0501072_0258314 3300049588 Bacteria 1387
232 Ga0501243_001818 3300049675 Bacteria 3090
233 Ga0501083_0014905 3300049744 Bacteria 5437
234 Ga0501083_0042786 3300049744 Bacteria 3070
235 Ga0501083_0060133 3300049744 Bacteria 2539
236 Ga0501265_012097 3300049762 Bacteria 1072
237 Ga0501035_0004187 3300049822 Bacteria 13710
238 Ga0501035_0032904 3300049822 Bacteria 4715
239 Ga0501035_0083680 3300049822 Bacteria 2815
240 Ga0501035_0107448 3300049822 Bacteria 2446
241 Ga0501044_0000188 3300049823 Bacteria 77610
242 Ga0501044_0017858 3300049823 Bacteria 7610
243 Ga0501044_0019577 3300049823 Bacteria 7236
244 Ga0501044_0049197 3300049823 Bacteria 4352
245 Ga0500593_201689 3300053117 Bacteria 717
246 Ga0500568_0003170 3300053139 Bacteria 9359
247 Ga0500622_0005115 3300053156 Bacteria 7960
248 Ga0587101_002121 3300059623 Bacteria 1843

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046454 Ga0495592_0366078 Ga0495592_0366078_330_905 189
2 3300005334 Ga0068869_100000006 Ga0068869_1000000067 197
3 3300005459 Ga0068867_100003491 Ga0068867_1000034915 197
4 3300006237 Ga0097621_100012004 Ga0097621_1000120047 197
5 3300006881 Ga0068865_100014137 Ga0068865_1000141373 197
6 3300020070 Ga0206356_10157715 Ga0206356_101577152 197
7 3300025942 Ga0207689_10000034 Ga0207689_1000003412 197
8 3300026023 Ga0207677_10038329 Ga0207677_100383292 197
9 3300026089 Ga0207648_10008188 Ga0207648_1000818815 197
10 3300031548 Ga0307408_100000009 Ga0307408_100000009102 197
11 3300031852 Ga0307410_10000097 Ga0307410_1000009711 197
12 3300031911 Ga0307412_10119599 Ga0307412_101195992 197
13 3300031995 Ga0307409_100000037 Ga0307409_10000003721 197
14 3300032002 Ga0307416_100000018 Ga0307416_100000018103 197
15 3300005327 Ga0070658_10116091 Ga0070658_101160912 198
16 3300003320 rootH2_10007835 rootH2_100078353 199
17 3300003323 rootH1_10011452 rootH1_100114523 199
18 3300005543 Ga0070672_100488433 Ga0070672_1004884331 199
19 3300028653 Ga0265323_10007136 Ga0265323_100071362 199
20 3300029957 Ga0265324_10013735 Ga0265324_100137351 199
21 3300031616 Ga0307508_10000276 Ga0307508_1000027610 199
22 3300053117 Ga0500593_201689 Ga0500593_201689_77_685 199
23 3300025925 Ga0207650_10350356 Ga0207650_103503562 201
24 3300049574 Ga0501038_0714426 Ga0501038_0714426_22_702 203
25 3300013296 Ga0157374_10328862 Ga0157374_103288623 204
26 3300025921 Ga0207652_10135674 Ga0207652_101356741 204
27 3300028556 Ga0265337_1046245 Ga0265337_10462452 204
28 3300035091 Ga0373951_0011584 Ga0373951_0011584_411_1025 204
29 3300042876 Ga0451577_0175589 Ga0451577_0175589_965_1585 204
30 3300044673 Ga0453683_0002272 Ga0453683_0002272_1713_2333 204
31 3300044673 Ga0453683_0219263 Ga0453683_0219263_48_668 204
32 3300044712 Ga0453684_0027964 Ga0453684_0027964_5801_6421 204
33 3300045051 Ga0451576_0015256 Ga0451576_0015256_1059_1679 204
34 3300045051 Ga0451576_0086632 Ga0451576_0086632_2530_3150 204
35 3300045051 Ga0451576_0127151 Ga0451576_0127151_66_686 204
36 3300047444 Ga0495675_0282800 Ga0495675_0282800_19_639 204
37 3300049762 Ga0501265_012097 Ga0501265_012097_171_785 204
38 3300004799 Ga0058863_11438633 Ga0058863_114386331 205
39 3300004800 Ga0058861_10013825 Ga0058861_100138253 205
40 3300005530 Ga0070679_100035776 Ga0070679_1000357763 205
41 3300005436 Ga0070713_100024466 Ga0070713_1000244662 206
42 3300025928 Ga0207700_10004440 Ga0207700_100044405 206
43 3300006195 Ga0075366_10486380 Ga0075366_104863801 210
44 3300013308 Ga0157375_10910388 Ga0157375_109103882 210
45 3300014969 Ga0157376_10113294 Ga0157376_101132943 210
46 3300028563 Ga0265319_1000011 Ga0265319_100001138 210
47 3300028563 Ga0265319_1019885 Ga0265319_10198854 210
48 3300028573 Ga0265334_10004519 Ga0265334_100045198 210
49 3300028577 Ga0265318_10000003 Ga0265318_10000003186 210
50 3300028577 Ga0265318_10001100 Ga0265318_100011007 210
51 3300028577 Ga0265318_10093518 Ga0265318_100935181 210
52 3300028794 Ga0307515_10043659 Ga0307515_100436597 210
53 3300028800 Ga0265338_10148386 Ga0265338_101483862 210
54 3300031240 Ga0265320_10002219 Ga0265320_1000221922 210
55 3300031240 Ga0265320_10002795 Ga0265320_100027954 210
56 3300031240 Ga0265320_10025233 Ga0265320_100252331 210
57 3300031249 Ga0265339_10093900 Ga0265339_100939002 210
58 3300031250 Ga0265331_10002422 Ga0265331_100024223 210
59 3300031250 Ga0265331_10008339 Ga0265331_1000833912 210
60 3300031251 Ga0265327_10000318 Ga0265327_1000031845 210
61 3300031251 Ga0265327_10020236 Ga0265327_100202363 210
62 3300031344 Ga0265316_10152909 Ga0265316_101529093 210
63 3300031344 Ga0265316_10248612 Ga0265316_102486121 210
64 3300031595 Ga0265313_10007926 Ga0265313_1000792614 210
65 3300031595 Ga0265313_10014640 Ga0265313_100146409 210
66 3300031711 Ga0265314_10000612 Ga0265314_1000061211 210
67 3300031711 Ga0265314_10006379 Ga0265314_100063798 210
68 3300031711 Ga0265314_10076006 Ga0265314_100760063 210
69 3300041491 Ga0451833_0433034 Ga0451833_0433034_414_1055 210
70 3300042876 Ga0451577_0000025 Ga0451577_0000025_142040_142681 210
71 3300042876 Ga0451577_0100147 Ga0451577_0100147_383_1027 210
72 3300044712 Ga0453684_0028551 Ga0453684_0028551_3960_4601 210
73 3300044712 Ga0453684_0149601 Ga0453684_0149601_535_1176 210
74 3300044712 Ga0453684_0897428 Ga0453684_0897428_256_900 210
75 3300045051 Ga0451576_0306603 Ga0451576_0306603_558_1199 210
76 3300049569 Ga0501032_0000512 Ga0501032_0000512_457_1098 210
77 3300049571 Ga0501034_0113794 Ga0501034_0113794_439_1080 210
78 3300049572 Ga0501036_0039645 Ga0501036_0039645_2960_3601 210
79 3300049744 Ga0501083_0042786 Ga0501083_0042786_2368_3009 210
80 3300049822 Ga0501035_0107448 Ga0501035_0107448_310_951 210
81 3300049823 Ga0501044_0000188 Ga0501044_0000188_72936_73577 210
82 3300053139 Ga0500568_0003170 Ga0500568_0003170_430_1071 210
83 3300053156 Ga0500622_0005115 Ga0500622_0005115_2504_3145 210
84 3300059623 Ga0587101_002121 Ga0587101_002121_521_1162 210
85 iso_pu_bacteria 2786546940 2788433938 211
86 3300045051 Ga0451576_0330626 Ga0451576_0330626_784_1509 213
87 3300049744 Ga0501083_0014905 Ga0501083_0014905_4661_5377 213
88 3300049744 Ga0501083_0060133 Ga0501083_0060133_989_1723 213
89 3300049823 Ga0501044_0017858 Ga0501044_0017858_2129_2872 213
90 3300028577 Ga0265318_10047937 Ga0265318_100479372 214
91 3300031250 Ga0265331_10034217 Ga0265331_100342171 214
92 3300031711 Ga0265314_10008489 Ga0265314_1000848918 214
93 3300035692 Ga0373935_0203167 Ga0373935_0203167_582_1313 214
94 3300035724 Ga0373933_0285739 Ga0373933_0285739_172_903 214
95 3300046690 Ga0495624_0253677 Ga0495624_0253677_171_824 214
96 3300049580 Ga0501046_0034073 Ga0501046_0034073_1213_1926 214
97 3300049822 Ga0501035_0032904 Ga0501035_0032904_3469_4182 214
98 3300003305 Ga0006770J48903_1058165 Ga0006770J48903_10581651 215
99 3300003320 rootH2_10029644 rootH2_100296443 215
100 3300005329 Ga0070683_100022160 Ga0070683_1000221606 215
101 3300005456 Ga0070678_100393585 Ga0070678_1003935851 215
102 3300005539 Ga0068853_100227011 Ga0068853_1002270112 215
103 3300005548 Ga0070665_100350848 Ga0070665_1003508482 215
104 3300005614 Ga0068856_100000665 Ga0068856_10000066531 215
105 3300005614 Ga0068856_100221671 Ga0068856_1002216712 215
106 3300005618 Ga0068864_100162127 Ga0068864_1001621272 215
107 3300005618 Ga0068864_100456255 Ga0068864_1004562551 215
108 3300005719 Ga0068861_100585253 Ga0068861_1005852532 215
109 3300005841 Ga0068863_100351567 Ga0068863_1003515672 215
110 3300005843 Ga0068860_100444484 Ga0068860_1004444841 215
111 3300006028 Ga0070717_10000003 Ga0070717_10000003230 215
112 3300006237 Ga0097621_100084887 Ga0097621_1000848873 215
113 3300009093 Ga0105240_11001546 Ga0105240_110015462 215
114 3300013307 Ga0157372_11363773 Ga0157372_113637731 215
115 3300025944 Ga0207661_10004001 Ga0207661_100040017 215
116 3300026078 Ga0207702_10000449 Ga0207702_1000044952 215
117 3300026121 Ga0207683_10162700 Ga0207683_101627004 215
118 3300028556 Ga0265337_1000360 Ga0265337_100036016 215
119 3300028556 Ga0265337_1007967 Ga0265337_10079673 215
120 3300028556 Ga0265337_1043726 Ga0265337_10437263 215
121 3300028558 Ga0265326_10028028 Ga0265326_100280282 215
122 3300028558 Ga0265326_10061032 Ga0265326_100610322 215
123 3300028563 Ga0265319_1000330 Ga0265319_100033026 215
124 3300028563 Ga0265319_1003969 Ga0265319_100396913 215
125 3300028563 Ga0265319_1004456 Ga0265319_10044564 215
126 3300028563 Ga0265319_1008522 Ga0265319_10085223 215
127 3300028563 Ga0265319_1015237 Ga0265319_10152374 215
128 3300028563 Ga0265319_1025087 Ga0265319_10250873 215
129 3300028573 Ga0265334_10008998 Ga0265334_100089982 215
130 3300028577 Ga0265318_10004329 Ga0265318_100043295 215
131 3300028577 Ga0265318_10007376 Ga0265318_100073762 215
132 3300028577 Ga0265318_10007903 Ga0265318_100079032 215
133 3300028577 Ga0265318_10011233 Ga0265318_100112333 215
134 3300028653 Ga0265323_10000005 Ga0265323_10000005158 215
135 3300028653 Ga0265323_10024641 Ga0265323_100246412 215
136 3300028653 Ga0265323_10058515 Ga0265323_100585151 215
137 3300028654 Ga0265322_10000493 Ga0265322_100004938 215
138 3300028654 Ga0265322_10029403 Ga0265322_100294033 215
139 3300028654 Ga0265322_10042633 Ga0265322_100426332 215
140 3300028654 Ga0265322_10083976 Ga0265322_100839761 215
141 3300028666 Ga0265336_10004610 Ga0265336_100046102 215
142 3300028666 Ga0265336_10018347 Ga0265336_100183474 215
143 3300028666 Ga0265336_10128752 Ga0265336_101287521 215
144 3300028800 Ga0265338_10000919 Ga0265338_1000091952 215
145 3300028800 Ga0265338_10001708 Ga0265338_100017087 215
146 3300028800 Ga0265338_10008397 Ga0265338_1000839721 215
147 3300028800 Ga0265338_10062065 Ga0265338_100620651 215
148 3300028800 Ga0265338_10579208 Ga0265338_105792082 215
149 3300029957 Ga0265324_10000257 Ga0265324_100002573 215
150 3300029957 Ga0265324_10006809 Ga0265324_100068093 215
151 3300031090 Ga0265760_10127029 Ga0265760_101270291 215
152 3300031235 Ga0265330_10032703 Ga0265330_100327032 215
153 3300031235 Ga0265330_10040360 Ga0265330_100403601 215
154 3300031235 Ga0265330_10064041 Ga0265330_100640411 215
155 3300031238 Ga0265332_10006700 Ga0265332_100067002 215
156 3300031239 Ga0265328_10038343 Ga0265328_100383432 215
157 3300031239 Ga0265328_10107157 Ga0265328_101071571 215
158 3300031240 Ga0265320_10000391 Ga0265320_1000039122 215
159 3300031240 Ga0265320_10000430 Ga0265320_1000043046 215
160 3300031240 Ga0265320_10001599 Ga0265320_1000159925 215
161 3300031240 Ga0265320_10007332 Ga0265320_100073323 215
162 3300031240 Ga0265320_10013495 Ga0265320_100134952 215
163 3300031240 Ga0265320_10014735 Ga0265320_100147354 215
164 3300031240 Ga0265320_10045039 Ga0265320_100450392 215
165 3300031241 Ga0265325_10017704 Ga0265325_100177044 215
166 3300031241 Ga0265325_10193844 Ga0265325_101938441 215
167 3300031247 Ga0265340_10040439 Ga0265340_100404391 215
168 3300031249 Ga0265339_10209625 Ga0265339_102096251 215
169 3300031249 Ga0265339_10287069 Ga0265339_102870691 215
170 3300031251 Ga0265327_10001385 Ga0265327_1000138526 215
171 3300031251 Ga0265327_10004150 Ga0265327_1000415021 215
172 3300031344 Ga0265316_10001559 Ga0265316_1000155913 215
173 3300031344 Ga0265316_10050844 Ga0265316_100508441 215
174 3300031344 Ga0265316_10051378 Ga0265316_100513782 215
175 3300031344 Ga0265316_10279042 Ga0265316_102790422 215
176 3300031344 Ga0265316_10302033 Ga0265316_103020331 215
177 3300031344 Ga0265316_10527972 Ga0265316_105279721 215
178 3300031595 Ga0265313_10000016 Ga0265313_10000016143 215
179 3300031595 Ga0265313_10000667 Ga0265313_1000066719 215
180 3300031595 Ga0265313_10003569 Ga0265313_100035697 215
181 3300031595 Ga0265313_10006543 Ga0265313_100065434 215
182 3300031595 Ga0265313_10046728 Ga0265313_100467283 215
183 3300031595 Ga0265313_10062877 Ga0265313_100628772 215
184 3300031711 Ga0265314_10003296 Ga0265314_1000329626 215
185 3300031711 Ga0265314_10003698 Ga0265314_100036984 215
186 3300031711 Ga0265314_10053444 Ga0265314_100534444 215
187 3300031711 Ga0265314_10060541 Ga0265314_100605414 215
188 3300031711 Ga0265314_10114192 Ga0265314_101141923 215
189 3300031711 Ga0265314_10124676 Ga0265314_101246762 215
190 3300031712 Ga0265342_10002267 Ga0265342_100022672 215
191 3300031712 Ga0265342_10048182 Ga0265342_100481823 215
192 3300031712 Ga0265342_10072163 Ga0265342_100721632 215
193 3300031712 Ga0265342_10097150 Ga0265342_100971502 215
194 3300031824 Ga0307413_10119263 Ga0307413_101192631 215
195 3300032004 Ga0307414_10873419 Ga0307414_108734191 215
196 3300037471 Ga0395905_0000064 Ga0395905_0000064_62162_62809 215
197 3300042876 Ga0451577_0137736 Ga0451577_0137736_164_814 215
198 3300042876 Ga0451577_0700126 Ga0451577_0700126_67_831 215
199 3300044712 Ga0453684_0018447 Ga0453684_0018447_8049_8699 215
200 3300044712 Ga0453684_0266732 Ga0453684_0266732_1175_1828 215
201 3300045051 Ga0451576_0001217 Ga0451576_0001217_24382_25032 215
202 3300045051 Ga0451576_0023682 Ga0451576_0023682_4573_5220 215
203 3300045051 Ga0451576_0115069 Ga0451576_0115069_431_1153 215
204 3300045976 Ga0466967_0008913 Ga0466967_0008913_2706_3353 215
205 3300046473 Ga0495582_0200992 Ga0495582_0200992_121_774 215
206 3300046477 Ga0495664_0146745 Ga0495664_0146745_718_1371 215
207 3300046517 Ga0495630_0202208 Ga0495630_0202208_286_939 215
208 3300046559 Ga0495667_0214420 Ga0495667_0214420_398_1051 215
209 3300046678 Ga0495599_0023358 Ga0495599_0023358_328_981 215
210 3300047318 Ga0495636_0109964 Ga0495636_0109964_240_971 215
211 3300047319 Ga0495674_0840683 Ga0495674_0840683_40_693 215
212 3300047471 Ga0495684_0333196 Ga0495684_0333196_30_683 215
213 3300049128 Ga0501308_000059 Ga0501308_000059_166_813 215
214 3300049129 Ga0501309_000600 Ga0501309_000600_1620_2267 215
215 3300049160 Ga0501304_000042 Ga0501304_000042_790_1437 215
216 3300049161 Ga0501305_000001 Ga0501305_000001_15279_15926 215
217 3300049161 Ga0501305_007439 Ga0501305_007439_302_949 215
218 3300049162 Ga0501307_000001 Ga0501307_000001_1088_1735 215
219 3300049528 Ga0501312_000001 Ga0501312_000001_3777_4424 215
220 3300049528 Ga0501312_000490 Ga0501312_000490_977_1624 215
221 3300049528 Ga0501312_051345 Ga0501312_051345_17_664 215
222 3300049530 Ga0501314_003585 Ga0501314_003585_447_1094 215
223 3300049531 Ga0501315_001895 Ga0501315_001895_823_1470 215
224 3300049536 Ga0501320_001059 Ga0501320_001059_464_1111 215
225 3300049569 Ga0501032_0009679 Ga0501032_0009679_4034_4690 215
226 3300049570 Ga0501033_0006825 Ga0501033_0006825_4350_5006 215
227 3300049570 Ga0501033_0013322 Ga0501033_0013322_5158_5811 215
228 3300049571 Ga0501034_0144754 Ga0501034_0144754_1419_2075 215
229 3300049572 Ga0501036_0021394 Ga0501036_0021394_2031_2687 215
230 3300049573 Ga0501037_0012356 Ga0501037_0012356_3808_4461 215
231 3300049573 Ga0501037_0016748 Ga0501037_0016748_2309_2965 215
232 3300049574 Ga0501038_0016279 Ga0501038_0016279_3733_4389 215
233 3300049575 Ga0501039_0057736 Ga0501039_0057736_946_1602 215
234 3300049578 Ga0501042_0012302 Ga0501042_0012302_2301_2957 215
235 3300049578 Ga0501042_0215565 Ga0501042_0215565_97_750 215
236 3300049579 Ga0501043_0019700 Ga0501043_0019700_2612_3268 215
237 3300049579 Ga0501043_0044187 Ga0501043_0044187_58_711 215
238 3300049580 Ga0501046_0005597 Ga0501046_0005597_4207_4860 215
239 3300049580 Ga0501046_0019206 Ga0501046_0019206_2428_3084 215
240 3300049581 Ga0501047_0023398 Ga0501047_0023398_1857_2513 215
241 3300049582 Ga0501048_0009159 Ga0501048_0009159_3905_4561 215
242 3300049582 Ga0501048_0297501 Ga0501048_0297501_69_725 215
243 3300049586 Ga0501070_0091667 Ga0501070_0091667_418_1071 215
244 3300049588 Ga0501072_0258314 Ga0501072_0258314_132_788 215
245 3300049675 Ga0501243_001818 Ga0501243_001818_1631_2278 215
246 3300049822 Ga0501035_0004187 Ga0501035_0004187_10181_10837 215
247 3300049822 Ga0501035_0083680 Ga0501035_0083680_1311_1964 215
248 3300049823 Ga0501044_0019577 Ga0501044_0019577_6010_6663 215
249 3300049823 Ga0501044_0049197 Ga0501044_0049197_1405_2061 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

91

173

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8983 4 209
6ppf-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class b 0.89 3 209
6ppf-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class b 0.885 3 209
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8819 3 209
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.8772 4 209
ID Description Score Start End Superfamily
af_P60438_33_95_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9207 35 96 3.30.160.810
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.915 35 94 3.30.160.810
af_Q2FW06_34_105_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9111 35 98 3.30.160.810
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9058 35 98 3.30.160.810
1vw3C01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8979 1 209 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A0G1QCC0-F1-model_v4 Large ribosomal subunit protein uL3 (50S ribosomal protein L3) 0.8159 1 205 GO:0003735
GO:0006412
GO:0022625
AF-A0A0G1QCC0-F1-model_v4 Large ribosomal subunit protein uL3 (50S ribosomal protein L3) 0.7984 1 205 GO:0003735
GO:0006412
GO:0022625
AF-A0A2T6CQH0-F1-model_v4 Large ribosomal subunit protein uL3 0.7612 1 213 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A836DX71-F1-model_v4 deleted 0.7587 2 214
AF-A0A351MRJ4-F1-model_v4 Large ribosomal subunit protein uL3 0.7526 1 211 GO:0003735
GO:0006412
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
73.77 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map