F360796
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 249 | 126 | 248 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300025925|Ga0207650_10350356|Ga0207650_103503562 |
| Length | 203 |
| Sequence | MISSILGKKLGMTQVYDAQNVLVPVTVVEAGPCAVVQVKTTATDGYNAVQIGFSSKKSKNTSAAEKQHATKAGLTDAPRVLSEVRLTDAPTLKVGDIVNVTTFKGFQGVVKRFRVAGGPATHGSMFHRRIGSVGMRQTPGRVWKNQAMPGHMGQLQRTMQNLRVVKIVAEKNLILVKGAIPGANGDDVIVRSAIKGQPKAAKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 2 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 15 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 18 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 19 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 20 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 21 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 22 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 24 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 26 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 32 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 42 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 43 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 44 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 45 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 46 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 47 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 48 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 49 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 50 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 51 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 52 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 53 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 54 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 55 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 56 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 57 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 58 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 59 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 60 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 61 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 62 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 63 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 64 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 65 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 66 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 67 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 68 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 69 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 70 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 71 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 72 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 73 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 74 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 75 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 76 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 77 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 78 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 79 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 80 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 81 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 82 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 83 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 84 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 98 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 99 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 101 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 105 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 106 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 107 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 108 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 110 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 111 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 119 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 121 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 124 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 125 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 126 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.37 |
| Metatranscriptomes | 7.23 |
| Isolates | 0.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.61 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 95.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006770J48903_1058165 | 3300003305 | Bacteria | 790 |
| 2 | rootH2_10007835 | 3300003320 | Bacteria | 2679 |
| 3 | rootH2_10029644 | 3300003320 | Bacteria | 5454 |
| 4 | rootH1_10011452 | 3300003323 | Bacteria | 12825 |
| 5 | Ga0058863_11438633 | 3300004799 | Bacteria | 1172 |
| 6 | Ga0058861_10013825 | 3300004800 | Bacteria | 1910 |
| 7 | Ga0070658_10116091 | 3300005327 | Bacteria | 2221 |
| 8 | Ga0070683_100022160 | 3300005329 | Bacteria | 5676 |
| 9 | Ga0068869_100000006 | 3300005334 | Bacteria | 87287 |
| 10 | Ga0070713_100024466 | 3300005436 | Bacteria | 4704 |
| 11 | Ga0070678_100393585 | 3300005456 | Bacteria | 1202 |
| 12 | Ga0068867_100003491 | 3300005459 | Bacteria | 11055 |
| 13 | Ga0070679_100035776 | 3300005530 | Bacteria | 4926 |
| 14 | Ga0068853_100227011 | 3300005539 | Bacteria | 1707 |
| 15 | Ga0070672_100488433 | 3300005543 | Bacteria | 1064 |
| 16 | Ga0070665_100350848 | 3300005548 | Bacteria | 1481 |
| 17 | Ga0068856_100000665 | 3300005614 | Bacteria | 37258 |
| 18 | Ga0068856_100221671 | 3300005614 | Bacteria | 1907 |
| 19 | Ga0068864_100162127 | 3300005618 | Bacteria | 2033 |
| 20 | Ga0068864_100456255 | 3300005618 | Bacteria | 1223 |
| 21 | Ga0068861_100585253 | 3300005719 | Bacteria | 1022 |
| 22 | Ga0068863_100351567 | 3300005841 | Bacteria | 1435 |
| 23 | Ga0068860_100444484 | 3300005843 | Bacteria | 1288 |
| 24 | Ga0070717_10000003 | 3300006028 | Bacteria | 370103 |
| 25 | Ga0075366_10486380 | 3300006195 | Bacteria | 763 |
| 26 | Ga0097621_100012004 | 3300006237 | Bacteria | 6410 |
| 27 | Ga0097621_100084887 | 3300006237 | Bacteria | 2641 |
| 28 | Ga0068865_100014137 | 3300006881 | Bacteria | 5067 |
| 29 | Ga0105240_11001546 | 3300009093 | Bacteria | 894 |
| 30 | Ga0157374_10328862 | 3300013296 | Bacteria | 1516 |
| 31 | Ga0157372_11363773 | 3300013307 | Bacteria | 818 |
| 32 | Ga0157375_10910388 | 3300013308 | Bacteria | 1023 |
| 33 | Ga0157376_10113294 | 3300014969 | Bacteria | 2391 |
| 34 | Ga0206356_10157715 | 3300020070 | Bacteria | 2055 |
| 35 | Ga0207652_10135674 | 3300025921 | Bacteria | 2198 |
| 36 | Ga0207650_10350356 | 3300025925 | Bacteria | 1215 |
| 37 | Ga0207700_10004440 | 3300025928 | Bacteria | 8272 |
| 38 | Ga0207689_10000034 | 3300025942 | Bacteria | 95262 |
| 39 | Ga0207661_10004001 | 3300025944 | Bacteria | 10300 |
| 40 | Ga0207677_10038329 | 3300026023 | Bacteria | 3142 |
| 41 | Ga0207702_10000449 | 3300026078 | Bacteria | 46527 |
| 42 | Ga0207648_10008188 | 3300026089 | Bacteria | 10161 |
| 43 | Ga0207683_10162700 | 3300026121 | Bacteria | 2018 |
| 44 | Ga0265337_1000360 | 3300028556 | Bacteria | 24386 |
| 45 | Ga0265337_1007967 | 3300028556 | Bacteria | 3903 |
| 46 | Ga0265337_1043726 | 3300028556 | Bacteria | 1280 |
| 47 | Ga0265337_1046245 | 3300028556 | Bacteria | 1236 |
| 48 | Ga0265326_10028028 | 3300028558 | Bacteria | 1605 |
| 49 | Ga0265326_10061032 | 3300028558 | Bacteria | 1067 |
| 50 | Ga0265319_1000011 | 3300028563 | Bacteria | 184643 |
| 51 | Ga0265319_1000330 | 3300028563 | Bacteria | 34865 |
| 52 | Ga0265319_1003969 | 3300028563 | Bacteria | 7508 |
| 53 | Ga0265319_1004456 | 3300028563 | Bacteria | 6926 |
| 54 | Ga0265319_1008522 | 3300028563 | Bacteria | 4478 |
| 55 | Ga0265319_1015237 | 3300028563 | Bacteria | 2987 |
| 56 | Ga0265319_1019885 | 3300028563 | Bacteria | 2498 |
| 57 | Ga0265319_1025087 | 3300028563 | Bacteria | 2137 |
| 58 | Ga0265334_10004519 | 3300028573 | Bacteria | 6167 |
| 59 | Ga0265334_10008998 | 3300028573 | Bacteria | 4237 |
| 60 | Ga0265318_10000003 | 3300028577 | Bacteria | 333722 |
| 61 | Ga0265318_10001100 | 3300028577 | Bacteria | 16981 |
| 62 | Ga0265318_10004329 | 3300028577 | Bacteria | 6895 |
| 63 | Ga0265318_10007376 | 3300028577 | Bacteria | 4975 |
| 64 | Ga0265318_10007903 | 3300028577 | Bacteria | 4775 |
| 65 | Ga0265318_10011233 | 3300028577 | Bacteria | 3864 |
| 66 | Ga0265318_10047937 | 3300028577 | Bacteria | 1610 |
| 67 | Ga0265318_10093518 | 3300028577 | Bacteria | 1107 |
| 68 | Ga0265323_10000005 | 3300028653 | Bacteria | 196003 |
| 69 | Ga0265323_10007136 | 3300028653 | Bacteria | 4662 |
| 70 | Ga0265323_10024641 | 3300028653 | Bacteria | 2285 |
| 71 | Ga0265323_10058515 | 3300028653 | Bacteria | 1345 |
| 72 | Ga0265322_10000493 | 3300028654 | Bacteria | 15441 |
| 73 | Ga0265322_10029403 | 3300028654 | Bacteria | 1570 |
| 74 | Ga0265322_10042633 | 3300028654 | Bacteria | 1292 |
| 75 | Ga0265322_10083976 | 3300028654 | Bacteria | 904 |
| 76 | Ga0265336_10004610 | 3300028666 | Bacteria | 5175 |
| 77 | Ga0265336_10018347 | 3300028666 | Bacteria | 2268 |
| 78 | Ga0265336_10128752 | 3300028666 | Bacteria | 754 |
| 79 | Ga0307515_10043659 | 3300028794 | Bacteria | 6959 |
| 80 | Ga0265338_10000919 | 3300028800 | Bacteria | 49615 |
| 81 | Ga0265338_10001708 | 3300028800 | Bacteria | 34832 |
| 82 | Ga0265338_10008397 | 3300028800 | Bacteria | 12546 |
| 83 | Ga0265338_10062065 | 3300028800 | Bacteria | 3270 |
| 84 | Ga0265338_10148386 | 3300028800 | Bacteria | 1826 |
| 85 | Ga0265338_10579208 | 3300028800 | Bacteria | 783 |
| 86 | Ga0265324_10000257 | 3300029957 | Bacteria | 39341 |
| 87 | Ga0265324_10006809 | 3300029957 | Bacteria | 4714 |
| 88 | Ga0265324_10013735 | 3300029957 | Bacteria | 3013 |
| 89 | Ga0265760_10127029 | 3300031090 | Bacteria | 822 |
| 90 | Ga0265330_10032703 | 3300031235 | Bacteria | 2330 |
| 91 | Ga0265330_10040360 | 3300031235 | Bacteria | 2073 |
| 92 | Ga0265330_10064041 | 3300031235 | Bacteria | 1597 |
| 93 | Ga0265332_10006700 | 3300031238 | Bacteria | 5218 |
| 94 | Ga0265328_10038343 | 3300031239 | Bacteria | 1769 |
| 95 | Ga0265328_10107157 | 3300031239 | Bacteria | 1037 |
| 96 | Ga0265320_10000391 | 3300031240 | Bacteria | 35502 |
| 97 | Ga0265320_10000430 | 3300031240 | Bacteria | 33126 |
| 98 | Ga0265320_10001599 | 3300031240 | Bacteria | 16249 |
| 99 | Ga0265320_10002219 | 3300031240 | Bacteria | 13630 |
| 100 | Ga0265320_10002795 | 3300031240 | Bacteria | 12011 |
| 101 | Ga0265320_10007332 | 3300031240 | Bacteria | 6849 |
| 102 | Ga0265320_10013495 | 3300031240 | Bacteria | 4698 |
| 103 | Ga0265320_10014735 | 3300031240 | Bacteria | 4436 |
| 104 | Ga0265320_10025233 | 3300031240 | Bacteria | 3128 |
| 105 | Ga0265320_10045039 | 3300031240 | Bacteria | 2169 |
| 106 | Ga0265325_10017704 | 3300031241 | Bacteria | 3957 |
| 107 | Ga0265325_10193844 | 3300031241 | Bacteria | 940 |
| 108 | Ga0265340_10040439 | 3300031247 | Bacteria | 2297 |
| 109 | Ga0265339_10093900 | 3300031249 | Bacteria | 1569 |
| 110 | Ga0265339_10209625 | 3300031249 | Bacteria | 958 |
| 111 | Ga0265339_10287069 | 3300031249 | Bacteria | 787 |
| 112 | Ga0265331_10002422 | 3300031250 | Bacteria | 12651 |
| 113 | Ga0265331_10008339 | 3300031250 | Bacteria | 5900 |
| 114 | Ga0265331_10034217 | 3300031250 | Bacteria | 2508 |
| 115 | Ga0265327_10000318 | 3300031251 | Bacteria | 92042 |
| 116 | Ga0265327_10001385 | 3300031251 | Bacteria | 30940 |
| 117 | Ga0265327_10004150 | 3300031251 | Bacteria | 13074 |
| 118 | Ga0265327_10020236 | 3300031251 | Bacteria | 4061 |
| 119 | Ga0265316_10001559 | 3300031344 | Bacteria | 24560 |
| 120 | Ga0265316_10050844 | 3300031344 | Bacteria | 3258 |
| 121 | Ga0265316_10051378 | 3300031344 | Bacteria | 3238 |
| 122 | Ga0265316_10152909 | 3300031344 | Bacteria | 1728 |
| 123 | Ga0265316_10248612 | 3300031344 | Bacteria | 1306 |
| 124 | Ga0265316_10279042 | 3300031344 | Bacteria | 1221 |
| 125 | Ga0265316_10302033 | 3300031344 | Bacteria | 1166 |
| 126 | Ga0265316_10527972 | 3300031344 | Bacteria | 841 |
| 127 | Ga0307408_100000009 | 3300031548 | Bacteria | 426576 |
| 128 | Ga0265313_10000016 | 3300031595 | Bacteria | 154004 |
| 129 | Ga0265313_10000667 | 3300031595 | Bacteria | 35343 |
| 130 | Ga0265313_10003569 | 3300031595 | Bacteria | 12508 |
| 131 | Ga0265313_10006543 | 3300031595 | Bacteria | 8218 |
| 132 | Ga0265313_10007926 | 3300031595 | Bacteria | 7140 |
| 133 | Ga0265313_10014640 | 3300031595 | Bacteria | 4622 |
| 134 | Ga0265313_10046728 | 3300031595 | Bacteria | 2100 |
| 135 | Ga0265313_10062877 | 3300031595 | Bacteria | 1732 |
| 136 | Ga0307508_10000276 | 3300031616 | Bacteria | 63298 |
| 137 | Ga0265314_10000612 | 3300031711 | Bacteria | 44102 |
| 138 | Ga0265314_10003296 | 3300031711 | Bacteria | 15770 |
| 139 | Ga0265314_10003698 | 3300031711 | Bacteria | 14661 |
| 140 | Ga0265314_10006379 | 3300031711 | Bacteria | 10453 |
| 141 | Ga0265314_10008489 | 3300031711 | Bacteria | 8789 |
| 142 | Ga0265314_10053444 | 3300031711 | Bacteria | 2801 |
| 143 | Ga0265314_10060541 | 3300031711 | Bacteria | 2584 |
| 144 | Ga0265314_10076006 | 3300031711 | Bacteria | 2233 |
| 145 | Ga0265314_10114192 | 3300031711 | Bacteria | 1711 |
| 146 | Ga0265314_10124676 | 3300031711 | Bacteria | 1615 |
| 147 | Ga0265342_10002267 | 3300031712 | Bacteria | 16808 |
| 148 | Ga0265342_10048182 | 3300031712 | Bacteria | 2555 |
| 149 | Ga0265342_10072163 | 3300031712 | Bacteria | 2010 |
| 150 | Ga0265342_10097150 | 3300031712 | Bacteria | 1682 |
| 151 | Ga0307413_10119263 | 3300031824 | Bacteria | 1783 |
| 152 | Ga0307410_10000097 | 3300031852 | Bacteria | 30229 |
| 153 | Ga0307412_10119599 | 3300031911 | Bacteria | 1894 |
| 154 | Ga0307409_100000037 | 3300031995 | Bacteria | 47029 |
| 155 | Ga0307416_100000018 | 3300032002 | Bacteria | 200227 |
| 156 | Ga0307414_10873419 | 3300032004 | Bacteria | 823 |
| 157 | Ga0373951_0011584 | 3300035091 | Bacteria | 1981 |
| 158 | Ga0373935_0203167 | 3300035692 | Bacteria | 1370 |
| 159 | Ga0373933_0285739 | 3300035724 | Bacteria | 1066 |
| 160 | Ga0395905_0000064 | 3300037471 | Bacteria | 186494 |
| 161 | Ga0451833_0433034 | 3300041491 | Bacteria | 1214 |
| 162 | Ga0451577_0000025 | 3300042876 | Bacteria | 403632 |
| 163 | Ga0451577_0100147 | 3300042876 | Bacteria | 2588 |
| 164 | Ga0451577_0137736 | 3300042876 | Bacteria | 2192 |
| 165 | Ga0451577_0175589 | 3300042876 | Bacteria | 1931 |
| 166 | Ga0451577_0700126 | 3300042876 | Bacteria | 918 |
| 167 | Ga0453683_0002272 | 3300044673 | Bacteria | 15175 |
| 168 | Ga0453683_0219263 | 3300044673 | Bacteria | 1209 |
| 169 | Ga0453684_0018447 | 3300044712 | Bacteria | 10709 |
| 170 | Ga0453684_0027964 | 3300044712 | Bacteria | 8066 |
| 171 | Ga0453684_0028551 | 3300044712 | Bacteria | 7956 |
| 172 | Ga0453684_0149601 | 3300044712 | Bacteria | 2776 |
| 173 | Ga0453684_0266732 | 3300044712 | Bacteria | 1959 |
| 174 | Ga0453684_0897428 | 3300044712 | Bacteria | 949 |
| 175 | Ga0451576_0001217 | 3300045051 | Bacteria | 45861 |
| 176 | Ga0451576_0015256 | 3300045051 | Bacteria | 8518 |
| 177 | Ga0451576_0023682 | 3300045051 | Bacteria | 6646 |
| 178 | Ga0451576_0086632 | 3300045051 | Bacteria | 3257 |
| 179 | Ga0451576_0115069 | 3300045051 | Bacteria | 2800 |
| 180 | Ga0451576_0127151 | 3300045051 | Bacteria | 2655 |
| 181 | Ga0451576_0306603 | 3300045051 | Bacteria | 1661 |
| 182 | Ga0451576_0330626 | 3300045051 | Bacteria | 1595 |
| 183 | Ga0466967_0008913 | 3300045976 | Bacteria | 7404 |
| 184 | Ga0495592_0366078 | 3300046454 | Bacteria | 921 |
| 185 | Ga0495582_0200992 | 3300046473 | Bacteria | 1138 |
| 186 | Ga0495664_0146745 | 3300046477 | Bacteria | 1431 |
| 187 | Ga0495630_0202208 | 3300046517 | Bacteria | 1516 |
| 188 | Ga0495667_0214420 | 3300046559 | Bacteria | 1230 |
| 189 | Ga0495599_0023358 | 3300046678 | Bacteria | 3866 |
| 190 | Ga0495624_0253677 | 3300046690 | Bacteria | 1064 |
| 191 | Ga0495636_0109964 | 3300047318 | Bacteria | 1212 |
| 192 | Ga0495674_0840683 | 3300047319 | Bacteria | 712 |
| 193 | Ga0495675_0282800 | 3300047444 | Bacteria | 989 |
| 194 | Ga0495684_0333196 | 3300047471 | Bacteria | 1082 |
| 195 | Ga0501308_000059 | 3300049128 | Bacteria | 4592 |
| 196 | Ga0501309_000600 | 3300049129 | Bacteria | 3042 |
| 197 | Ga0501304_000042 | 3300049160 | Bacteria | 4484 |
| 198 | Ga0501305_000001 | 3300049161 | Bacteria | 19709 |
| 199 | Ga0501305_007439 | 3300049161 | Bacteria | 1391 |
| 200 | Ga0501307_000001 | 3300049162 | Bacteria | 10981 |
| 201 | Ga0501312_000001 | 3300049528 | Bacteria | 18666 |
| 202 | Ga0501312_000490 | 3300049528 | Bacteria | 3220 |
| 203 | Ga0501312_051345 | 3300049528 | Bacteria | 696 |
| 204 | Ga0501314_003585 | 3300049530 | Bacteria | 1255 |
| 205 | Ga0501315_001895 | 3300049531 | Bacteria | 1882 |
| 206 | Ga0501320_001059 | 3300049536 | Bacteria | 1884 |
| 207 | Ga0501032_0000512 | 3300049569 | Bacteria | 31496 |
| 208 | Ga0501032_0009679 | 3300049569 | Bacteria | 6981 |
| 209 | Ga0501033_0006825 | 3300049570 | Bacteria | 8910 |
| 210 | Ga0501033_0013322 | 3300049570 | Bacteria | 6266 |
| 211 | Ga0501034_0113794 | 3300049571 | Bacteria | 2695 |
| 212 | Ga0501034_0144754 | 3300049571 | Bacteria | 2354 |
| 213 | Ga0501036_0021394 | 3300049572 | Bacteria | 5437 |
| 214 | Ga0501036_0039645 | 3300049572 | Bacteria | 3986 |
| 215 | Ga0501037_0012356 | 3300049573 | Bacteria | 6286 |
| 216 | Ga0501037_0016748 | 3300049573 | Bacteria | 5392 |
| 217 | Ga0501038_0016279 | 3300049574 | Bacteria | 6741 |
| 218 | Ga0501038_0714426 | 3300049574 | Bacteria | 750 |
| 219 | Ga0501039_0057736 | 3300049575 | Bacteria | 3005 |
| 220 | Ga0501042_0012302 | 3300049578 | Bacteria | 5793 |
| 221 | Ga0501042_0215565 | 3300049578 | Bacteria | 1385 |
| 222 | Ga0501043_0019700 | 3300049579 | Bacteria | 5298 |
| 223 | Ga0501043_0044187 | 3300049579 | Bacteria | 3503 |
| 224 | Ga0501046_0005597 | 3300049580 | Bacteria | 11214 |
| 225 | Ga0501046_0019206 | 3300049580 | Bacteria | 5668 |
| 226 | Ga0501046_0034073 | 3300049580 | Bacteria | 4111 |
| 227 | Ga0501047_0023398 | 3300049581 | Bacteria | 5931 |
| 228 | Ga0501048_0009159 | 3300049582 | Bacteria | 7445 |
| 229 | Ga0501048_0297501 | 3300049582 | Bacteria | 1148 |
| 230 | Ga0501070_0091667 | 3300049586 | Bacteria | 2515 |
| 231 | Ga0501072_0258314 | 3300049588 | Bacteria | 1387 |
| 232 | Ga0501243_001818 | 3300049675 | Bacteria | 3090 |
| 233 | Ga0501083_0014905 | 3300049744 | Bacteria | 5437 |
| 234 | Ga0501083_0042786 | 3300049744 | Bacteria | 3070 |
| 235 | Ga0501083_0060133 | 3300049744 | Bacteria | 2539 |
| 236 | Ga0501265_012097 | 3300049762 | Bacteria | 1072 |
| 237 | Ga0501035_0004187 | 3300049822 | Bacteria | 13710 |
| 238 | Ga0501035_0032904 | 3300049822 | Bacteria | 4715 |
| 239 | Ga0501035_0083680 | 3300049822 | Bacteria | 2815 |
| 240 | Ga0501035_0107448 | 3300049822 | Bacteria | 2446 |
| 241 | Ga0501044_0000188 | 3300049823 | Bacteria | 77610 |
| 242 | Ga0501044_0017858 | 3300049823 | Bacteria | 7610 |
| 243 | Ga0501044_0019577 | 3300049823 | Bacteria | 7236 |
| 244 | Ga0501044_0049197 | 3300049823 | Bacteria | 4352 |
| 245 | Ga0500593_201689 | 3300053117 | Bacteria | 717 |
| 246 | Ga0500568_0003170 | 3300053139 | Bacteria | 9359 |
| 247 | Ga0500622_0005115 | 3300053156 | Bacteria | 7960 |
| 248 | Ga0587101_002121 | 3300059623 | Bacteria | 1843 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046454 | Ga0495592_0366078 | Ga0495592_0366078_330_905 | 189 |
| 2 | 3300005334 | Ga0068869_100000006 | Ga0068869_1000000067 | 197 |
| 3 | 3300005459 | Ga0068867_100003491 | Ga0068867_1000034915 | 197 |
| 4 | 3300006237 | Ga0097621_100012004 | Ga0097621_1000120047 | 197 |
| 5 | 3300006881 | Ga0068865_100014137 | Ga0068865_1000141373 | 197 |
| 6 | 3300020070 | Ga0206356_10157715 | Ga0206356_101577152 | 197 |
| 7 | 3300025942 | Ga0207689_10000034 | Ga0207689_1000003412 | 197 |
| 8 | 3300026023 | Ga0207677_10038329 | Ga0207677_100383292 | 197 |
| 9 | 3300026089 | Ga0207648_10008188 | Ga0207648_1000818815 | 197 |
| 10 | 3300031548 | Ga0307408_100000009 | Ga0307408_100000009102 | 197 |
| 11 | 3300031852 | Ga0307410_10000097 | Ga0307410_1000009711 | 197 |
| 12 | 3300031911 | Ga0307412_10119599 | Ga0307412_101195992 | 197 |
| 13 | 3300031995 | Ga0307409_100000037 | Ga0307409_10000003721 | 197 |
| 14 | 3300032002 | Ga0307416_100000018 | Ga0307416_100000018103 | 197 |
| 15 | 3300005327 | Ga0070658_10116091 | Ga0070658_101160912 | 198 |
| 16 | 3300003320 | rootH2_10007835 | rootH2_100078353 | 199 |
| 17 | 3300003323 | rootH1_10011452 | rootH1_100114523 | 199 |
| 18 | 3300005543 | Ga0070672_100488433 | Ga0070672_1004884331 | 199 |
| 19 | 3300028653 | Ga0265323_10007136 | Ga0265323_100071362 | 199 |
| 20 | 3300029957 | Ga0265324_10013735 | Ga0265324_100137351 | 199 |
| 21 | 3300031616 | Ga0307508_10000276 | Ga0307508_1000027610 | 199 |
| 22 | 3300053117 | Ga0500593_201689 | Ga0500593_201689_77_685 | 199 |
| 23 | 3300025925 | Ga0207650_10350356 | Ga0207650_103503562 | 201 |
| 24 | 3300049574 | Ga0501038_0714426 | Ga0501038_0714426_22_702 | 203 |
| 25 | 3300013296 | Ga0157374_10328862 | Ga0157374_103288623 | 204 |
| 26 | 3300025921 | Ga0207652_10135674 | Ga0207652_101356741 | 204 |
| 27 | 3300028556 | Ga0265337_1046245 | Ga0265337_10462452 | 204 |
| 28 | 3300035091 | Ga0373951_0011584 | Ga0373951_0011584_411_1025 | 204 |
| 29 | 3300042876 | Ga0451577_0175589 | Ga0451577_0175589_965_1585 | 204 |
| 30 | 3300044673 | Ga0453683_0002272 | Ga0453683_0002272_1713_2333 | 204 |
| 31 | 3300044673 | Ga0453683_0219263 | Ga0453683_0219263_48_668 | 204 |
| 32 | 3300044712 | Ga0453684_0027964 | Ga0453684_0027964_5801_6421 | 204 |
| 33 | 3300045051 | Ga0451576_0015256 | Ga0451576_0015256_1059_1679 | 204 |
| 34 | 3300045051 | Ga0451576_0086632 | Ga0451576_0086632_2530_3150 | 204 |
| 35 | 3300045051 | Ga0451576_0127151 | Ga0451576_0127151_66_686 | 204 |
| 36 | 3300047444 | Ga0495675_0282800 | Ga0495675_0282800_19_639 | 204 |
| 37 | 3300049762 | Ga0501265_012097 | Ga0501265_012097_171_785 | 204 |
| 38 | 3300004799 | Ga0058863_11438633 | Ga0058863_114386331 | 205 |
| 39 | 3300004800 | Ga0058861_10013825 | Ga0058861_100138253 | 205 |
| 40 | 3300005530 | Ga0070679_100035776 | Ga0070679_1000357763 | 205 |
| 41 | 3300005436 | Ga0070713_100024466 | Ga0070713_1000244662 | 206 |
| 42 | 3300025928 | Ga0207700_10004440 | Ga0207700_100044405 | 206 |
| 43 | 3300006195 | Ga0075366_10486380 | Ga0075366_104863801 | 210 |
| 44 | 3300013308 | Ga0157375_10910388 | Ga0157375_109103882 | 210 |
| 45 | 3300014969 | Ga0157376_10113294 | Ga0157376_101132943 | 210 |
| 46 | 3300028563 | Ga0265319_1000011 | Ga0265319_100001138 | 210 |
| 47 | 3300028563 | Ga0265319_1019885 | Ga0265319_10198854 | 210 |
| 48 | 3300028573 | Ga0265334_10004519 | Ga0265334_100045198 | 210 |
| 49 | 3300028577 | Ga0265318_10000003 | Ga0265318_10000003186 | 210 |
| 50 | 3300028577 | Ga0265318_10001100 | Ga0265318_100011007 | 210 |
| 51 | 3300028577 | Ga0265318_10093518 | Ga0265318_100935181 | 210 |
| 52 | 3300028794 | Ga0307515_10043659 | Ga0307515_100436597 | 210 |
| 53 | 3300028800 | Ga0265338_10148386 | Ga0265338_101483862 | 210 |
| 54 | 3300031240 | Ga0265320_10002219 | Ga0265320_1000221922 | 210 |
| 55 | 3300031240 | Ga0265320_10002795 | Ga0265320_100027954 | 210 |
| 56 | 3300031240 | Ga0265320_10025233 | Ga0265320_100252331 | 210 |
| 57 | 3300031249 | Ga0265339_10093900 | Ga0265339_100939002 | 210 |
| 58 | 3300031250 | Ga0265331_10002422 | Ga0265331_100024223 | 210 |
| 59 | 3300031250 | Ga0265331_10008339 | Ga0265331_1000833912 | 210 |
| 60 | 3300031251 | Ga0265327_10000318 | Ga0265327_1000031845 | 210 |
| 61 | 3300031251 | Ga0265327_10020236 | Ga0265327_100202363 | 210 |
| 62 | 3300031344 | Ga0265316_10152909 | Ga0265316_101529093 | 210 |
| 63 | 3300031344 | Ga0265316_10248612 | Ga0265316_102486121 | 210 |
| 64 | 3300031595 | Ga0265313_10007926 | Ga0265313_1000792614 | 210 |
| 65 | 3300031595 | Ga0265313_10014640 | Ga0265313_100146409 | 210 |
| 66 | 3300031711 | Ga0265314_10000612 | Ga0265314_1000061211 | 210 |
| 67 | 3300031711 | Ga0265314_10006379 | Ga0265314_100063798 | 210 |
| 68 | 3300031711 | Ga0265314_10076006 | Ga0265314_100760063 | 210 |
| 69 | 3300041491 | Ga0451833_0433034 | Ga0451833_0433034_414_1055 | 210 |
| 70 | 3300042876 | Ga0451577_0000025 | Ga0451577_0000025_142040_142681 | 210 |
| 71 | 3300042876 | Ga0451577_0100147 | Ga0451577_0100147_383_1027 | 210 |
| 72 | 3300044712 | Ga0453684_0028551 | Ga0453684_0028551_3960_4601 | 210 |
| 73 | 3300044712 | Ga0453684_0149601 | Ga0453684_0149601_535_1176 | 210 |
| 74 | 3300044712 | Ga0453684_0897428 | Ga0453684_0897428_256_900 | 210 |
| 75 | 3300045051 | Ga0451576_0306603 | Ga0451576_0306603_558_1199 | 210 |
| 76 | 3300049569 | Ga0501032_0000512 | Ga0501032_0000512_457_1098 | 210 |
| 77 | 3300049571 | Ga0501034_0113794 | Ga0501034_0113794_439_1080 | 210 |
| 78 | 3300049572 | Ga0501036_0039645 | Ga0501036_0039645_2960_3601 | 210 |
| 79 | 3300049744 | Ga0501083_0042786 | Ga0501083_0042786_2368_3009 | 210 |
| 80 | 3300049822 | Ga0501035_0107448 | Ga0501035_0107448_310_951 | 210 |
| 81 | 3300049823 | Ga0501044_0000188 | Ga0501044_0000188_72936_73577 | 210 |
| 82 | 3300053139 | Ga0500568_0003170 | Ga0500568_0003170_430_1071 | 210 |
| 83 | 3300053156 | Ga0500622_0005115 | Ga0500622_0005115_2504_3145 | 210 |
| 84 | 3300059623 | Ga0587101_002121 | Ga0587101_002121_521_1162 | 210 |
| 85 | iso_pu_bacteria | 2786546940 | 2788433938 | 211 |
| 86 | 3300045051 | Ga0451576_0330626 | Ga0451576_0330626_784_1509 | 213 |
| 87 | 3300049744 | Ga0501083_0014905 | Ga0501083_0014905_4661_5377 | 213 |
| 88 | 3300049744 | Ga0501083_0060133 | Ga0501083_0060133_989_1723 | 213 |
| 89 | 3300049823 | Ga0501044_0017858 | Ga0501044_0017858_2129_2872 | 213 |
| 90 | 3300028577 | Ga0265318_10047937 | Ga0265318_100479372 | 214 |
| 91 | 3300031250 | Ga0265331_10034217 | Ga0265331_100342171 | 214 |
| 92 | 3300031711 | Ga0265314_10008489 | Ga0265314_1000848918 | 214 |
| 93 | 3300035692 | Ga0373935_0203167 | Ga0373935_0203167_582_1313 | 214 |
| 94 | 3300035724 | Ga0373933_0285739 | Ga0373933_0285739_172_903 | 214 |
| 95 | 3300046690 | Ga0495624_0253677 | Ga0495624_0253677_171_824 | 214 |
| 96 | 3300049580 | Ga0501046_0034073 | Ga0501046_0034073_1213_1926 | 214 |
| 97 | 3300049822 | Ga0501035_0032904 | Ga0501035_0032904_3469_4182 | 214 |
| 98 | 3300003305 | Ga0006770J48903_1058165 | Ga0006770J48903_10581651 | 215 |
| 99 | 3300003320 | rootH2_10029644 | rootH2_100296443 | 215 |
| 100 | 3300005329 | Ga0070683_100022160 | Ga0070683_1000221606 | 215 |
| 101 | 3300005456 | Ga0070678_100393585 | Ga0070678_1003935851 | 215 |
| 102 | 3300005539 | Ga0068853_100227011 | Ga0068853_1002270112 | 215 |
| 103 | 3300005548 | Ga0070665_100350848 | Ga0070665_1003508482 | 215 |
| 104 | 3300005614 | Ga0068856_100000665 | Ga0068856_10000066531 | 215 |
| 105 | 3300005614 | Ga0068856_100221671 | Ga0068856_1002216712 | 215 |
| 106 | 3300005618 | Ga0068864_100162127 | Ga0068864_1001621272 | 215 |
| 107 | 3300005618 | Ga0068864_100456255 | Ga0068864_1004562551 | 215 |
| 108 | 3300005719 | Ga0068861_100585253 | Ga0068861_1005852532 | 215 |
| 109 | 3300005841 | Ga0068863_100351567 | Ga0068863_1003515672 | 215 |
| 110 | 3300005843 | Ga0068860_100444484 | Ga0068860_1004444841 | 215 |
| 111 | 3300006028 | Ga0070717_10000003 | Ga0070717_10000003230 | 215 |
| 112 | 3300006237 | Ga0097621_100084887 | Ga0097621_1000848873 | 215 |
| 113 | 3300009093 | Ga0105240_11001546 | Ga0105240_110015462 | 215 |
| 114 | 3300013307 | Ga0157372_11363773 | Ga0157372_113637731 | 215 |
| 115 | 3300025944 | Ga0207661_10004001 | Ga0207661_100040017 | 215 |
| 116 | 3300026078 | Ga0207702_10000449 | Ga0207702_1000044952 | 215 |
| 117 | 3300026121 | Ga0207683_10162700 | Ga0207683_101627004 | 215 |
| 118 | 3300028556 | Ga0265337_1000360 | Ga0265337_100036016 | 215 |
| 119 | 3300028556 | Ga0265337_1007967 | Ga0265337_10079673 | 215 |
| 120 | 3300028556 | Ga0265337_1043726 | Ga0265337_10437263 | 215 |
| 121 | 3300028558 | Ga0265326_10028028 | Ga0265326_100280282 | 215 |
| 122 | 3300028558 | Ga0265326_10061032 | Ga0265326_100610322 | 215 |
| 123 | 3300028563 | Ga0265319_1000330 | Ga0265319_100033026 | 215 |
| 124 | 3300028563 | Ga0265319_1003969 | Ga0265319_100396913 | 215 |
| 125 | 3300028563 | Ga0265319_1004456 | Ga0265319_10044564 | 215 |
| 126 | 3300028563 | Ga0265319_1008522 | Ga0265319_10085223 | 215 |
| 127 | 3300028563 | Ga0265319_1015237 | Ga0265319_10152374 | 215 |
| 128 | 3300028563 | Ga0265319_1025087 | Ga0265319_10250873 | 215 |
| 129 | 3300028573 | Ga0265334_10008998 | Ga0265334_100089982 | 215 |
| 130 | 3300028577 | Ga0265318_10004329 | Ga0265318_100043295 | 215 |
| 131 | 3300028577 | Ga0265318_10007376 | Ga0265318_100073762 | 215 |
| 132 | 3300028577 | Ga0265318_10007903 | Ga0265318_100079032 | 215 |
| 133 | 3300028577 | Ga0265318_10011233 | Ga0265318_100112333 | 215 |
| 134 | 3300028653 | Ga0265323_10000005 | Ga0265323_10000005158 | 215 |
| 135 | 3300028653 | Ga0265323_10024641 | Ga0265323_100246412 | 215 |
| 136 | 3300028653 | Ga0265323_10058515 | Ga0265323_100585151 | 215 |
| 137 | 3300028654 | Ga0265322_10000493 | Ga0265322_100004938 | 215 |
| 138 | 3300028654 | Ga0265322_10029403 | Ga0265322_100294033 | 215 |
| 139 | 3300028654 | Ga0265322_10042633 | Ga0265322_100426332 | 215 |
| 140 | 3300028654 | Ga0265322_10083976 | Ga0265322_100839761 | 215 |
| 141 | 3300028666 | Ga0265336_10004610 | Ga0265336_100046102 | 215 |
| 142 | 3300028666 | Ga0265336_10018347 | Ga0265336_100183474 | 215 |
| 143 | 3300028666 | Ga0265336_10128752 | Ga0265336_101287521 | 215 |
| 144 | 3300028800 | Ga0265338_10000919 | Ga0265338_1000091952 | 215 |
| 145 | 3300028800 | Ga0265338_10001708 | Ga0265338_100017087 | 215 |
| 146 | 3300028800 | Ga0265338_10008397 | Ga0265338_1000839721 | 215 |
| 147 | 3300028800 | Ga0265338_10062065 | Ga0265338_100620651 | 215 |
| 148 | 3300028800 | Ga0265338_10579208 | Ga0265338_105792082 | 215 |
| 149 | 3300029957 | Ga0265324_10000257 | Ga0265324_100002573 | 215 |
| 150 | 3300029957 | Ga0265324_10006809 | Ga0265324_100068093 | 215 |
| 151 | 3300031090 | Ga0265760_10127029 | Ga0265760_101270291 | 215 |
| 152 | 3300031235 | Ga0265330_10032703 | Ga0265330_100327032 | 215 |
| 153 | 3300031235 | Ga0265330_10040360 | Ga0265330_100403601 | 215 |
| 154 | 3300031235 | Ga0265330_10064041 | Ga0265330_100640411 | 215 |
| 155 | 3300031238 | Ga0265332_10006700 | Ga0265332_100067002 | 215 |
| 156 | 3300031239 | Ga0265328_10038343 | Ga0265328_100383432 | 215 |
| 157 | 3300031239 | Ga0265328_10107157 | Ga0265328_101071571 | 215 |
| 158 | 3300031240 | Ga0265320_10000391 | Ga0265320_1000039122 | 215 |
| 159 | 3300031240 | Ga0265320_10000430 | Ga0265320_1000043046 | 215 |
| 160 | 3300031240 | Ga0265320_10001599 | Ga0265320_1000159925 | 215 |
| 161 | 3300031240 | Ga0265320_10007332 | Ga0265320_100073323 | 215 |
| 162 | 3300031240 | Ga0265320_10013495 | Ga0265320_100134952 | 215 |
| 163 | 3300031240 | Ga0265320_10014735 | Ga0265320_100147354 | 215 |
| 164 | 3300031240 | Ga0265320_10045039 | Ga0265320_100450392 | 215 |
| 165 | 3300031241 | Ga0265325_10017704 | Ga0265325_100177044 | 215 |
| 166 | 3300031241 | Ga0265325_10193844 | Ga0265325_101938441 | 215 |
| 167 | 3300031247 | Ga0265340_10040439 | Ga0265340_100404391 | 215 |
| 168 | 3300031249 | Ga0265339_10209625 | Ga0265339_102096251 | 215 |
| 169 | 3300031249 | Ga0265339_10287069 | Ga0265339_102870691 | 215 |
| 170 | 3300031251 | Ga0265327_10001385 | Ga0265327_1000138526 | 215 |
| 171 | 3300031251 | Ga0265327_10004150 | Ga0265327_1000415021 | 215 |
| 172 | 3300031344 | Ga0265316_10001559 | Ga0265316_1000155913 | 215 |
| 173 | 3300031344 | Ga0265316_10050844 | Ga0265316_100508441 | 215 |
| 174 | 3300031344 | Ga0265316_10051378 | Ga0265316_100513782 | 215 |
| 175 | 3300031344 | Ga0265316_10279042 | Ga0265316_102790422 | 215 |
| 176 | 3300031344 | Ga0265316_10302033 | Ga0265316_103020331 | 215 |
| 177 | 3300031344 | Ga0265316_10527972 | Ga0265316_105279721 | 215 |
| 178 | 3300031595 | Ga0265313_10000016 | Ga0265313_10000016143 | 215 |
| 179 | 3300031595 | Ga0265313_10000667 | Ga0265313_1000066719 | 215 |
| 180 | 3300031595 | Ga0265313_10003569 | Ga0265313_100035697 | 215 |
| 181 | 3300031595 | Ga0265313_10006543 | Ga0265313_100065434 | 215 |
| 182 | 3300031595 | Ga0265313_10046728 | Ga0265313_100467283 | 215 |
| 183 | 3300031595 | Ga0265313_10062877 | Ga0265313_100628772 | 215 |
| 184 | 3300031711 | Ga0265314_10003296 | Ga0265314_1000329626 | 215 |
| 185 | 3300031711 | Ga0265314_10003698 | Ga0265314_100036984 | 215 |
| 186 | 3300031711 | Ga0265314_10053444 | Ga0265314_100534444 | 215 |
| 187 | 3300031711 | Ga0265314_10060541 | Ga0265314_100605414 | 215 |
| 188 | 3300031711 | Ga0265314_10114192 | Ga0265314_101141923 | 215 |
| 189 | 3300031711 | Ga0265314_10124676 | Ga0265314_101246762 | 215 |
| 190 | 3300031712 | Ga0265342_10002267 | Ga0265342_100022672 | 215 |
| 191 | 3300031712 | Ga0265342_10048182 | Ga0265342_100481823 | 215 |
| 192 | 3300031712 | Ga0265342_10072163 | Ga0265342_100721632 | 215 |
| 193 | 3300031712 | Ga0265342_10097150 | Ga0265342_100971502 | 215 |
| 194 | 3300031824 | Ga0307413_10119263 | Ga0307413_101192631 | 215 |
| 195 | 3300032004 | Ga0307414_10873419 | Ga0307414_108734191 | 215 |
| 196 | 3300037471 | Ga0395905_0000064 | Ga0395905_0000064_62162_62809 | 215 |
| 197 | 3300042876 | Ga0451577_0137736 | Ga0451577_0137736_164_814 | 215 |
| 198 | 3300042876 | Ga0451577_0700126 | Ga0451577_0700126_67_831 | 215 |
| 199 | 3300044712 | Ga0453684_0018447 | Ga0453684_0018447_8049_8699 | 215 |
| 200 | 3300044712 | Ga0453684_0266732 | Ga0453684_0266732_1175_1828 | 215 |
| 201 | 3300045051 | Ga0451576_0001217 | Ga0451576_0001217_24382_25032 | 215 |
| 202 | 3300045051 | Ga0451576_0023682 | Ga0451576_0023682_4573_5220 | 215 |
| 203 | 3300045051 | Ga0451576_0115069 | Ga0451576_0115069_431_1153 | 215 |
| 204 | 3300045976 | Ga0466967_0008913 | Ga0466967_0008913_2706_3353 | 215 |
| 205 | 3300046473 | Ga0495582_0200992 | Ga0495582_0200992_121_774 | 215 |
| 206 | 3300046477 | Ga0495664_0146745 | Ga0495664_0146745_718_1371 | 215 |
| 207 | 3300046517 | Ga0495630_0202208 | Ga0495630_0202208_286_939 | 215 |
| 208 | 3300046559 | Ga0495667_0214420 | Ga0495667_0214420_398_1051 | 215 |
| 209 | 3300046678 | Ga0495599_0023358 | Ga0495599_0023358_328_981 | 215 |
| 210 | 3300047318 | Ga0495636_0109964 | Ga0495636_0109964_240_971 | 215 |
| 211 | 3300047319 | Ga0495674_0840683 | Ga0495674_0840683_40_693 | 215 |
| 212 | 3300047471 | Ga0495684_0333196 | Ga0495684_0333196_30_683 | 215 |
| 213 | 3300049128 | Ga0501308_000059 | Ga0501308_000059_166_813 | 215 |
| 214 | 3300049129 | Ga0501309_000600 | Ga0501309_000600_1620_2267 | 215 |
| 215 | 3300049160 | Ga0501304_000042 | Ga0501304_000042_790_1437 | 215 |
| 216 | 3300049161 | Ga0501305_000001 | Ga0501305_000001_15279_15926 | 215 |
| 217 | 3300049161 | Ga0501305_007439 | Ga0501305_007439_302_949 | 215 |
| 218 | 3300049162 | Ga0501307_000001 | Ga0501307_000001_1088_1735 | 215 |
| 219 | 3300049528 | Ga0501312_000001 | Ga0501312_000001_3777_4424 | 215 |
| 220 | 3300049528 | Ga0501312_000490 | Ga0501312_000490_977_1624 | 215 |
| 221 | 3300049528 | Ga0501312_051345 | Ga0501312_051345_17_664 | 215 |
| 222 | 3300049530 | Ga0501314_003585 | Ga0501314_003585_447_1094 | 215 |
| 223 | 3300049531 | Ga0501315_001895 | Ga0501315_001895_823_1470 | 215 |
| 224 | 3300049536 | Ga0501320_001059 | Ga0501320_001059_464_1111 | 215 |
| 225 | 3300049569 | Ga0501032_0009679 | Ga0501032_0009679_4034_4690 | 215 |
| 226 | 3300049570 | Ga0501033_0006825 | Ga0501033_0006825_4350_5006 | 215 |
| 227 | 3300049570 | Ga0501033_0013322 | Ga0501033_0013322_5158_5811 | 215 |
| 228 | 3300049571 | Ga0501034_0144754 | Ga0501034_0144754_1419_2075 | 215 |
| 229 | 3300049572 | Ga0501036_0021394 | Ga0501036_0021394_2031_2687 | 215 |
| 230 | 3300049573 | Ga0501037_0012356 | Ga0501037_0012356_3808_4461 | 215 |
| 231 | 3300049573 | Ga0501037_0016748 | Ga0501037_0016748_2309_2965 | 215 |
| 232 | 3300049574 | Ga0501038_0016279 | Ga0501038_0016279_3733_4389 | 215 |
| 233 | 3300049575 | Ga0501039_0057736 | Ga0501039_0057736_946_1602 | 215 |
| 234 | 3300049578 | Ga0501042_0012302 | Ga0501042_0012302_2301_2957 | 215 |
| 235 | 3300049578 | Ga0501042_0215565 | Ga0501042_0215565_97_750 | 215 |
| 236 | 3300049579 | Ga0501043_0019700 | Ga0501043_0019700_2612_3268 | 215 |
| 237 | 3300049579 | Ga0501043_0044187 | Ga0501043_0044187_58_711 | 215 |
| 238 | 3300049580 | Ga0501046_0005597 | Ga0501046_0005597_4207_4860 | 215 |
| 239 | 3300049580 | Ga0501046_0019206 | Ga0501046_0019206_2428_3084 | 215 |
| 240 | 3300049581 | Ga0501047_0023398 | Ga0501047_0023398_1857_2513 | 215 |
| 241 | 3300049582 | Ga0501048_0009159 | Ga0501048_0009159_3905_4561 | 215 |
| 242 | 3300049582 | Ga0501048_0297501 | Ga0501048_0297501_69_725 | 215 |
| 243 | 3300049586 | Ga0501070_0091667 | Ga0501070_0091667_418_1071 | 215 |
| 244 | 3300049588 | Ga0501072_0258314 | Ga0501072_0258314_132_788 | 215 |
| 245 | 3300049675 | Ga0501243_001818 | Ga0501243_001818_1631_2278 | 215 |
| 246 | 3300049822 | Ga0501035_0004187 | Ga0501035_0004187_10181_10837 | 215 |
| 247 | 3300049822 | Ga0501035_0083680 | Ga0501035_0083680_1311_1964 | 215 |
| 248 | 3300049823 | Ga0501044_0019577 | Ga0501044_0019577_6010_6663 | 215 |
| 249 | 3300049823 | Ga0501044_0049197 | Ga0501044_0049197_1405_2061 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c97-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.8983 | 4 | 209 |
| 6ppf-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class b | 0.89 | 3 | 209 |
| 6ppf-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class b | 0.885 | 3 | 209 |
| 8c93-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.8819 | 3 | 209 |
| 8c97-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.8772 | 4 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P60438_33_95_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9207 | 35 | 96 | 3.30.160.810 |
| af_Q9SKX4_88_148_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.915 | 35 | 94 | 3.30.160.810 |
| af_Q2FW06_34_105_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9111 | 35 | 98 | 3.30.160.810 |
| af_P9WH87_35_101_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9058 | 35 | 98 | 3.30.160.810 |
| 1vw3C01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.8979 | 1 | 209 | 2.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0G1QCC0-F1-model_v4 | Large ribosomal subunit protein uL3 (50S ribosomal protein L3) | 0.8159 | 1 | 205 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A0G1QCC0-F1-model_v4 | Large ribosomal subunit protein uL3 (50S ribosomal protein L3) | 0.7984 | 1 | 205 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2T6CQH0-F1-model_v4 | Large ribosomal subunit protein uL3 | 0.7612 | 1 | 213 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A836DX71-F1-model_v4 | deleted | 0.7587 | 2 | 214 |
|
| AF-A0A351MRJ4-F1-model_v4 | Large ribosomal subunit protein uL3 | 0.7526 | 1 | 211 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar