F360553

General Info

Members Datasets Scaffolds Average Seq Length
249 153 498 188

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100089655|Ga0068867_1000896552
Length 231
Sequence MLLLNRKTNAEECDATEALYLQTAWLKKILAEYYCINKQETDLSMNEHHNPWQIISKKEIYDNNWLTVTHFDVINPSGGKGIYGKVHFKNIAIGIVPLDENMNTYLVGQYRFPIEQYSWEIPEGGGPLNDDPLHSAQRELLEEAGLKAVRWIKILDMHLSNSVSDEACAVYIATGLSQHSAMPEETEQLLIKKIPFDEVYQMVQTGKITDAVTVAAVLKTKLMLLDGTIKL

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
135 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
136 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
137 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
138 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
139 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
151 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
152 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
153 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.02
Nodule 0
Rhizoplane 0.4
Rhizosphere 89.96
Stem 0
Stem Tuber 0
Unclassified 3.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100089655 3300005459 Bacteria 2332
2 JGI24736J21556_1003689 3300001904 Bacteria 2645
3 JGI24740J21852_10010625 3300001979 Bacteria 3536
4 JGI24737J22298_10013203 3300001990 Bacteria 2690
5 JGI24735J21928_10013850 3300002067 Bacteria 2529
6 rootH2_10012714 3300003320 Bacteria 66260
7 rootH2_10044553 3300003320 Bacteria 4167
8 rootH2_10058845 3300003320 Bacteria 2121
9 rootH2_10160929 3300003320 Bacteria 10668
10 rootL2_10203748 3300003322 Bacteria 1644
11 rootH1_10020487 3300003323 Bacteria 1667
12 rootH1_10025575 3300003323 Bacteria 6892
13 JGI25160J50197_1000745 3300003354 Bacteria 17705
14 Ga0065704_10167672 3300005289 Bacteria 1312
15 Ga0070676_10332927 3300005328 Unclassified 1039
16 Ga0070690_100527810 3300005330 Bacteria 887
17 Ga0070677_10310933 3300005333 Bacteria 804
18 Ga0068869_100012175 3300005334 Bacteria 5674
19 Ga0070666_10000405 3300005335 Bacteria 27033
20 Ga0068868_100102222 3300005338 Bacteria 2320
21 Ga0068868_100154167 3300005338 Bacteria 1894
22 Ga0068868_100187676 3300005338 Bacteria 1718
23 Ga0070689_100023390 3300005340 Bacteria 4625
24 Ga0070687_100036485 3300005343 Bacteria 2450
25 Ga0070675_100967976 3300005354 Bacteria 781
26 Ga0070671_100006063 3300005355 Bacteria 9632
27 Ga0070671_100206375 3300005355 Bacteria 1666
28 Ga0070673_100020458 3300005364 Bacteria 4774
29 Ga0070673_100125934 3300005364 Bacteria 2143
30 Ga0070688_101075157 3300005365 Bacteria 642
31 Ga0070659_100001588 3300005366 Bacteria 16376
32 Ga0070667_100013268 3300005367 Bacteria 6806
33 Ga0070667_100060819 3300005367 Bacteria 3197
34 Ga0070667_100385832 3300005367 Bacteria 1273
35 Ga0070663_100012482 3300005455 Bacteria 5376
36 Ga0070678_101013305 3300005456 Bacteria 764
37 Ga0070662_100615404 3300005457 Bacteria 914
38 Ga0068867_100172119 3300005459 Bacteria 1716
39 Ga0070685_10018124 3300005466 Bacteria 3781
40 Ga0070684_100709601 3300005535 Bacteria 938
41 Ga0068853_100904876 3300005539 Bacteria 848
42 Ga0070672_100187027 3300005543 Bacteria 1728
43 Ga0070686_100036471 3300005544 Bacteria 3045
44 Ga0068855_100070603 3300005563 Bacteria 4063
45 Ga0068855_100129887 3300005563 Bacteria 2878
46 Ga0068857_100012630 3300005577 Bacteria 7360
47 Ga0068857_100081003 3300005577 Bacteria 2899
48 Ga0068857_100410650 3300005577 Bacteria 1261
49 Ga0068856_100053444 3300005614 Bacteria 3982
50 Ga0070702_100049452 3300005615 Bacteria 2398
51 Ga0068852_100028541 3300005616 Bacteria 4569
52 Ga0068852_100195156 3300005616 Bacteria 1913
53 Ga0068852_100312821 3300005616 Unclassified 1523
54 Ga0068859_100000066 3300005617 Bacteria 100640
55 Ga0068859_100829534 3300005617 Unclassified 1011
56 Ga0068864_100105929 3300005618 Bacteria 2500
57 Ga0068864_100320127 3300005618 Bacteria 1456
58 Ga0068864_100605877 3300005618 Bacteria 1063
59 Ga0068861_100930247 3300005719 Bacteria 825
60 Ga0068851_10340250 3300005834 Bacteria 871
61 Ga0068870_10569594 3300005840 Bacteria 765
62 Ga0068863_100002306 3300005841 Bacteria 18971
63 Ga0068863_100029418 3300005841 Bacteria 5244
64 Ga0068863_101422243 3300005841 Bacteria 701
65 Ga0068858_100038172 3300005842 Bacteria 4454
66 Ga0068860_100057694 3300005843 Bacteria 3691
67 Ga0068860_100550087 3300005843 Bacteria 1156
68 Ga0068862_100899470 3300005844 Bacteria 870
69 Ga0068862_101178205 3300005844 Bacteria 764
70 Ga0081539_10159849 3300005985 Bacteria 1075
71 Ga0075366_10063526 3300006195 Bacteria 2195
72 Ga0097621_100085791 3300006237 Bacteria 2626
73 Ga0097621_100431658 3300006237 Bacteria 1184
74 Ga0075429_100291628 3300006880 Bacteria 1428
75 Ga0068865_100154191 3300006881 Bacteria 1746
76 Ga0068865_100594929 3300006881 Bacteria 934
77 Ga0097620_100000066 3300006931 Bacteria 100640
78 Ga0097620_100188956 3300006931 Bacteria 2144
79 Ga0097620_100829590 3300006931 Unclassified 1011
80 Ga0105240_10003903 3300009093 Bacteria 23022
81 Ga0105240_10027708 3300009093 Bacteria 7414
82 Ga0105240_10035196 3300009093 Bacteria 6455
83 Ga0105245_10156130 3300009098 Bacteria 2161
84 Ga0114129_10037330 3300009147 Bacteria 6860
85 Ga0105243_10328048 3300009148 Bacteria 1397
86 Ga0105243_11086126 3300009148 Bacteria 808
87 Ga0105241_10001740 3300009174 Bacteria 16524
88 Ga0105241_10173755 3300009174 Bacteria 1781
89 Ga0105241_10195465 3300009174 Bacteria 1686
90 Ga0105241_10222556 3300009174 Bacteria 1587
91 Ga0105242_10147238 3300009176 Bacteria 2050
92 Ga0105237_10003163 3300009545 Bacteria 19782
93 Ga0105237_10035471 3300009545 Bacteria 5047
94 Ga0105237_10232278 3300009545 Bacteria 1845
95 Ga0105238_10065037 3300009551 Bacteria 3648
96 Ga0105238_10091214 3300009551 Bacteria 3034
97 Ga0105238_10309650 3300009551 Bacteria 1564
98 Ga0105238_10689200 3300009551 Unclassified 1033
99 Ga0105249_10003050 3300009553 Bacteria 14455
100 Ga0105239_10000865 3300010375 Bacteria 43041
101 Ga0105239_10002482 3300010375 Bacteria 23507
102 Ga0105239_10011094 3300010375 Bacteria 10055
103 Ga0105239_10066837 3300010375 Bacteria 3949
104 Ga0105239_10231629 3300010375 Bacteria 2072
105 Ga0105239_10340021 3300010375 Bacteria 1694
106 Ga0105239_11419485 3300010375 Unclassified 802
107 Ga0105246_10094520 3300011119 Bacteria 2162
108 Ga0157373_10000678 3300013100 Bacteria 26681
109 Ga0157373_10541544 3300013100 Bacteria 843
110 Ga0157371_10000107 3300013102 Bacteria 126477
111 Ga0157371_10001167 3300013102 Bacteria 28190
112 Ga0157370_10018299 3300013104 Bacteria 7047
113 Ga0157370_10129299 3300013104 Bacteria 2357
114 Ga0157370_10397110 3300013104 Bacteria 1269
115 Ga0157369_10001802 3300013105 Bacteria 25924
116 Ga0157374_10221234 3300013296 Bacteria 1858
117 Ga0157374_10463122 3300013296 Bacteria 1270
118 Ga0157378_10004660 3300013297 Bacteria 12026
119 Ga0157378_10032884 3300013297 Bacteria 4584
120 Ga0157378_10211242 3300013297 Bacteria 1840
121 Ga0157378_10427805 3300013297 Bacteria 1310
122 Ga0163162_10001227 3300013306 Bacteria 23959
123 Ga0163162_10001762 3300013306 Bacteria 20284
124 Ga0163162_10153483 3300013306 Bacteria 2421
125 Ga0163162_10319728 3300013306 Bacteria 1684
126 Ga0163162_11033419 3300013306 Bacteria 930
127 Ga0157372_10000039 3300013307 Bacteria 165839
128 Ga0157372_10000238 3300013307 Bacteria 60988
129 Ga0157372_11559602 3300013307 Bacteria 760
130 Ga0157372_11604776 3300013307 Bacteria 749
131 Ga0157375_10017179 3300013308 Bacteria 6523
132 Ga0157375_10240066 3300013308 Bacteria 1972
133 Ga0157375_10242445 3300013308 Bacteria 1962
134 Ga0157375_10793017 3300013308 Bacteria 1096
135 Ga0163163_10566242 3300014325 Bacteria 1199
136 Ga0157379_10078393 3300014968 Bacteria 2959
137 Ga0157376_10003452 3300014969 Bacteria 10889
138 Ga0157376_10015110 3300014969 Bacteria 5819
139 Ga0157376_10711766 3300014969 Bacteria 1010
140 Ga0163161_10505716 3300017792 Bacteria 985
141 Ga0207426_1000002 3300025302 Bacteria 1249660
142 Ga0207682_10279656 3300025893 Bacteria 780
143 Ga0207680_10000143 3300025903 Bacteria 34125
144 Ga0207647_10000071 3300025904 Bacteria 79170
145 Ga0207645_10177434 3300025907 Bacteria 1397
146 Ga0207643_10041612 3300025908 Bacteria 2589
147 Ga0207643_10076596 3300025908 Bacteria 1932
148 Ga0207654_10053685 3300025911 Bacteria 2327
149 Ga0207654_10062906 3300025911 Bacteria 2176
150 Ga0207695_10000039 3300025913 Bacteria 454801
151 Ga0207695_10000142 3300025913 Bacteria 214715
152 Ga0207695_10038987 3300025913 Bacteria 5109
153 Ga0207671_10000110 3300025914 Bacteria 126480
154 Ga0207671_10001491 3300025914 Bacteria 27003
155 Ga0207662_10191899 3300025918 Bacteria 1319
156 Ga0207694_10318929 3300025924 Bacteria 1282
157 Ga0207659_10383215 3300025926 Bacteria 1173
158 Ga0207644_10005924 3300025931 Bacteria 7969
159 Ga0207644_10109825 3300025931 Bacteria 2084
160 Ga0207690_10004024 3300025932 Bacteria 8680
161 Ga0207669_10235936 3300025937 Bacteria 1353
162 Ga0207704_10747479 3300025938 Bacteria 813
163 Ga0207691_10123782 3300025940 Bacteria 2289
164 Ga0207689_10037907 3300025942 Bacteria 3995
165 Ga0207689_10161522 3300025942 Bacteria 1846
166 Ga0207689_10242474 3300025942 Bacteria 1490
167 Ga0207667_10008543 3300025949 Bacteria 12153
168 Ga0207667_10227257 3300025949 Bacteria 1911
169 Ga0207651_10032157 3300025960 Bacteria 3366
170 Ga0207712_10007340 3300025961 Bacteria 6958
171 Ga0207658_10013185 3300025986 Bacteria 5644
172 Ga0207658_10237262 3300025986 Bacteria 1543
173 Ga0207677_10002453 3300026023 Bacteria 9745
174 Ga0207677_10298085 3300026023 Bacteria 1331
175 Ga0207677_10417720 3300026023 Bacteria 1142
176 Ga0207703_10002420 3300026035 Bacteria 16204
177 Ga0207703_10798035 3300026035 Bacteria 901
178 Ga0207639_11021864 3300026041 Bacteria 774
179 Ga0207678_10057125 3300026067 Bacteria 3358
180 Ga0207641_10000828 3300026088 Bacteria 32919
181 Ga0207641_10023263 3300026088 Bacteria 5106
182 Ga0207641_11563759 3300026088 Bacteria 661
183 Ga0207648_10123959 3300026089 Bacteria 2272
184 Ga0207674_10044287 3300026116 Bacteria 4583
185 Ga0207674_10091574 3300026116 Bacteria 3030
186 Ga0207674_10357220 3300026116 Bacteria 1412
187 Ga0207683_10905661 3300026121 Bacteria 819
188 Ga0207698_10024341 3300026142 Bacteria 4248
189 Ga0207698_10115212 3300026142 Unclassified 2263
190 Ga0268264_10046683 3300028381 Bacteria 3598
191 Ga0265327_10000432 3300031251 Bacteria 75935
192 Ga0307509_10072318 3300031507 Bacteria 3593
193 Ga0373936_0179733 3300035113 Bacteria 928
194 Ga0395899_0000024 3300037312 Bacteria 357402
195 Ga0395900_0133268 3300037418 Bacteria 2546
196 Ga0395901_0099644 3300038443 Bacteria 3047
197 Ga0451791_0762432 3300041451 Bacteria 905
198 Ga0451853_1798140 3300041512 Bacteria 1294
199 Ga0466969_0000167 3300044656 Bacteria 35385
200 Ga0466969_0018232 3300044656 Bacteria 3659
201 Ga0466966_0000161 3300044684 Bacteria 43671
202 Ga0466966_0007294 3300044684 Bacteria 7325
203 Ga0466961_0008755 3300044693 Bacteria 6454
204 Ga0466959_0000005 3300045049 Bacteria 213958
205 Ga0466958_0004908 3300045836 Bacteria 7129
206 Ga0495632_0317373 3300046519 Bacteria 689
207 Ga0495668_0002880 3300046616 Bacteria 13634
208 Ga0495625_0044153 3300046660 Bacteria 3228
209 Ga0495687_024467 3300047443 Bacteria 2869
210 Ga0501032_0028628 3300049569 Bacteria 3827
211 Ga0501033_0023956 3300049570 Bacteria 4605
212 Ga0501034_0004134 3300049571 Bacteria 16252
213 Ga0501034_0668452 3300049571 Bacteria 939
214 Ga0501036_0045209 3300049572 Bacteria 3731
215 Ga0501037_0002736 3300049573 Bacteria 12747
216 Ga0501037_0021494 3300049573 Bacteria 4770
217 Ga0501039_0136624 3300049575 Bacteria 1925
218 Ga0501043_0067501 3300049579 Bacteria 2808
219 Ga0501043_0068257 3300049579 Bacteria 2791
220 Ga0501047_0003566 3300049581 Bacteria 14690
221 Ga0501047_0076135 3300049581 Bacteria 3229
222 Ga0501047_0227858 3300049581 Bacteria 1718
223 Ga0501223_003348 3300049663 Bacteria 3500
224 Ga0501224_003410 3300049664 Bacteria 2215
225 Ga0501227_052355 3300049665 Bacteria 1033
226 Ga0501235_000285 3300049669 Bacteria 9473
227 Ga0501221_005352 3300049704 Bacteria 2142
228 Ga0501225_0001076 3300049705 Bacteria 8572
229 Ga0501225_0002770 3300049705 Bacteria 5381
230 Ga0501035_0147385 3300049822 Bacteria 2043
231 Ga0501035_0249597 3300049822 Bacteria 1507
232 Ga0501044_0008438 3300049823 Bacteria 11298
233 Ga0501044_0010721 3300049823 Bacteria 9946
234 Ga0501044_0107675 3300049823 Bacteria 2798
235 Ga0501044_0516027 3300049823 Unclassified 1095
236 nmdc:mga0k408_253803_c1 3300050493 Bacteria 1050
237 nmdc:mga05p37_28588_c1 3300050507 Bacteria 6799
238 nmdc:mga09592_731215_c1 3300050508 Bacteria 841
239 Ga0500578_0000066 3300053086 Bacteria 116854
240 Ga0500578_0087580 3300053086 Bacteria 1978
241 Ga0500646_0012831 3300053090 Bacteria 2167
242 Ga0500583_0000002 3300053092 Bacteria 232826
243 Ga0500583_0002413 3300053092 Bacteria 5611
244 Ga0500651_0401809 3300053093 Unclassified 769
245 Ga0500641_0024312 3300053096 Bacteria 2335
246 Ga0500559_0143307 3300053136 Bacteria 1119
247 Ga0500589_043011 3300053147 Bacteria 2105
248 Ga0500604_0061769 3300053151 Bacteria 1178
249 Ga0500622_0021555 3300053156 Bacteria 3419
250 Ga0068867_100089655
251 JGI24736J21556_1003689
252 JGI24740J21852_10010625
253 JGI24737J22298_10013203
254 JGI24735J21928_10013850
255 rootH2_10012714
256 rootH2_10044553
257 rootH2_10058845
258 rootH2_10160929
259 rootL2_10203748
260 rootH1_10020487
261 rootH1_10025575
262 JGI25160J50197_1000745
263 Ga0065704_10167672
264 Ga0070676_10332927
265 Ga0070690_100527810
266 Ga0070677_10310933
267 Ga0068869_100012175
268 Ga0070666_10000405
269 Ga0068868_100102222
270 Ga0068868_100154167
271 Ga0068868_100187676
272 Ga0070689_100023390
273 Ga0070687_100036485
274 Ga0070675_100967976
275 Ga0070671_100006063
276 Ga0070671_100206375
277 Ga0070673_100020458
278 Ga0070673_100125934
279 Ga0070688_101075157
280 Ga0070659_100001588
281 Ga0070667_100013268
282 Ga0070667_100060819
283 Ga0070667_100385832
284 Ga0070663_100012482
285 Ga0070678_101013305
286 Ga0070662_100615404
287 Ga0068867_100172119
288 Ga0070685_10018124
289 Ga0070684_100709601
290 Ga0068853_100904876
291 Ga0070672_100187027
292 Ga0070686_100036471
293 Ga0068855_100070603
294 Ga0068855_100129887
295 Ga0068857_100012630
296 Ga0068857_100081003
297 Ga0068857_100410650
298 Ga0068856_100053444
299 Ga0070702_100049452
300 Ga0068852_100028541
301 Ga0068852_100195156
302 Ga0068852_100312821
303 Ga0068859_100000066
304 Ga0068859_100829534
305 Ga0068864_100105929
306 Ga0068864_100320127
307 Ga0068864_100605877
308 Ga0068861_100930247
309 Ga0068851_10340250
310 Ga0068870_10569594
311 Ga0068863_100002306
312 Ga0068863_100029418
313 Ga0068863_101422243
314 Ga0068858_100038172
315 Ga0068860_100057694
316 Ga0068860_100550087
317 Ga0068862_100899470
318 Ga0068862_101178205
319 Ga0081539_10159849
320 Ga0075366_10063526
321 Ga0097621_100085791
322 Ga0097621_100431658
323 Ga0075429_100291628
324 Ga0068865_100154191
325 Ga0068865_100594929
326 Ga0097620_100000066
327 Ga0097620_100188956
328 Ga0097620_100829590
329 Ga0105240_10003903
330 Ga0105240_10027708
331 Ga0105240_10035196
332 Ga0105245_10156130
333 Ga0114129_10037330
334 Ga0105243_10328048
335 Ga0105243_11086126
336 Ga0105241_10001740
337 Ga0105241_10173755
338 Ga0105241_10195465
339 Ga0105241_10222556
340 Ga0105242_10147238
341 Ga0105237_10003163
342 Ga0105237_10035471
343 Ga0105237_10232278
344 Ga0105238_10065037
345 Ga0105238_10091214
346 Ga0105238_10309650
347 Ga0105238_10689200
348 Ga0105249_10003050
349 Ga0105239_10000865
350 Ga0105239_10002482
351 Ga0105239_10011094
352 Ga0105239_10066837
353 Ga0105239_10231629
354 Ga0105239_10340021
355 Ga0105239_11419485
356 Ga0105246_10094520
357 Ga0157373_10000678
358 Ga0157373_10541544
359 Ga0157371_10000107
360 Ga0157371_10001167
361 Ga0157370_10018299
362 Ga0157370_10129299
363 Ga0157370_10397110
364 Ga0157369_10001802
365 Ga0157374_10221234
366 Ga0157374_10463122
367 Ga0157378_10004660
368 Ga0157378_10032884
369 Ga0157378_10211242
370 Ga0157378_10427805
371 Ga0163162_10001227
372 Ga0163162_10001762
373 Ga0163162_10153483
374 Ga0163162_10319728
375 Ga0163162_11033419
376 Ga0157372_10000039
377 Ga0157372_10000238
378 Ga0157372_11559602
379 Ga0157372_11604776
380 Ga0157375_10017179
381 Ga0157375_10240066
382 Ga0157375_10242445
383 Ga0157375_10793017
384 Ga0163163_10566242
385 Ga0157379_10078393
386 Ga0157376_10003452
387 Ga0157376_10015110
388 Ga0157376_10711766
389 Ga0163161_10505716
390 Ga0207426_1000002
391 Ga0207682_10279656
392 Ga0207680_10000143
393 Ga0207647_10000071
394 Ga0207645_10177434
395 Ga0207643_10041612
396 Ga0207643_10076596
397 Ga0207654_10053685
398 Ga0207654_10062906
399 Ga0207695_10000039
400 Ga0207695_10000142
401 Ga0207695_10038987
402 Ga0207671_10000110
403 Ga0207671_10001491
404 Ga0207662_10191899
405 Ga0207694_10318929
406 Ga0207659_10383215
407 Ga0207644_10005924
408 Ga0207644_10109825
409 Ga0207690_10004024
410 Ga0207669_10235936
411 Ga0207704_10747479
412 Ga0207691_10123782
413 Ga0207689_10037907
414 Ga0207689_10161522
415 Ga0207689_10242474
416 Ga0207667_10008543
417 Ga0207667_10227257
418 Ga0207651_10032157
419 Ga0207712_10007340
420 Ga0207658_10013185
421 Ga0207658_10237262
422 Ga0207677_10002453
423 Ga0207677_10298085
424 Ga0207677_10417720
425 Ga0207703_10002420
426 Ga0207703_10798035
427 Ga0207639_11021864
428 Ga0207678_10057125
429 Ga0207641_10000828
430 Ga0207641_10023263
431 Ga0207641_11563759
432 Ga0207648_10123959
433 Ga0207674_10044287
434 Ga0207674_10091574
435 Ga0207674_10357220
436 Ga0207683_10905661
437 Ga0207698_10024341
438 Ga0207698_10115212
439 Ga0268264_10046683
440 Ga0265327_10000432
441 Ga0307509_10072318
442 Ga0373936_0179733
443 Ga0395899_0000024
444 Ga0395900_0133268
445 Ga0395901_0099644
446 Ga0451791_0762432
447 Ga0451853_1798140
448 Ga0466969_0000167
449 Ga0466969_0018232
450 Ga0466966_0000161
451 Ga0466966_0007294
452 Ga0466961_0008755
453 Ga0466959_0000005
454 Ga0466958_0004908
455 Ga0495632_0317373
456 Ga0495668_0002880
457 Ga0495625_0044153
458 Ga0495687_024467
459 Ga0501032_0028628
460 Ga0501033_0023956
461 Ga0501034_0004134
462 Ga0501034_0668452
463 Ga0501036_0045209
464 Ga0501037_0002736
465 Ga0501037_0021494
466 Ga0501039_0136624
467 Ga0501043_0067501
468 Ga0501043_0068257
469 Ga0501047_0003566
470 Ga0501047_0076135
471 Ga0501047_0227858
472 Ga0501223_003348
473 Ga0501224_003410
474 Ga0501227_052355
475 Ga0501235_000285
476 Ga0501221_005352
477 Ga0501225_0001076
478 Ga0501225_0002770
479 Ga0501035_0147385
480 Ga0501035_0249597
481 Ga0501044_0008438
482 Ga0501044_0010721
483 Ga0501044_0107675
484 Ga0501044_0516027
485 nmdc:mga0k408_253803_c1
486 nmdc:mga05p37_28588_c1
487 nmdc:mga09592_731215_c1
488 Ga0500578_0000066
489 Ga0500578_0087580
490 Ga0500646_0012831
491 Ga0500583_0000002
492 Ga0500583_0002413
493 Ga0500651_0401809
494 Ga0500641_0024312
495 Ga0500559_0143307
496 Ga0500589_043011
497 Ga0500604_0061769
498 Ga0500622_0021555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

88

216

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yvm-assembly1.cif.gz_A crystal structure of ndx2 in complex with mg2+ from thermus thermophilus hb8 0.8902 6 183
2w4e-assembly1.cif.gz_B structure of an n-terminally truncated nudix hydrolase dr2204 from deinococcus radiodurans 0.8889 45 183
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.8864 9 183
2w4e-assembly1.cif.gz_A structure of an n-terminally truncated nudix hydrolase dr2204 from deinococcus radiodurans 0.8861 42 183
5c7q-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.8847 9 184
ID Description Score Start End Superfamily
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.911 9 176 3.90.79.10
2yvmA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8902 6 183 3.90.79.10
2w4eB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8889 45 183 3.90.79.10
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8865 9 183 3.90.79.10
2w4eB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8761 45 183 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A7C2X0M0-F1-model_v4 NUDIX hydrolase 0.9828 57 184 GO:0016787
AF-A0A2D8FQS0-F1-model_v4 DNA mismatch repair protein MutT 0.9809 41 184 GO:0016787
AF-A0A645C5A4-F1-model_v4 Methanol dehydrogenase activator (EC 3.-.-.-) 0.977 45 178 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-A0A3B9MMZ3-F1-model_v4 Nudix hydrolase domain-containing protein 0.9729 74 181 GO:0016787
AF-A0A426H7P5-F1-model_v4 deleted 0.9683 30 181

Map