F360458

General Info

Members Datasets Scaffolds Average Seq Length
249 142 498 282

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100054780|Ga0070683_1000547802
Length 281
Sequence VRFLNRPLGRLSRYRRGPVAGLLVVLLGLLLTGGLYAAFSPASAHDDDSEAQIEKGRQLFLVGCSFCHGDNGQGVKTLDGNQLGPPLIGVGAAAVDFQVGTGRMPAVQPGPQIPQKEVSYTPDEIAALAAYVASLGKADYDISNMTDEELQEAITRGGEIFLTNCTACHNFEGSGGAMPHGGYAPKIRGVEPKYIFEAMLTGPQAMDNFSNGNLSVDEKRDIIAYLQSLEDNPDYGGFGMGGIGPVSEGMFAWIVGIGSLVGVATWIAAHTARSSKEKAES

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
81 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
82 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
83 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
84 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
131 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
139 2643221576 Nocardioides sp. Root614 Isolate Unclassified
140 2643221590 Nocardioides sp. Root682 Isolate Unclassified
141 2643221641 Nocardioides sp. Root122 Isolate Unclassified
142 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.19
Metatranscriptomes 1.2
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.88
Nodule 0
Rhizoplane 14.06
Rhizosphere 64.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100054780 3300005329 Bacteria 3698
2 JGI24737J22298_10008014 3300001990 Bacteria 3550
3 Ga0070683_100020975 3300005329 Bacteria 5826
4 Ga0068869_100123334 3300005334 Bacteria 1984
5 Ga0070682_100047033 3300005337 Bacteria 2680
6 Ga0070682_100424211 3300005337 Bacteria 1012
7 Ga0068868_100172911 3300005338 Bacteria 1789
8 Ga0070660_100038081 3300005339 Bacteria 3648
9 Ga0070659_100012753 3300005366 Bacteria 6239
10 Ga0070667_100020155 3300005367 Bacteria 5537
11 Ga0070667_100392427 3300005367 Bacteria 1262
12 Ga0070662_100251076 3300005457 Bacteria 1422
13 Ga0070679_100034357 3300005530 Bacteria 5025
14 Ga0070684_100000520 3300005535 Bacteria 26402
15 Ga0070684_100217709 3300005535 Bacteria 1742
16 Ga0070684_100295490 3300005535 Bacteria 1486
17 Ga0070665_100001493 3300005548 Bacteria 27224
18 Ga0070665_100114690 3300005548 Bacteria 2697
19 Ga0070665_100251536 3300005548 Bacteria 1768
20 Ga0068855_100169557 3300005563 Bacteria 2472
21 Ga0068857_100017453 3300005577 Bacteria 6291
22 Ga0068856_100121695 3300005614 Bacteria 2611
23 Ga0070702_100140834 3300005615 Bacteria 1536
24 Ga0068864_100047210 3300005618 Bacteria 3698
25 Ga0068863_100112979 3300005841 Bacteria 2587
26 Ga0068860_100129387 3300005843 Bacteria 2422
27 Ga0068862_100221242 3300005844 Bacteria 1714
28 Ga0081539_10102345 3300005985 Bacteria 1457
29 Ga0075365_10096027 3300006038 Bacteria 2025
30 Ga0075365_10129427 3300006038 Bacteria 1746
31 Ga0075365_10134892 3300006038 Bacteria 1710
32 Ga0075365_10146824 3300006038 Bacteria 1639
33 Ga0075365_10250875 3300006038 Bacteria 1243
34 Ga0075368_10000515 3300006042 Bacteria 11534
35 Ga0075363_100019875 3300006048 Bacteria 3362
36 Ga0075364_10070748 3300006051 Bacteria 2297
37 Ga0075364_10212553 3300006051 Bacteria 1312
38 Ga0075362_10082840 3300006177 Bacteria 1481
39 Ga0075367_10007493 3300006178 Bacteria 5591
40 Ga0075367_10021638 3300006178 Bacteria 3596
41 Ga0075367_10033437 3300006178 Bacteria 2963
42 Ga0075367_10189772 3300006178 Bacteria 1282
43 Ga0075370_10002627 3300006353 Bacteria 8385
44 Ga0075370_10058624 3300006353 Bacteria 2190
45 Ga0068865_100059033 3300006881 Bacteria 2682
46 Ga0068865_100266405 3300006881 Bacteria 1359
47 Ga0105245_10023011 3300009098 Bacteria 5467
48 Ga0105243_10325919 3300009148 Bacteria 1401
49 Ga0105249_10028313 3300009553 Bacteria 5058
50 Ga0105249_10140387 3300009553 Bacteria 2316
51 Ga0105239_10007996 3300010375 Bacteria 12073
52 Ga0105246_10013502 3300011119 Bacteria 5121
53 Ga0163162_10012578 3300013306 Bacteria 8266
54 Ga0163162_10256612 3300013306 Bacteria 1880
55 Ga0157372_10016621 3300013307 Bacteria 7895
56 Ga0157375_10020889 3300013308 Bacteria 5993
57 Ga0157375_10279331 3300013308 Bacteria 1833
58 Ga0157375_10494711 3300013308 Bacteria 1387
59 Ga0163163_10097889 3300014325 Bacteria 2955
60 Ga0163163_10165035 3300014325 Bacteria 2261
61 Ga0157380_10344493 3300014326 Bacteria 1392
62 Ga0197907_11501200 3300020069 Bacteria 1026
63 Ga0224712_10033880 3300022467 Bacteria 1873
64 Ga0207642_10237672 3300025899 Bacteria 1027
65 Ga0207705_10087333 3300025909 Bacteria 2280
66 Ga0207660_10149933 3300025917 Bacteria 1791
67 Ga0207657_10046080 3300025919 Bacteria 3820
68 Ga0207652_10058095 3300025921 Bacteria 3333
69 Ga0207652_10553096 3300025921 Bacteria 1034
70 Ga0207687_10287115 3300025927 Bacteria 1321
71 Ga0207690_10163453 3300025932 Bacteria 1662
72 Ga0207706_10155003 3300025933 Bacteria 2015
73 Ga0207709_10283040 3300025935 Bacteria 1225
74 Ga0207704_10072902 3300025938 Bacteria 2185
75 Ga0207689_10115866 3300025942 Bacteria 2203
76 Ga0207661_10082487 3300025944 Bacteria 2658
77 Ga0207661_10105402 3300025944 Bacteria 2375
78 Ga0207667_10121951 3300025949 Bacteria 2686
79 Ga0207712_10141710 3300025961 Bacteria 1846
80 Ga0207658_10031056 3300025986 Bacteria 3790
81 Ga0207639_10051295 3300026041 Bacteria 3137
82 Ga0207702_10238056 3300026078 Bacteria 1704
83 Ga0207702_10601729 3300026078 Bacteria 1079
84 Ga0207641_10205433 3300026088 Bacteria 1819
85 Ga0207674_10002877 3300026116 Bacteria 21385
86 Ga0207674_10260632 3300026116 Bacteria 1681
87 Ga0207698_10055902 3300026142 Bacteria 3045
88 Ga0209813_10010046 3300027866 Bacteria 2437
89 Ga0209813_10019036 3300027866 Bacteria 1904
90 Ga0268266_10001844 3300028379 Bacteria 23906
91 Ga0268266_10101110 3300028379 Bacteria 2541
92 Ga0268266_10299266 3300028379 Bacteria 1500
93 Ga0268264_10000843 3300028381 Bacteria 32793
94 Ga0268264_10071433 3300028381 Bacteria 2941
95 Ga0395898_0056945 3300037466 Bacteria 3809
96 Ga0395901_0029192 3300038443 Bacteria 5676
97 Ga0395901_0371139 3300038443 Bacteria 1474
98 Ga0436365_1297033 3300039437 Bacteria 1839
99 Ga0451837_1168970 3300041494 Bacteria 2620
100 Ga0451853_3514523 3300041512 Bacteria 1681
101 Ga0450907_003360 3300042146 Bacteria 2866
102 Ga0466965_0182359 3300044683 Bacteria 1108
103 Ga0466963_0039532 3300044694 Bacteria 3089
104 Ga0466963_0053127 3300044694 Bacteria 2690
105 Ga0466964_0021731 3300044706 Bacteria 2483
106 Ga0466970_0008529 3300044765 Bacteria 5161
107 Ga0466970_0012606 3300044765 Bacteria 4325
108 Ga0466957_0107151 3300044842 Bacteria 1768
109 Ga0466960_0000473 3300044901 Bacteria 13691
110 Ga0466960_0034377 3300044901 Bacteria 2362
111 Ga0466960_0055453 3300044901 Bacteria 1927
112 Ga0466967_0001211 3300045976 Bacteria 14529
113 Ga0466967_0202876 3300045976 Bacteria 1878
114 Ga0466967_0674331 3300045976 Bacteria 1023
115 Ga0495641_0070975 3300046461 Bacteria 1564
116 Ga0495582_0077926 3300046473 Bacteria 1838
117 Ga0495635_0090064 3300046663 Bacteria 2099
118 Ga0495658_0089865 3300046683 Bacteria 1817
119 Ga0495658_0109067 3300046683 Bacteria 1662
120 Ga0495658_0159393 3300046683 Bacteria 1391
121 Ga0495600_0211577 3300046809 Bacteria 1242
122 Ga0495676_0103404 3300047321 Bacteria 2103
123 Ga0495680_0168041 3300047322 Bacteria 1589
124 Ga0496100_0062321 3300048903 Bacteria 2461
125 Ga0496100_0093401 3300048903 Bacteria 2058
126 Ga0496101_0088952 3300048904 Bacteria 2294
127 Ga0496101_0162023 3300048904 Bacteria 1716
128 Ga0496102_0014126 3300048905 Bacteria 6937
129 Ga0496102_0015450 3300048905 Bacteria 6650
130 Ga0496102_0169448 3300048905 Bacteria 2055
131 Ga0496102_0212488 3300048905 Bacteria 1824
132 Ga0496103_0019081 3300048906 Bacteria 4118
133 Ga0496103_0056627 3300048906 Bacteria 2434
134 Ga0496104_0012619 3300048907 Bacteria 7604
135 Ga0496106_0242730 3300048909 Bacteria 1439
136 Ga0496107_0031367 3300048910 Bacteria 3791
137 Ga0496107_0081881 3300048910 Bacteria 2354
138 Ga0496107_0107422 3300048910 Bacteria 2050
139 Ga0496107_0338481 3300048910 Bacteria 1119
140 Ga0496107_0380166 3300048910 Bacteria 1050
141 Ga0496107_0466935 3300048910 Bacteria 937
142 Ga0496108_0026336 3300048911 Bacteria 4796
143 Ga0496108_0040745 3300048911 Bacteria 3874
144 Ga0496108_0143955 3300048911 Bacteria 2054
145 Ga0496109_0019036 3300048912 Bacteria 6047
146 Ga0496109_0037022 3300048912 Bacteria 4407
147 Ga0496109_0646480 3300048912 Bacteria 994
148 Ga0496110_0014585 3300048913 Bacteria 6529
149 Ga0496111_0021984 3300048914 Bacteria 4460
150 Ga0496111_0059070 3300048914 Bacteria 2778
151 Ga0496112_0460160 3300048915 Bacteria 1210
152 Ga0496113_0056904 3300048916 Bacteria 2937
153 Ga0496113_0323458 3300048916 Bacteria 1236
154 Ga0496114_0010744 3300048917 Bacteria 7286
155 Ga0496114_0076546 3300048917 Bacteria 2819
156 Ga0496114_0199896 3300048917 Bacteria 1750
157 Ga0496115_0001458 3300048918 Bacteria 16992
158 Ga0496115_0022725 3300048918 Bacteria 4862
159 Ga0501031_0003445 3300049568 Bacteria 10151
160 Ga0501034_0004327 3300049571 Bacteria 15834
161 Ga0501034_0126281 3300049571 Bacteria 2543
162 Ga0501036_0092321 3300049572 Bacteria 2557
163 Ga0501037_0101102 3300049573 Bacteria 2081
164 Ga0501041_0016440 3300049577 Bacteria 4398
165 Ga0501042_0152748 3300049578 Bacteria 1665
166 Ga0501047_0118653 3300049581 Bacteria 2527
167 Ga0501048_0018289 3300049582 Bacteria 5155
168 Ga0501067_0006612 3300049583 Bacteria 6430
169 Ga0501067_0021342 3300049583 Bacteria 3583
170 Ga0501068_0033684 3300049584 Bacteria 3051
171 Ga0501069_0021753 3300049585 Bacteria 3484
172 Ga0501069_0041490 3300049585 Bacteria 2544
173 Ga0501070_0001225 3300049586 Bacteria 22969
174 Ga0501070_0006526 3300049586 Bacteria 9924
175 Ga0501070_0022169 3300049586 Bacteria 5319
176 Ga0501070_0085493 3300049586 Bacteria 2611
177 Ga0501070_0125351 3300049586 Bacteria 2122
178 Ga0501070_0369193 3300049586 Bacteria 1163
179 Ga0501071_0012803 3300049587 Bacteria 5704
180 Ga0501071_0171452 3300049587 Bacteria 1624
181 Ga0501072_0012484 3300049588 Bacteria 6493
182 Ga0501072_0034847 3300049588 Bacteria 3944
183 Ga0501072_0043152 3300049588 Bacteria 3544
184 Ga0501072_0053201 3300049588 Bacteria 3188
185 Ga0501073_0010652 3300049589 Bacteria 6730
186 Ga0501073_0016417 3300049589 Bacteria 5366
187 Ga0501074_0001641 3300049590 Bacteria 15162
188 Ga0501074_0013373 3300049590 Bacteria 5967
189 Ga0501075_0035367 3300049591 Bacteria 3725
190 Ga0501075_0212079 3300049591 Bacteria 1477
191 Ga0501075_0315283 3300049591 Bacteria 1192
192 Ga0501076_0018420 3300049592 Bacteria 5323
193 Ga0501076_0198065 3300049592 Bacteria 1640
194 Ga0501077_0035187 3300049593 Bacteria 3188
195 Ga0501077_0049075 3300049593 Bacteria 2682
196 Ga0501077_0113607 3300049593 Bacteria 1717
197 Ga0501079_0195618 3300049741 Bacteria 1578
198 Ga0501079_0503787 3300049741 Bacteria 952
199 Ga0501080_0003825 3300049742 Bacteria 13305
200 Ga0501080_0010078 3300049742 Bacteria 8639
201 Ga0501080_0028249 3300049742 Bacteria 5217
202 Ga0501080_0039892 3300049742 Bacteria 4382
203 Ga0501080_0076364 3300049742 Bacteria 3116
204 Ga0501081_0029876 3300049743 Bacteria 3685
205 Ga0501083_0015097 3300049744 Bacteria 5407
206 Ga0501035_0156623 3300049822 Bacteria 1974
207 nmdc:mga03n38_13944_c1 3300050490 Bacteria 3068
208 nmdc:mga03n38_37426_c1 3300050490 Bacteria 2093
209 nmdc:mga00v17_12440_c1 3300050491 Bacteria 4697
210 nmdc:mga00v17_16494_c1 3300050491 Bacteria 4162
211 nmdc:mga00v17_45783_c1 3300050491 Bacteria 2645
212 nmdc:mga00v17_66374_c1 3300050491 Bacteria 2228
213 nmdc:mga0yw44_114550_c1 3300050492 Bacteria 1731
214 nmdc:mga0yw44_134017_c1 3300050492 Bacteria 1606
215 nmdc:mga0yw44_190018_c1 3300050492 Bacteria 1354
216 nmdc:mga0yw44_21279_c1 3300050492 Bacteria 3615
217 nmdc:mga0yw44_261791_c1 3300050492 Bacteria 1153
218 nmdc:mga0yw44_29894_c1 3300050492 Bacteria 3151
219 nmdc:mga0yw44_32607_c1 3300050492 Bacteria 3037
220 nmdc:mga0yw44_36610_c1 3300050492 Bacteria 2893
221 nmdc:mga0yw44_37659_c1 3300050492 Bacteria 2857
222 nmdc:mga0yw44_44412_c1 3300050492 Bacteria 2658
223 nmdc:mga0yw44_53118_c1 3300050492 Bacteria 2459
224 nmdc:mga0yw44_7329_c1 3300050492 Bacteria 5417
225 nmdc:mga0yw44_82695_c1 3300050492 Bacteria 2015
226 nmdc:mga06z11_143878_c1 3300050494 Bacteria 1350
227 nmdc:mga06z11_51349_c1 3300050494 Bacteria 2111
228 nmdc:mga04h51_10579_c1 3300050495 Bacteria 2538
229 nmdc:mga04h51_878_c1 3300050495 Bacteria 6917
230 nmdc:mga07m45_11428_c1 3300050496 Bacteria 4664
231 nmdc:mga07m45_14440_c1 3300050496 Bacteria 4206
232 nmdc:mga07m45_171174_c1 3300050496 Bacteria 1262
233 nmdc:mga07m45_48710_c1 3300050496 Bacteria 2384
234 Ga0495655_0041797 3300053083 Bacteria 1174
235 Ga0495595_0071609 3300053084 Bacteria 1639
236 Ga0495619_0015277 3300053085 Bacteria 4855
237 Ga0500644_0010652 3300053088 Bacteria 2493
238 Ga0500554_008754 3300053102 Bacteria 2392
239 Ga0501084_0025330 3300054114 Bacteria 4948
240 Ga0501084_0072955 3300054114 Bacteria 2875
241 Ga0587083_0015660 3300059505 Bacteria 1327
242 Ga0501082_0028879 3300060353 Bacteria 4778
243 Ga0501082_0242515 3300060353 Bacteria 1568
244 Ga0466962_0027292 3300061719 Bacteria 2741
245 Ga0466962_0041006 3300061719 Bacteria 2215
246 2643889060 2643221576 Bacteria 5214352
247 2643958115 2643221590 Bacteria 5214697
248 2644228995 2643221641 Bacteria 4490190
249 2857483073 2857481737 Bacteria 4761446
250 Ga0070683_100054780
251 JGI24737J22298_10008014
252 Ga0070683_100020975
253 Ga0068869_100123334
254 Ga0070682_100047033
255 Ga0070682_100424211
256 Ga0068868_100172911
257 Ga0070660_100038081
258 Ga0070659_100012753
259 Ga0070667_100020155
260 Ga0070667_100392427
261 Ga0070662_100251076
262 Ga0070679_100034357
263 Ga0070684_100000520
264 Ga0070684_100217709
265 Ga0070684_100295490
266 Ga0070665_100001493
267 Ga0070665_100114690
268 Ga0070665_100251536
269 Ga0068855_100169557
270 Ga0068857_100017453
271 Ga0068856_100121695
272 Ga0070702_100140834
273 Ga0068864_100047210
274 Ga0068863_100112979
275 Ga0068860_100129387
276 Ga0068862_100221242
277 Ga0081539_10102345
278 Ga0075365_10096027
279 Ga0075365_10129427
280 Ga0075365_10134892
281 Ga0075365_10146824
282 Ga0075365_10250875
283 Ga0075368_10000515
284 Ga0075363_100019875
285 Ga0075364_10070748
286 Ga0075364_10212553
287 Ga0075362_10082840
288 Ga0075367_10007493
289 Ga0075367_10021638
290 Ga0075367_10033437
291 Ga0075367_10189772
292 Ga0075370_10002627
293 Ga0075370_10058624
294 Ga0068865_100059033
295 Ga0068865_100266405
296 Ga0105245_10023011
297 Ga0105243_10325919
298 Ga0105249_10028313
299 Ga0105249_10140387
300 Ga0105239_10007996
301 Ga0105246_10013502
302 Ga0163162_10012578
303 Ga0163162_10256612
304 Ga0157372_10016621
305 Ga0157375_10020889
306 Ga0157375_10279331
307 Ga0157375_10494711
308 Ga0163163_10097889
309 Ga0163163_10165035
310 Ga0157380_10344493
311 Ga0197907_11501200
312 Ga0224712_10033880
313 Ga0207642_10237672
314 Ga0207705_10087333
315 Ga0207660_10149933
316 Ga0207657_10046080
317 Ga0207652_10058095
318 Ga0207652_10553096
319 Ga0207687_10287115
320 Ga0207690_10163453
321 Ga0207706_10155003
322 Ga0207709_10283040
323 Ga0207704_10072902
324 Ga0207689_10115866
325 Ga0207661_10082487
326 Ga0207661_10105402
327 Ga0207667_10121951
328 Ga0207712_10141710
329 Ga0207658_10031056
330 Ga0207639_10051295
331 Ga0207702_10238056
332 Ga0207702_10601729
333 Ga0207641_10205433
334 Ga0207674_10002877
335 Ga0207674_10260632
336 Ga0207698_10055902
337 Ga0209813_10010046
338 Ga0209813_10019036
339 Ga0268266_10001844
340 Ga0268266_10101110
341 Ga0268266_10299266
342 Ga0268264_10000843
343 Ga0268264_10071433
344 Ga0395898_0056945
345 Ga0395901_0029192
346 Ga0395901_0371139
347 Ga0436365_1297033
348 Ga0451837_1168970
349 Ga0451853_3514523
350 Ga0450907_003360
351 Ga0466965_0182359
352 Ga0466963_0039532
353 Ga0466963_0053127
354 Ga0466964_0021731
355 Ga0466970_0008529
356 Ga0466970_0012606
357 Ga0466957_0107151
358 Ga0466960_0000473
359 Ga0466960_0034377
360 Ga0466960_0055453
361 Ga0466967_0001211
362 Ga0466967_0202876
363 Ga0466967_0674331
364 Ga0495641_0070975
365 Ga0495582_0077926
366 Ga0495635_0090064
367 Ga0495658_0089865
368 Ga0495658_0109067
369 Ga0495658_0159393
370 Ga0495600_0211577
371 Ga0495676_0103404
372 Ga0495680_0168041
373 Ga0496100_0062321
374 Ga0496100_0093401
375 Ga0496101_0088952
376 Ga0496101_0162023
377 Ga0496102_0014126
378 Ga0496102_0015450
379 Ga0496102_0169448
380 Ga0496102_0212488
381 Ga0496103_0019081
382 Ga0496103_0056627
383 Ga0496104_0012619
384 Ga0496106_0242730
385 Ga0496107_0031367
386 Ga0496107_0081881
387 Ga0496107_0107422
388 Ga0496107_0338481
389 Ga0496107_0380166
390 Ga0496107_0466935
391 Ga0496108_0026336
392 Ga0496108_0040745
393 Ga0496108_0143955
394 Ga0496109_0019036
395 Ga0496109_0037022
396 Ga0496109_0646480
397 Ga0496110_0014585
398 Ga0496111_0021984
399 Ga0496111_0059070
400 Ga0496112_0460160
401 Ga0496113_0056904
402 Ga0496113_0323458
403 Ga0496114_0010744
404 Ga0496114_0076546
405 Ga0496114_0199896
406 Ga0496115_0001458
407 Ga0496115_0022725
408 Ga0501031_0003445
409 Ga0501034_0004327
410 Ga0501034_0126281
411 Ga0501036_0092321
412 Ga0501037_0101102
413 Ga0501041_0016440
414 Ga0501042_0152748
415 Ga0501047_0118653
416 Ga0501048_0018289
417 Ga0501067_0006612
418 Ga0501067_0021342
419 Ga0501068_0033684
420 Ga0501069_0021753
421 Ga0501069_0041490
422 Ga0501070_0001225
423 Ga0501070_0006526
424 Ga0501070_0022169
425 Ga0501070_0085493
426 Ga0501070_0125351
427 Ga0501070_0369193
428 Ga0501071_0012803
429 Ga0501071_0171452
430 Ga0501072_0012484
431 Ga0501072_0034847
432 Ga0501072_0043152
433 Ga0501072_0053201
434 Ga0501073_0010652
435 Ga0501073_0016417
436 Ga0501074_0001641
437 Ga0501074_0013373
438 Ga0501075_0035367
439 Ga0501075_0212079
440 Ga0501075_0315283
441 Ga0501076_0018420
442 Ga0501076_0198065
443 Ga0501077_0035187
444 Ga0501077_0049075
445 Ga0501077_0113607
446 Ga0501079_0195618
447 Ga0501079_0503787
448 Ga0501080_0003825
449 Ga0501080_0010078
450 Ga0501080_0028249
451 Ga0501080_0039892
452 Ga0501080_0076364
453 Ga0501081_0029876
454 Ga0501083_0015097
455 Ga0501035_0156623
456 nmdc:mga03n38_13944_c1
457 nmdc:mga03n38_37426_c1
458 nmdc:mga00v17_12440_c1
459 nmdc:mga00v17_16494_c1
460 nmdc:mga00v17_45783_c1
461 nmdc:mga00v17_66374_c1
462 nmdc:mga0yw44_114550_c1
463 nmdc:mga0yw44_134017_c1
464 nmdc:mga0yw44_190018_c1
465 nmdc:mga0yw44_21279_c1
466 nmdc:mga0yw44_261791_c1
467 nmdc:mga0yw44_29894_c1
468 nmdc:mga0yw44_32607_c1
469 nmdc:mga0yw44_36610_c1
470 nmdc:mga0yw44_37659_c1
471 nmdc:mga0yw44_44412_c1
472 nmdc:mga0yw44_53118_c1
473 nmdc:mga0yw44_7329_c1
474 nmdc:mga0yw44_82695_c1
475 nmdc:mga06z11_143878_c1
476 nmdc:mga06z11_51349_c1
477 nmdc:mga04h51_10579_c1
478 nmdc:mga04h51_878_c1
479 nmdc:mga07m45_11428_c1
480 nmdc:mga07m45_14440_c1
481 nmdc:mga07m45_171174_c1
482 nmdc:mga07m45_48710_c1
483 Ga0495655_0041797
484 Ga0495595_0071609
485 Ga0495619_0015277
486 Ga0500644_0010652
487 Ga0500554_008754
488 Ga0501084_0025330
489 Ga0501084_0072955
490 Ga0587083_0015660
491 Ga0501082_0028879
492 Ga0501082_0242515
493 Ga0466962_0027292
494 Ga0466962_0041006
495 2643889060
496 2643958115
497 2644228995
498 2857483073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

152

226

0.84

PF00034

Cytochrom_C

Cytochrome c

53

136

0.8

PF00034

Cytochrom_C

Cytochrome c

154

230

0.68

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

51

132

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hcr-assembly1.cif.gz_O cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.7337 52 274
7e1x-assembly1.cif.gz_O cryo-em structure of hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv in presence of tb47 0.7208 53 274
6adq-assembly1.cif.gz_C respiratory complex ciii2civ2sod2 from mycobacterium smegmatis 0.716 50 274
8hcr-assembly1.cif.gz_O cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.7149 52 274
7qhm-assembly1.cif.gz_C cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.7127 49 274
ID Description Score Start End Superfamily
af_P9WP35_148_241_1.10.760.10 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7214 150 238 1.10.760.10
af_P9WP35_148_241_1.10.760.10 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6788 150 238 1.10.760.10
6cunA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.625 148 239 1.10.760.10
1ls9A00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6197 50 136 1.10.760.10
1h1oB02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6192 54 135 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2D6I075-F1-model_v4 Cystathionine beta-lyase 0.8474 51 226 GO:0009055
GO:0016829
GO:0020037
GO:0046872
AF-A0A3D3BQT2-F1-model_v4 Cystathionine beta-lyase 0.8375 51 183 GO:0009055
GO:0016829
GO:0020037
GO:0046872
AF-A0A2D6I075-F1-model_v4 Cystathionine beta-lyase 0.8191 51 226 GO:0009055
GO:0016829
GO:0020037
GO:0046872
AF-A0A538B2Y7-F1-model_v4 Cytochrome c 0.8113 55 172 GO:0009055
GO:0020037
GO:0046872
AF-A0A3D3BQT2-F1-model_v4 Cystathionine beta-lyase 0.8062 51 183 GO:0009055
GO:0016829
GO:0020037
GO:0046872

Map