F360768

General Info

Members Datasets Scaffolds Average Seq Length
249 149 498 243

Family's Representative Sequence

Representative Sequence 3300020082|Ga0206353_12070550|Ga0206353_120705502
Length 279
Sequence MSDSERGTRSERAGEAARLRIDIVTIFPTMVHAGLAEGVIGRAIASGILDVRVHDLRRFTTDRHHVVDDAPFGGGPGMVLKPEPLFAAVETIAAQRRAXXSTVILTSPDGERLTQDVARRLSTVDHMVILCGRYEGVDERVRERLATDVISIGDYVLSGGELPALVIVDAAARFVPGVVGDEASVEGDSFTRGLLDFPQYTRPADFRGYSVPSVLMSGHHAEIERWRREQALERTRRYRPDLLKESPDANGMERASKREWNEESQAGCRGPRRSKGDRQ

Samples

Sample ID Description Type Environment
1 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
88 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
105 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
106 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 4.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.81
Nodule 0
Rhizoplane 3.21
Rhizosphere 93.17
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206353_12070550 3300020082 Bacteria 1324
2 Ga0070676_10102053 3300005328 Bacteria 1774
3 Ga0070670_100544588 3300005331 Bacteria 1035
4 Ga0068869_100003812 3300005334 Bacteria 9294
5 Ga0070666_10054764 3300005335 Bacteria 2691
6 Ga0070661_100065768 3300005344 Bacteria 2664
7 Ga0070659_100020438 3300005366 Bacteria 5029
8 Ga0070703_10045770 3300005406 Bacteria 1381
9 Ga0070711_100021596 3300005439 Bacteria 4164
10 Ga0070711_100027789 3300005439 Bacteria 3717
11 Ga0070694_100340184 3300005444 Bacteria 1160
12 Ga0070708_100052504 3300005445 Bacteria 3615
13 Ga0070708_100092436 3300005445 Bacteria 2756
14 Ga0070708_100151836 3300005445 Bacteria 2154
15 Ga0070708_100233416 3300005445 Bacteria 1726
16 Ga0070708_100334216 3300005445 Bacteria 1428
17 Ga0070706_100290874 3300005467 Bacteria 1524
18 Ga0070707_100234456 3300005468 Bacteria 1786
19 Ga0070707_100344559 3300005468 Bacteria 1447
20 Ga0070698_100018885 3300005471 Bacteria 7253
21 Ga0070699_100019476 3300005518 Bacteria 5844
22 Ga0070699_100156036 3300005518 Bacteria 2020
23 Ga0070699_100177351 3300005518 Bacteria 1890
24 Ga0070699_100583076 3300005518 Bacteria 1019
25 Ga0070697_100028611 3300005536 Bacteria 4464
26 Ga0070697_100153394 3300005536 Bacteria 1943
27 Ga0068853_100018742 3300005539 Bacteria 5732
28 Ga0070695_100007890 3300005545 Bacteria 6301
29 Ga0070693_100033265 3300005547 Bacteria 2844
30 Ga0068855_100009003 3300005563 Bacteria 12062
31 Ga0068866_10288074 3300005718 Bacteria 1020
32 Ga0068861_100095360 3300005719 Bacteria 2356
33 Ga0068863_100024175 3300005841 Bacteria 5796
34 Ga0068858_100556434 3300005842 Bacteria 1111
35 Ga0068860_100179120 3300005843 Bacteria 2049
36 Ga0068862_100038714 3300005844 Bacteria 4046
37 Ga0081455_10000788 3300005937 Bacteria 40708
38 Ga0081538_10035211 3300005981 Bacteria 3293
39 Ga0081540_1018733 3300005983 Bacteria 4234
40 Ga0070712_100011684 3300006175 Bacteria 5576
41 Ga0075367_10071375 3300006178 Bacteria 2089
42 Ga0075366_10092666 3300006195 Bacteria 1810
43 Ga0075366_10136096 3300006195 Bacteria 1483
44 Ga0097621_100017190 3300006237 Bacteria 5489
45 Ga0075370_10094588 3300006353 Bacteria 1725
46 Ga0068871_100022994 3300006358 Bacteria 4813
47 Ga0068871_100069976 3300006358 Bacteria 2883
48 Ga0075428_100132399 3300006844 Bacteria 2712
49 Ga0075431_100000270 3300006847 Bacteria 40180
50 Ga0075431_100423141 3300006847 Bacteria 1331
51 Ga0075433_10126127 3300006852 Bacteria 2273
52 Ga0075433_10242618 3300006852 Bacteria 1599
53 Ga0075433_10249636 3300006852 Bacteria 1574
54 Ga0075434_100006115 3300006871 Bacteria 11019
55 Ga0075434_100071432 3300006871 Bacteria 3463
56 Ga0075434_100078275 3300006871 Bacteria 3301
57 Ga0075434_100293126 3300006871 Bacteria 1647
58 Ga0075434_100526751 3300006871 Bacteria 1202
59 Ga0075434_100624540 3300006871 Bacteria 1096
60 Ga0075434_100648149 3300006871 Bacteria 1074
61 Ga0075436_100000469 3300006914 Bacteria 26224
62 Ga0075436_100086535 3300006914 Bacteria 2176
63 Ga0075435_100024712 3300007076 Bacteria 4666
64 Ga0075435_100228276 3300007076 Bacteria 1581
65 Ga0075435_100505038 3300007076 Bacteria 1045
66 Ga0105240_10567435 3300009093 Bacteria 1254
67 Ga0111539_10001936 3300009094 Bacteria 27603
68 Ga0111539_10172320 3300009094 Bacteria 2528
69 Ga0111539_10408803 3300009094 Bacteria 1581
70 Ga0105245_10612445 3300009098 Bacteria 1116
71 Ga0114129_10028017 3300009147 Bacteria 7979
72 Ga0105248_10142294 3300009177 Bacteria 2706
73 Ga0105248_10730888 3300009177 Bacteria 1117
74 Ga0105249_10043513 3300009553 Bacteria 4084
75 Ga0105249_10174560 3300009553 Bacteria 2086
76 Ga0105239_10654168 3300010375 Unclassified 1200
77 Ga0105239_10812370 3300010375 Bacteria 1071
78 Ga0163162_10428223 3300013306 Bacteria 1455
79 Ga0157372_10532542 3300013307 Unclassified 1369
80 Ga0157380_10298337 3300014326 Bacteria 1483
81 Ga0157380_10476378 3300014326 Bacteria 1206
82 Ga0157376_10001124 3300014969 Bacteria 17538
83 Ga0207653_10020228 3300025885 Bacteria 2106
84 Ga0207642_10377346 3300025899 Bacteria 843
85 Ga0207645_10138228 3300025907 Bacteria 1587
86 Ga0207707_10488437 3300025912 Bacteria 1051
87 Ga0207695_10060823 3300025913 Bacteria 3907
88 Ga0207695_10654855 3300025913 Bacteria 931
89 Ga0207693_10029318 3300025915 Bacteria 4348
90 Ga0207663_10012369 3300025916 Bacteria 4613
91 Ga0207649_10039913 3300025920 Bacteria 2849
92 Ga0207652_10211364 3300025921 Bacteria 1747
93 Ga0207646_10048579 3300025922 Bacteria 3803
94 Ga0207646_10205818 3300025922 Bacteria 1777
95 Ga0207646_10295208 3300025922 Bacteria 1464
96 Ga0207650_10392315 3300025925 Bacteria 1148
97 Ga0207706_10106478 3300025933 Bacteria 2467
98 Ga0207665_10188607 3300025939 Bacteria 1497
99 Ga0207665_10230768 3300025939 Bacteria 1360
100 Ga0207689_10001241 3300025942 Bacteria 24582
101 Ga0207667_10013341 3300025949 Bacteria 9407
102 Ga0207651_10016474 3300025960 Bacteria 4330
103 Ga0207712_10039932 3300025961 Bacteria 3217
104 Ga0207703_10172832 3300026035 Bacteria 1902
105 Ga0207678_10076673 3300026067 Bacteria 2863
106 Ga0207702_10072682 3300026078 Bacteria 2965
107 Ga0207641_10760401 3300026088 Bacteria 957
108 Ga0207641_10833543 3300026088 Bacteria 913
109 Ga0207675_100101751 3300026118 Bacteria 2707
110 Ga0207428_10002635 3300027907 Bacteria 17888
111 Ga0207428_10068349 3300027907 Bacteria 2795
112 Ga0268265_10065456 3300028380 Bacteria 2805
113 Ga0268264_10245477 3300028381 Bacteria 1661
114 Ga0265334_10035466 3300028573 Bacteria 1974
115 Ga0265338_10138663 3300028800 Bacteria 1908
116 Ga0265340_10041316 3300031247 Unclassified 2268
117 Ga0265327_10036301 3300031251 Bacteria 2711
118 Ga0265327_10059826 3300031251 Bacteria 1950
119 Ga0307508_10004466 3300031616 Bacteria 13661
120 Ga0265314_10005470 3300031711 Bacteria 11453
121 Ga0316576_10016707 3300031727 Bacteria 4967
122 Ga0316576_10033408 3300031727 Bacteria 3662
123 Ga0316576_10384933 3300031727 Bacteria 1041
124 Ga0316577_10015338 3300031733 Bacteria 4215
125 Ga0316577_10018801 3300031733 Bacteria 3823
126 Ga0307409_100038885 3300031995 Bacteria 3524
127 Ga0316583_10000245 3300032133 Bacteria 14776
128 Ga0316593_10003153 3300032168 Unclassified 4050
129 Ga0316593_10003830 3300032168 Bacteria 3783
130 Ga0316593_10004032 3300032168 Bacteria 3718
131 Ga0316593_10047773 3300032168 Bacteria 1439
132 Ga0316593_10072110 3300032168 Unclassified 1196
133 Ga0316592_1017454 3300033524 Bacteria 1506
134 Ga0316588_1005562 3300033528 Bacteria 2463
135 Ga0316588_1032773 3300033528 Unclassified 1223
136 Ga0316596_1004060 3300033541 Unclassified 3253
137 Ga0316596_1042889 3300033541 Bacteria 1190
138 Ga0373926_0121968 3300035083 Bacteria 983
139 Ga0373931_0009139 3300035691 Bacteria 4730
140 Ga0373931_0349024 3300035691 Bacteria 926
141 Ga0373927_0001839 3300035695 Bacteria 15763
142 Ga0373927_0014051 3300035695 Bacteria 5307
143 Ga0373947_0405384 3300035725 Bacteria 920
144 Ga0373937_0166415 3300036401 Bacteria 2068
145 Ga0316582_0011446 3300036647 Bacteria 4905
146 Ga0316582_0071841 3300036647 Bacteria 2242
147 Ga0316582_0074916 3300036647 Bacteria 2198
148 Ga0316582_0123662 3300036647 Bacteria 1733
149 Ga0316584_0063289 3300036712 Bacteria 2769
150 Ga0316584_0549232 3300036712 Bacteria 807
151 Ga0373925_0003109 3300037068 Bacteria 13025
152 Ga0373925_0243663 3300037068 Bacteria 1440
153 Ga0316581_0040184 3300037588 Unclassified 1424
154 Ga0316581_0047453 3300037588 Bacteria 1314
155 Ga0395901_0436410 3300038443 Bacteria 1341
156 Ga0400489_13864 3300039093 Bacteria 1231
157 Ga0451807_1465773 3300041486 Bacteria 2411
158 Ga0439462_0051331 3300042015 Bacteria 1109
159 Ga0450898_022628 3300042134 Bacteria 1114
160 Ga0439446_0002374 3300042156 Bacteria 4510
161 Ga0439434_0058475 3300042435 Bacteria 1203
162 Ga0451577_0000035 3300042876 Bacteria 373467
163 Ga0451577_0004042 3300042876 Bacteria 15774
164 Ga0451577_0010923 3300042876 Bacteria 8628
165 Ga0451577_0044723 3300042876 Bacteria 3964
166 Ga0451577_0046609 3300042876 Bacteria 3878
167 Ga0451577_0066371 3300042876 Bacteria 3218
168 Ga0451577_0523223 3300042876 Bacteria 1077
169 Ga0453683_0000014 3300044673 Bacteria 364381
170 Ga0453683_0068114 3300044673 Bacteria 2225
171 Ga0453683_0116799 3300044673 Bacteria 1679
172 Ga0466961_0273734 3300044693 Bacteria 1034
173 Ga0466964_0096953 3300044706 Bacteria 1293
174 Ga0453684_0000053 3300044712 Bacteria 545350
175 Ga0453684_0000097 3300044712 Bacteria 377772
176 Ga0453684_0000210 3300044712 Bacteria 255463
177 Ga0453684_0000718 3300044712 Bacteria 117108
178 Ga0453684_0001583 3300044712 Bacteria 62833
179 Ga0453684_0010714 3300044712 Bacteria 15585
180 Ga0453684_0011164 3300044712 Bacteria 15130
181 Ga0453684_0011865 3300044712 Bacteria 14512
182 Ga0453684_0061651 3300044712 Bacteria 4812
183 Ga0453684_0065404 3300044712 Bacteria 4638
184 Ga0453684_0091251 3300044712 Bacteria 3761
185 Ga0453684_0092710 3300044712 Bacteria 3723
186 Ga0453684_0300825 3300044712 Bacteria 1823
187 Ga0453684_1013453 3300044712 Unclassified 882
188 Ga0466960_0235438 3300044901 Bacteria 1012
189 Ga0466959_0052248 3300045049 Bacteria 2994
190 Ga0451576_0000089 3300045051 Bacteria 233076
191 Ga0451576_0134921 3300045051 Unclassified 2574
192 Ga0451576_0452806 3300045051 Bacteria 1347
193 Ga0451576_0551629 3300045051 Bacteria 1211
194 Ga0451576_0553019 3300045051 Bacteria 1209
195 Ga0495636_0204615 3300047318 Bacteria 902
196 Ga0496100_0006095 3300048903 Bacteria 6554
197 Ga0496101_0006432 3300048904 Bacteria 7558
198 Ga0496104_0005659 3300048907 Bacteria 10946
199 Ga0496106_0103456 3300048909 Bacteria 2210
200 Ga0496112_0072493 3300048915 Bacteria 3405
201 Ga0496114_0000009 3300048917 Bacteria 370373
202 Ga0496114_0001716 3300048917 Bacteria 16633
203 Ga0501038_0501779 3300049574 Bacteria 928
204 Ga0501041_0422954 3300049577 Bacteria 845
205 Ga0501068_0008823 3300049584 Bacteria 5624
206 Ga0501071_0106633 3300049587 Bacteria 2069
207 Ga0501072_0028690 3300049588 Bacteria 4345
208 Ga0501072_0103503 3300049588 Bacteria 2263
209 Ga0501072_0223689 3300049588 Bacteria 1500
210 Ga0501073_0074283 3300049589 Bacteria 2367
211 Ga0501073_0132317 3300049589 Bacteria 1729
212 Ga0501075_0000198 3300049591 Bacteria 31770
213 Ga0501075_0007326 3300049591 Bacteria 7651
214 Ga0501075_0035033 3300049591 Bacteria 3742
215 Ga0501075_0131839 3300049591 Bacteria 1904
216 Ga0501076_0066581 3300049592 Bacteria 2875
217 Ga0501076_0230662 3300049592 Bacteria 1513
218 Ga0501076_0436956 3300049592 Bacteria 1077
219 Ga0501077_0026663 3300049593 Bacteria 3668
220 Ga0501077_0048675 3300049593 Bacteria 2694
221 Ga0501077_0130432 3300049593 Bacteria 1594
222 Ga0501079_0030022 3300049741 Bacteria 4176
223 Ga0501080_0011677 3300049742 Bacteria 8046
224 Ga0501080_0047989 3300049742 Bacteria 3976
225 Ga0501081_0004377 3300049743 Bacteria 9053
226 Ga0501081_0212365 3300049743 Bacteria 1406
227 Ga0501045_0509010 3300049824 Bacteria 894
228 nmdc:mga0k408_48424_c1 3300050493 Bacteria 2458
229 nmdc:mga07m45_89535_c1 3300050496 Bacteria 1762
230 nmdc:mga05p37_16244_c1 3300050507 Bacteria 8962
231 nmdc:mga06r32_87_c1 3300050510 Bacteria 63774
232 nmdc:mga08y16_116130_c1 3300050511 Bacteria 2786
233 nmdc:mga08y16_195545_c1 3300050511 Bacteria 2096
234 nmdc:mga0n895_247059_c1 3300050512 Bacteria 1811
235 nmdc:mga0n895_324504_c1 3300050512 Bacteria 1560
236 nmdc:mga0n895_32473_c1 3300050512 Bacteria 5011
237 nmdc:mga0n895_63151_c1 3300050512 Bacteria 3662
238 nmdc:mga0n895_703186_c1 3300050512 Bacteria 1007
239 nmdc:mga0n895_844636_c1 3300050512 Bacteria 904
240 nmdc:mga0rr50_92603_c1 3300050513 Bacteria 2357
241 nmdc:mga08x19_72_c1 3300050514 Bacteria 96429
242 nmdc:mga0a205_211368_c1 3300050515 Bacteria 1828
243 nmdc:mga0a205_3096_c1 3300050515 Bacteria 14752
244 nmdc:mga0a205_6191_c1 3300050515 Bacteria 10800
245 Ga0495595_0102708 3300053084 Bacteria 1381
246 Ga0500616_0002599 3300053153 Bacteria 14801
247 Ga0501084_0027856 3300054114 Bacteria 4722
248 Ga0501082_0076253 3300060353 Bacteria 2890
249 Ga0530510_0316998 3300061734 Bacteria 1168
250 Ga0206353_12070550
251 Ga0070676_10102053
252 Ga0070670_100544588
253 Ga0068869_100003812
254 Ga0070666_10054764
255 Ga0070661_100065768
256 Ga0070659_100020438
257 Ga0070703_10045770
258 Ga0070711_100021596
259 Ga0070711_100027789
260 Ga0070694_100340184
261 Ga0070708_100052504
262 Ga0070708_100092436
263 Ga0070708_100151836
264 Ga0070708_100233416
265 Ga0070708_100334216
266 Ga0070706_100290874
267 Ga0070707_100234456
268 Ga0070707_100344559
269 Ga0070698_100018885
270 Ga0070699_100019476
271 Ga0070699_100156036
272 Ga0070699_100177351
273 Ga0070699_100583076
274 Ga0070697_100028611
275 Ga0070697_100153394
276 Ga0068853_100018742
277 Ga0070695_100007890
278 Ga0070693_100033265
279 Ga0068855_100009003
280 Ga0068866_10288074
281 Ga0068861_100095360
282 Ga0068863_100024175
283 Ga0068858_100556434
284 Ga0068860_100179120
285 Ga0068862_100038714
286 Ga0081455_10000788
287 Ga0081538_10035211
288 Ga0081540_1018733
289 Ga0070712_100011684
290 Ga0075367_10071375
291 Ga0075366_10092666
292 Ga0075366_10136096
293 Ga0097621_100017190
294 Ga0075370_10094588
295 Ga0068871_100022994
296 Ga0068871_100069976
297 Ga0075428_100132399
298 Ga0075431_100000270
299 Ga0075431_100423141
300 Ga0075433_10126127
301 Ga0075433_10242618
302 Ga0075433_10249636
303 Ga0075434_100006115
304 Ga0075434_100071432
305 Ga0075434_100078275
306 Ga0075434_100293126
307 Ga0075434_100526751
308 Ga0075434_100624540
309 Ga0075434_100648149
310 Ga0075436_100000469
311 Ga0075436_100086535
312 Ga0075435_100024712
313 Ga0075435_100228276
314 Ga0075435_100505038
315 Ga0105240_10567435
316 Ga0111539_10001936
317 Ga0111539_10172320
318 Ga0111539_10408803
319 Ga0105245_10612445
320 Ga0114129_10028017
321 Ga0105248_10142294
322 Ga0105248_10730888
323 Ga0105249_10043513
324 Ga0105249_10174560
325 Ga0105239_10654168
326 Ga0105239_10812370
327 Ga0163162_10428223
328 Ga0157372_10532542
329 Ga0157380_10298337
330 Ga0157380_10476378
331 Ga0157376_10001124
332 Ga0207653_10020228
333 Ga0207642_10377346
334 Ga0207645_10138228
335 Ga0207707_10488437
336 Ga0207695_10060823
337 Ga0207695_10654855
338 Ga0207693_10029318
339 Ga0207663_10012369
340 Ga0207649_10039913
341 Ga0207652_10211364
342 Ga0207646_10048579
343 Ga0207646_10205818
344 Ga0207646_10295208
345 Ga0207650_10392315
346 Ga0207706_10106478
347 Ga0207665_10188607
348 Ga0207665_10230768
349 Ga0207689_10001241
350 Ga0207667_10013341
351 Ga0207651_10016474
352 Ga0207712_10039932
353 Ga0207703_10172832
354 Ga0207678_10076673
355 Ga0207702_10072682
356 Ga0207641_10760401
357 Ga0207641_10833543
358 Ga0207675_100101751
359 Ga0207428_10002635
360 Ga0207428_10068349
361 Ga0268265_10065456
362 Ga0268264_10245477
363 Ga0265334_10035466
364 Ga0265338_10138663
365 Ga0265340_10041316
366 Ga0265327_10036301
367 Ga0265327_10059826
368 Ga0307508_10004466
369 Ga0265314_10005470
370 Ga0316576_10016707
371 Ga0316576_10033408
372 Ga0316576_10384933
373 Ga0316577_10015338
374 Ga0316577_10018801
375 Ga0307409_100038885
376 Ga0316583_10000245
377 Ga0316593_10003153
378 Ga0316593_10003830
379 Ga0316593_10004032
380 Ga0316593_10047773
381 Ga0316593_10072110
382 Ga0316592_1017454
383 Ga0316588_1005562
384 Ga0316588_1032773
385 Ga0316596_1004060
386 Ga0316596_1042889
387 Ga0373926_0121968
388 Ga0373931_0009139
389 Ga0373931_0349024
390 Ga0373927_0001839
391 Ga0373927_0014051
392 Ga0373947_0405384
393 Ga0373937_0166415
394 Ga0316582_0011446
395 Ga0316582_0071841
396 Ga0316582_0074916
397 Ga0316582_0123662
398 Ga0316584_0063289
399 Ga0316584_0549232
400 Ga0373925_0003109
401 Ga0373925_0243663
402 Ga0316581_0040184
403 Ga0316581_0047453
404 Ga0395901_0436410
405 Ga0400489_13864
406 Ga0451807_1465773
407 Ga0439462_0051331
408 Ga0450898_022628
409 Ga0439446_0002374
410 Ga0439434_0058475
411 Ga0451577_0000035
412 Ga0451577_0004042
413 Ga0451577_0010923
414 Ga0451577_0044723
415 Ga0451577_0046609
416 Ga0451577_0066371
417 Ga0451577_0523223
418 Ga0453683_0000014
419 Ga0453683_0068114
420 Ga0453683_0116799
421 Ga0466961_0273734
422 Ga0466964_0096953
423 Ga0453684_0000053
424 Ga0453684_0000097
425 Ga0453684_0000210
426 Ga0453684_0000718
427 Ga0453684_0001583
428 Ga0453684_0010714
429 Ga0453684_0011164
430 Ga0453684_0011865
431 Ga0453684_0061651
432 Ga0453684_0065404
433 Ga0453684_0091251
434 Ga0453684_0092710
435 Ga0453684_0300825
436 Ga0453684_1013453
437 Ga0466960_0235438
438 Ga0466959_0052248
439 Ga0451576_0000089
440 Ga0451576_0134921
441 Ga0451576_0452806
442 Ga0451576_0551629
443 Ga0451576_0553019
444 Ga0495636_0204615
445 Ga0496100_0006095
446 Ga0496101_0006432
447 Ga0496104_0005659
448 Ga0496106_0103456
449 Ga0496112_0072493
450 Ga0496114_0000009
451 Ga0496114_0001716
452 Ga0501038_0501779
453 Ga0501041_0422954
454 Ga0501068_0008823
455 Ga0501071_0106633
456 Ga0501072_0028690
457 Ga0501072_0103503
458 Ga0501072_0223689
459 Ga0501073_0074283
460 Ga0501073_0132317
461 Ga0501075_0000198
462 Ga0501075_0007326
463 Ga0501075_0035033
464 Ga0501075_0131839
465 Ga0501076_0066581
466 Ga0501076_0230662
467 Ga0501076_0436956
468 Ga0501077_0026663
469 Ga0501077_0048675
470 Ga0501077_0130432
471 Ga0501079_0030022
472 Ga0501080_0011677
473 Ga0501080_0047989
474 Ga0501081_0004377
475 Ga0501081_0212365
476 Ga0501045_0509010
477 nmdc:mga0k408_48424_c1
478 nmdc:mga07m45_89535_c1
479 nmdc:mga05p37_16244_c1
480 nmdc:mga06r32_87_c1
481 nmdc:mga08y16_116130_c1
482 nmdc:mga08y16_195545_c1
483 nmdc:mga0n895_247059_c1
484 nmdc:mga0n895_324504_c1
485 nmdc:mga0n895_32473_c1
486 nmdc:mga0n895_63151_c1
487 nmdc:mga0n895_703186_c1
488 nmdc:mga0n895_844636_c1
489 nmdc:mga0rr50_92603_c1
490 nmdc:mga08x19_72_c1
491 nmdc:mga0a205_211368_c1
492 nmdc:mga0a205_3096_c1
493 nmdc:mga0a205_6191_c1
494 Ga0495595_0102708
495 Ga0500616_0002599
496 Ga0501084_0027856
497 Ga0501082_0076253
498 Ga0530510_0316998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

40

240

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b1n-assembly1.cif.gz_B crystal structure of trmd-tm1570 from calditerrivibrio nitroreducens in complex with s-adenosyl-l-methionine 0.9178 2 227
8byh-assembly1.cif.gz_A crystal structure of trmd domain from calditerrivibrio nitroreducens in complex with s-adenosyl-l-methionine 0.9114 2 227
8byh-assembly1.cif.gz_B crystal structure of trmd domain from calditerrivibrio nitroreducens in complex with s-adenosyl-l-methionine 0.9112 2 226
8b1n-assembly1.cif.gz_A crystal structure of trmd-tm1570 from calditerrivibrio nitroreducens in complex with s-adenosyl-l-methionine 0.9103 2 232
4ig6-assembly1.cif.gz_A crystal structure of a trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum bound to s-adenosylhomocysteine 0.8948 2 210
ID Description Score Start End Superfamily
3quvB02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9738 162 211 1.10.1270.20
5zhkA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9689 162 210 1.10.1270.20
5zhlA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9656 162 210 1.10.1270.20
4ig6A02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9608 161 210 1.10.1270.20
5zhjA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9472 166 209 1.10.1270.20
ID Description Score Start End GO Terms
AF-A0A348NA91-F1-model_v4 deleted 0.9611 70 210
AF-A0A3M1NAI2-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.9541 2 210 GO:0002939
GO:0005829
GO:0052906
AF-A0A7C3IZ41-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9535 2 207 GO:0002939
GO:0005829
GO:0052906
AF-A0A354HIZ7-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9531 2 212 GO:0002939
GO:0005829
GO:0052906
AF-A0A2V6KQD6-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.953 54 211 GO:0002939
GO:0005829
GO:0052906

Map