F360238

General Info

Members Datasets Scaffolds Average Seq Length
248 144 496 294

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0080140|Ga0501033_0080140_1243_2160
Length 305
Sequence LVAEPDQPTAATGSDLVQQRRLGRIDHASSVLIYGAAALAQVDQDLADRSIQLALDAGINHFDVAASYGDAELRLGPWIPRIRERVFLATKTGERSADDAWAQINRSLERLQTDHLDLIQLHAVGDLDELDRVTGAGGALQAAVRARDEGLARFIGITGHGHQAPATHRQALRRFPFDTVLCPLNYALSLDPVYLGDYEELAAEVRAADAGLMIIKAVSRRNWPDGSRPYTTWYEPFDDQERITAATVWALSHPEVTGIATPGDVRLLPLLIEAAKQVGTMPPADAEEVLAAAADYSSPFINIPF

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
71 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
80 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
87 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
88 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
89 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
90 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
99 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
103 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
140 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
141 2643221679 Angustibacter sp. Root456 Isolate Unclassified
142 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
143 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
144 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.42
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 3.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0080140 3300049570 Bacteria 2396
2 JGI24737J22298_10006074 3300001990 Bacteria 4140
3 JGI24033J26618_1001671 3300002155 Bacteria 2206
4 JGI24751J29686_10000305 3300002459 Bacteria 18483
5 JGI25407J50210_10000829 3300003373 Bacteria 6627
6 JGI25407J50210_10013414 3300003373 Bacteria 2106
7 Ga0070670_100013806 3300005331 Bacteria 6923
8 Ga0070670_100159196 3300005331 Bacteria 1956
9 Ga0070682_100012606 3300005337 Bacteria 4849
10 Ga0070661_100011668 3300005344 Bacteria 6125
11 Ga0070675_100201706 3300005354 Bacteria 1727
12 Ga0070667_100519304 3300005367 Bacteria 1093
13 Ga0070700_100013958 3300005441 Bacteria 4526
14 Ga0070708_100267625 3300005445 Bacteria 1607
15 Ga0070698_100001328 3300005471 Bacteria 27563
16 Ga0070698_100257662 3300005471 Bacteria 1677
17 Ga0070699_100024181 3300005518 Bacteria 5235
18 Ga0070684_100274290 3300005535 Bacteria 1544
19 Ga0070665_100278806 3300005548 Bacteria 1673
20 Ga0070704_100016584 3300005549 Bacteria 4658
21 Ga0070664_100001264 3300005564 Bacteria 20252
22 Ga0068857_100295529 3300005577 Bacteria 1492
23 Ga0068854_100455940 3300005578 Bacteria 1069
24 Ga0068864_100006514 3300005618 Bacteria 9570
25 Ga0068870_10015472 3300005840 Bacteria 3620
26 Ga0068870_10239707 3300005840 Bacteria 1119
27 Ga0068863_100109185 3300005841 Bacteria 2633
28 Ga0068858_100432534 3300005842 Bacteria 1266
29 Ga0068862_100028494 3300005844 Bacteria 4704
30 Ga0081455_10002870 3300005937 Bacteria 20291
31 Ga0081455_10005448 3300005937 Bacteria 13951
32 Ga0081455_10021631 3300005937 Bacteria 6027
33 Ga0081455_10035002 3300005937 Bacteria 4494
34 Ga0081455_10050664 3300005937 Bacteria 3568
35 Ga0081455_10147844 3300005937 Bacteria 1815
36 Ga0081538_10000305 3300005981 Bacteria 56642
37 Ga0081538_10000342 3300005981 Bacteria 53103
38 Ga0081538_10000726 3300005981 Bacteria 35921
39 Ga0081538_10001824 3300005981 Bacteria 21449
40 Ga0081538_10002193 3300005981 Bacteria 19357
41 Ga0081538_10007692 3300005981 Bacteria 9287
42 Ga0081538_10008949 3300005981 Bacteria 8414
43 Ga0081538_10010148 3300005981 Bacteria 7745
44 Ga0081538_10011435 3300005981 Bacteria 7188
45 Ga0081538_10020912 3300005981 Bacteria 4800
46 Ga0081538_10049905 3300005981 Bacteria 2533
47 Ga0081538_10081354 3300005981 Bacteria 1723
48 Ga0081538_10089893 3300005981 Bacteria 1592
49 Ga0081540_1020933 3300005983 Bacteria 3915
50 Ga0081539_10000187 3300005985 Bacteria 145407
51 Ga0081539_10050913 3300005985 Bacteria 2339
52 Ga0081539_10054425 3300005985 Bacteria 2234
53 Ga0081539_10069368 3300005985 Bacteria 1898
54 Ga0081539_10137069 3300005985 Bacteria 1194
55 Ga0075432_10003042 3300006058 Bacteria 5654
56 Ga0075432_10027088 3300006058 Bacteria 1971
57 Ga0075427_10010735 3300006194 Bacteria 1374
58 Ga0075428_100002554 3300006844 Bacteria 19788
59 Ga0075428_100016416 3300006844 Bacteria 8183
60 Ga0075430_100000448 3300006846 Bacteria 30765
61 Ga0075430_100001423 3300006846 Bacteria 19457
62 Ga0075430_100087963 3300006846 Bacteria 2600
63 Ga0075430_100174311 3300006846 Bacteria 1789
64 Ga0075431_100000688 3300006847 Bacteria 29046
65 Ga0075431_100002201 3300006847 Bacteria 18658
66 Ga0075431_100004736 3300006847 Bacteria 13374
67 Ga0075433_10026240 3300006852 Bacteria 4930
68 Ga0075434_100003111 3300006871 Bacteria 14784
69 Ga0075434_100038639 3300006871 Bacteria 4728
70 Ga0075434_100134342 3300006871 Bacteria 2494
71 Ga0075429_100001358 3300006880 Bacteria 20005
72 Ga0075429_100013769 3300006880 Bacteria 7013
73 Ga0105245_10611303 3300009098 Bacteria 1117
74 Ga0114129_10003492 3300009147 Bacteria 22098
75 Ga0114129_10038137 3300009147 Bacteria 6781
76 Ga0114129_10089429 3300009147 Bacteria 4268
77 Ga0114129_10108550 3300009147 Bacteria 3831
78 Ga0114129_10123722 3300009147 Bacteria 3557
79 Ga0114129_10166338 3300009147 Bacteria 3009
80 Ga0114129_10382429 3300009147 Bacteria 1859
81 Ga0105243_10175277 3300009148 Bacteria 1861
82 Ga0105249_10081987 3300009553 Bacteria 3000
83 Ga0105249_10088067 3300009553 Bacteria 2899
84 Ga0105239_10138065 3300010375 Bacteria 2714
85 Ga0105239_10250545 3300010375 Bacteria 1989
86 Ga0105246_10003614 3300011119 Bacteria 9356
87 Ga0157369_10513133 3300013105 Bacteria 1240
88 Ga0157372_10459973 3300013307 Bacteria 1483
89 Ga0163163_10002852 3300014325 Bacteria 14604
90 Ga0157377_10087774 3300014745 Bacteria 1831
91 Ga0157377_10159937 3300014745 Unclassified 1400
92 Ga0163161_10023234 3300017792 Bacteria 4372
93 Ga0207647_10005673 3300025904 Bacteria 9116
94 Ga0207643_10002743 3300025908 Bacteria 9535
95 Ga0207649_10046618 3300025920 Bacteria 2664
96 Ga0207650_10003993 3300025925 Bacteria 10099
97 Ga0207650_10106304 3300025925 Bacteria 2167
98 Ga0207659_10107268 3300025926 Bacteria 2116
99 Ga0207659_10163152 3300025926 Bacteria 1751
100 Ga0207706_10025767 3300025933 Bacteria 5268
101 Ga0207689_10359567 3300025942 Bacteria 1210
102 Ga0207679_10015862 3300025945 Bacteria 4992
103 Ga0207712_10201567 3300025961 Bacteria 1578
104 Ga0207668_10231565 3300025972 Bacteria 1490
105 Ga0207658_10846086 3300025986 Bacteria 832
106 Ga0207639_10126444 3300026041 Bacteria 2109
107 Ga0207678_10013581 3300026067 Bacteria 7151
108 Ga0207678_10350865 3300026067 Bacteria 1272
109 Ga0207708_10067206 3300026075 Bacteria 2742
110 Ga0207676_10001435 3300026095 Bacteria 17717
111 Ga0207674_10013509 3300026116 Bacteria 9054
112 Ga0207674_10039551 3300026116 Bacteria 4888
113 Ga0207675_100016995 3300026118 Bacteria 6797
114 Ga0207428_10002652 3300027907 Bacteria 17814
115 Ga0207428_10006109 3300027907 Bacteria 11136
116 Ga0268264_10254927 3300028381 Unclassified 1632
117 Ga0307512_10120026 3300030522 Bacteria 1694
118 Ga0307408_100397733 3300031548 Bacteria 1182
119 Ga0316578_10042801 3300031728 Bacteria 2628
120 Ga0316577_10011830 3300031733 Bacteria 4738
121 Ga0307413_10041424 3300031824 Bacteria 2696
122 Ga0307410_10231372 3300031852 Bacteria 1427
123 Ga0307407_10003304 3300031903 Bacteria 6585
124 Ga0307409_100023471 3300031995 Bacteria 4275
125 Ga0307409_100111278 3300031995 Bacteria 2297
126 Ga0307409_100133028 3300031995 Bacteria 2129
127 Ga0307409_100189969 3300031995 Bacteria 1827
128 Ga0307409_100428726 3300031995 Bacteria 1270
129 Ga0307416_100013631 3300032002 Bacteria 5534
130 Ga0307416_100048779 3300032002 Bacteria 3362
131 Ga0307416_100142513 3300032002 Bacteria 2181
132 Ga0307411_10081444 3300032005 Bacteria 2229
133 Ga0307411_10146261 3300032005 Bacteria 1750
134 Ga0307411_10365194 3300032005 Bacteria 1182
135 Ga0307415_100000689 3300032126 Bacteria 15005
136 Ga0307415_100001596 3300032126 Bacteria 10951
137 Ga0307415_100007736 3300032126 Bacteria 5902
138 Ga0307415_100015262 3300032126 Bacteria 4542
139 Ga0307415_100191074 3300032126 Bacteria 1616
140 Ga0307415_100196532 3300032126 Unclassified 1596
141 Ga0373961_0087755 3300035241 Unclassified 989
142 Ga0316584_0037719 3300036712 Bacteria 3592
143 Ga0395899_0053461 3300037312 Bacteria 2990
144 Ga0395900_0049050 3300037418 Bacteria 4349
145 Ga0395900_0216959 3300037418 Bacteria 1930
146 Ga0395900_0272041 3300037418 Bacteria 1688
147 Ga0395898_0059266 3300037466 Bacteria 3725
148 Ga0395898_0215503 3300037466 Bacteria 1831
149 Ga0395898_0257611 3300037466 Bacteria 1664
150 Ga0395898_0376970 3300037466 Bacteria 1353
151 Ga0395905_0156653 3300037471 Bacteria 2142
152 Ga0395905_0191662 3300037471 Bacteria 1917
153 Ga0395901_0012363 3300038443 Bacteria 8659
154 Ga0395901_0074766 3300038443 Bacteria 3534
155 Ga0395901_0199668 3300038443 Bacteria 2096
156 Ga0395901_0694995 3300038443 Bacteria 1015
157 Ga0439448_0021981 3300042005 Bacteria 1979
158 Ga0439455_0005085 3300042012 Bacteria 2653
159 Ga0439463_019898 3300042016 Bacteria 1673
160 Ga0439460_0005242 3300042461 Bacteria 3176
161 Ga0439460_0010951 3300042461 Unclassified 2332
162 Ga0439440_0002004 3300042993 Bacteria 3793
163 Ga0466957_0107765 3300044842 Bacteria 1764
164 Ga0466960_0078303 3300044901 Bacteria 1659
165 Ga0466967_0277312 3300045976 Bacteria 1608
166 Ga0495629_0312482 3300046459 Bacteria 1075
167 Ga0495584_0056790 3300046491 Unclassified 1970
168 Ga0495585_0084575 3300046492 Bacteria 1716
169 Ga0495596_0060171 3300046500 Unclassified 1480
170 Ga0495607_0142326 3300046501 Unclassified 1236
171 Ga0495611_0100199 3300046648 Bacteria 1345
172 Ga0495625_0052918 3300046660 Bacteria 2906
173 Ga0495588_0010112 3300046674 Bacteria 4377
174 Ga0495670_0038983 3300046691 Bacteria 2370
175 Ga0495670_0150121 3300046691 Bacteria 1222
176 Ga0495670_0184177 3300046691 Unclassified 1103
177 Ga0495636_0091224 3300047318 Bacteria 1323
178 Ga0496104_0156474 3300048907 Bacteria 2187
179 Ga0496104_0261265 3300048907 Bacteria 1644
180 Ga0496108_0213540 3300048911 Bacteria 1675
181 Ga0496109_0093207 3300048912 Bacteria 2787
182 Ga0496110_0338057 3300048913 Bacteria 1372
183 Ga0496114_0146367 3300048917 Bacteria 2048
184 Ga0501036_0024835 3300049572 Bacteria 5053
185 Ga0501038_0017571 3300049574 Bacteria 6466
186 Ga0501040_0021472 3300049576 Bacteria 4312
187 Ga0501040_0229203 3300049576 Bacteria 1322
188 Ga0501042_0091900 3300049578 Bacteria 2178
189 Ga0501042_0356028 3300049578 Bacteria 1059
190 Ga0501046_0118599 3300049580 Bacteria 2015
191 Ga0501048_0211951 3300049582 Bacteria 1374
192 Ga0501067_0003730 3300049583 Bacteria 8392
193 Ga0501068_0051656 3300049584 Bacteria 2487
194 Ga0501068_0069595 3300049584 Bacteria 2146
195 Ga0501068_0314698 3300049584 Bacteria 1003
196 Ga0501069_0029597 3300049585 Bacteria 3005
197 Ga0501071_0098190 3300049587 Bacteria 2157
198 Ga0501072_0029274 3300049588 Bacteria 4301
199 Ga0501072_0038342 3300049588 Bacteria 3760
200 Ga0501072_0067952 3300049588 Bacteria 2813
201 Ga0501072_0179905 3300049588 Bacteria 1687
202 Ga0501074_0003125 3300049590 Bacteria 11678
203 Ga0501074_0110145 3300049590 Bacteria 1970
204 Ga0501075_0033388 3300049591 Bacteria 3828
205 Ga0501076_0137852 3300049592 Bacteria 1981
206 Ga0501076_0159380 3300049592 Bacteria 1838
207 Ga0501077_0002880 3300049593 Bacteria 10316
208 Ga0501079_0009048 3300049741 Bacteria 7544
209 Ga0501081_0006356 3300049743 Bacteria 7663
210 Ga0501044_0083344 3300049823 Bacteria 3234
211 Ga0501045_0056839 3300049824 Bacteria 2862
212 Ga0501045_0070035 3300049824 Bacteria 2579
213 nmdc:mga05p37_232810_c1 3300050507 Bacteria 2219
214 nmdc:mga05p37_25715_c1 3300050507 Bacteria 7159
215 nmdc:mga05p37_2846_c1 3300050507 Bacteria 20103
216 nmdc:mga05p37_297321_c1 3300050507 Bacteria 1920
217 nmdc:mga05p37_35077_c1 3300050507 Bacteria 6150
218 nmdc:mga05p37_36884_c1 3300050507 Bacteria 5996
219 nmdc:mga05p37_789343_c1 3300050507 Bacteria 1041
220 nmdc:mga05p37_80718_c1 3300050507 Bacteria 4006
221 nmdc:mga09592_166945_c1 3300050508 Bacteria 1903
222 nmdc:mga09592_93817_c1 3300050508 Bacteria 2567
223 nmdc:mga0qj67_27053_c1 3300050509 Bacteria 4442
224 nmdc:mga0qj67_5006_c1 3300050509 Bacteria 9628
225 nmdc:mga06r32_17978_c1 3300050510 Bacteria 6463
226 nmdc:mga06r32_19105_c1 3300050510 Bacteria 6286
227 nmdc:mga06r32_1967_c1 3300050510 Bacteria 18350
228 nmdc:mga06r32_23625_c1 3300050510 Bacteria 5691
229 nmdc:mga06r32_90593_c1 3300050510 Bacteria 2988
230 nmdc:mga08y16_105177_c1 3300050511 Bacteria 2939
231 nmdc:mga08y16_113877_c1 3300050511 Bacteria 2816
232 nmdc:mga0n895_10803_c1 3300050512 Bacteria 8102
233 nmdc:mga0n895_6767_c1 3300050512 Bacteria 9778
234 nmdc:mga0a205_231736_c1 3300050515 Bacteria 1730
235 nmdc:mga0a205_60657_c1 3300050515 Bacteria 3653
236 nmdc:mga0a205_87785_c1 3300050515 Bacteria 3005
237 Ga0495655_0012943 3300053083 Bacteria 1712
238 Ga0501084_0010689 3300054114 Bacteria 7597
239 Ga0501084_0127206 3300054114 Bacteria 2144
240 Ga0590075_009228 3300059424 Bacteria 2361
241 Ga0501082_0011249 3300060353 Bacteria 7691
242 Ga0501082_0021558 3300060353 Bacteria 5557
243 Ga0530510_0056846 3300061734 Bacteria 2827
244 2515855995 2515154155 Bacteria 7985436
245 2644447177 2643221679 Bacteria 3839507
246 2676478911 2675903058 Bacteria 6822861
247 2816424834 2816332119 Bacteria 8120218
248 2827633850 2827628540 Bacteria 6858585
249 Ga0501033_0080140
250 JGI24737J22298_10006074
251 JGI24033J26618_1001671
252 JGI24751J29686_10000305
253 JGI25407J50210_10000829
254 JGI25407J50210_10013414
255 Ga0070670_100013806
256 Ga0070670_100159196
257 Ga0070682_100012606
258 Ga0070661_100011668
259 Ga0070675_100201706
260 Ga0070667_100519304
261 Ga0070700_100013958
262 Ga0070708_100267625
263 Ga0070698_100001328
264 Ga0070698_100257662
265 Ga0070699_100024181
266 Ga0070684_100274290
267 Ga0070665_100278806
268 Ga0070704_100016584
269 Ga0070664_100001264
270 Ga0068857_100295529
271 Ga0068854_100455940
272 Ga0068864_100006514
273 Ga0068870_10015472
274 Ga0068870_10239707
275 Ga0068863_100109185
276 Ga0068858_100432534
277 Ga0068862_100028494
278 Ga0081455_10002870
279 Ga0081455_10005448
280 Ga0081455_10021631
281 Ga0081455_10035002
282 Ga0081455_10050664
283 Ga0081455_10147844
284 Ga0081538_10000305
285 Ga0081538_10000342
286 Ga0081538_10000726
287 Ga0081538_10001824
288 Ga0081538_10002193
289 Ga0081538_10007692
290 Ga0081538_10008949
291 Ga0081538_10010148
292 Ga0081538_10011435
293 Ga0081538_10020912
294 Ga0081538_10049905
295 Ga0081538_10081354
296 Ga0081538_10089893
297 Ga0081540_1020933
298 Ga0081539_10000187
299 Ga0081539_10050913
300 Ga0081539_10054425
301 Ga0081539_10069368
302 Ga0081539_10137069
303 Ga0075432_10003042
304 Ga0075432_10027088
305 Ga0075427_10010735
306 Ga0075428_100002554
307 Ga0075428_100016416
308 Ga0075430_100000448
309 Ga0075430_100001423
310 Ga0075430_100087963
311 Ga0075430_100174311
312 Ga0075431_100000688
313 Ga0075431_100002201
314 Ga0075431_100004736
315 Ga0075433_10026240
316 Ga0075434_100003111
317 Ga0075434_100038639
318 Ga0075434_100134342
319 Ga0075429_100001358
320 Ga0075429_100013769
321 Ga0105245_10611303
322 Ga0114129_10003492
323 Ga0114129_10038137
324 Ga0114129_10089429
325 Ga0114129_10108550
326 Ga0114129_10123722
327 Ga0114129_10166338
328 Ga0114129_10382429
329 Ga0105243_10175277
330 Ga0105249_10081987
331 Ga0105249_10088067
332 Ga0105239_10138065
333 Ga0105239_10250545
334 Ga0105246_10003614
335 Ga0157369_10513133
336 Ga0157372_10459973
337 Ga0163163_10002852
338 Ga0157377_10087774
339 Ga0157377_10159937
340 Ga0163161_10023234
341 Ga0207647_10005673
342 Ga0207643_10002743
343 Ga0207649_10046618
344 Ga0207650_10003993
345 Ga0207650_10106304
346 Ga0207659_10107268
347 Ga0207659_10163152
348 Ga0207706_10025767
349 Ga0207689_10359567
350 Ga0207679_10015862
351 Ga0207712_10201567
352 Ga0207668_10231565
353 Ga0207658_10846086
354 Ga0207639_10126444
355 Ga0207678_10013581
356 Ga0207678_10350865
357 Ga0207708_10067206
358 Ga0207676_10001435
359 Ga0207674_10013509
360 Ga0207674_10039551
361 Ga0207675_100016995
362 Ga0207428_10002652
363 Ga0207428_10006109
364 Ga0268264_10254927
365 Ga0307512_10120026
366 Ga0307408_100397733
367 Ga0316578_10042801
368 Ga0316577_10011830
369 Ga0307413_10041424
370 Ga0307410_10231372
371 Ga0307407_10003304
372 Ga0307409_100023471
373 Ga0307409_100111278
374 Ga0307409_100133028
375 Ga0307409_100189969
376 Ga0307409_100428726
377 Ga0307416_100013631
378 Ga0307416_100048779
379 Ga0307416_100142513
380 Ga0307411_10081444
381 Ga0307411_10146261
382 Ga0307411_10365194
383 Ga0307415_100000689
384 Ga0307415_100001596
385 Ga0307415_100007736
386 Ga0307415_100015262
387 Ga0307415_100191074
388 Ga0307415_100196532
389 Ga0373961_0087755
390 Ga0316584_0037719
391 Ga0395899_0053461
392 Ga0395900_0049050
393 Ga0395900_0216959
394 Ga0395900_0272041
395 Ga0395898_0059266
396 Ga0395898_0215503
397 Ga0395898_0257611
398 Ga0395898_0376970
399 Ga0395905_0156653
400 Ga0395905_0191662
401 Ga0395901_0012363
402 Ga0395901_0074766
403 Ga0395901_0199668
404 Ga0395901_0694995
405 Ga0439448_0021981
406 Ga0439455_0005085
407 Ga0439463_019898
408 Ga0439460_0005242
409 Ga0439460_0010951
410 Ga0439440_0002004
411 Ga0466957_0107765
412 Ga0466960_0078303
413 Ga0466967_0277312
414 Ga0495629_0312482
415 Ga0495584_0056790
416 Ga0495585_0084575
417 Ga0495596_0060171
418 Ga0495607_0142326
419 Ga0495611_0100199
420 Ga0495625_0052918
421 Ga0495588_0010112
422 Ga0495670_0038983
423 Ga0495670_0150121
424 Ga0495670_0184177
425 Ga0495636_0091224
426 Ga0496104_0156474
427 Ga0496104_0261265
428 Ga0496108_0213540
429 Ga0496109_0093207
430 Ga0496110_0338057
431 Ga0496114_0146367
432 Ga0501036_0024835
433 Ga0501038_0017571
434 Ga0501040_0021472
435 Ga0501040_0229203
436 Ga0501042_0091900
437 Ga0501042_0356028
438 Ga0501046_0118599
439 Ga0501048_0211951
440 Ga0501067_0003730
441 Ga0501068_0051656
442 Ga0501068_0069595
443 Ga0501068_0314698
444 Ga0501069_0029597
445 Ga0501071_0098190
446 Ga0501072_0029274
447 Ga0501072_0038342
448 Ga0501072_0067952
449 Ga0501072_0179905
450 Ga0501074_0003125
451 Ga0501074_0110145
452 Ga0501075_0033388
453 Ga0501076_0137852
454 Ga0501076_0159380
455 Ga0501077_0002880
456 Ga0501079_0009048
457 Ga0501081_0006356
458 Ga0501044_0083344
459 Ga0501045_0056839
460 Ga0501045_0070035
461 nmdc:mga05p37_232810_c1
462 nmdc:mga05p37_25715_c1
463 nmdc:mga05p37_2846_c1
464 nmdc:mga05p37_297321_c1
465 nmdc:mga05p37_35077_c1
466 nmdc:mga05p37_36884_c1
467 nmdc:mga05p37_789343_c1
468 nmdc:mga05p37_80718_c1
469 nmdc:mga09592_166945_c1
470 nmdc:mga09592_93817_c1
471 nmdc:mga0qj67_27053_c1
472 nmdc:mga0qj67_5006_c1
473 nmdc:mga06r32_17978_c1
474 nmdc:mga06r32_19105_c1
475 nmdc:mga06r32_1967_c1
476 nmdc:mga06r32_23625_c1
477 nmdc:mga06r32_90593_c1
478 nmdc:mga08y16_105177_c1
479 nmdc:mga08y16_113877_c1
480 nmdc:mga0n895_10803_c1
481 nmdc:mga0n895_6767_c1
482 nmdc:mga0a205_231736_c1
483 nmdc:mga0a205_60657_c1
484 nmdc:mga0a205_87785_c1
485 Ga0495655_0012943
486 Ga0501084_0010689
487 Ga0501084_0127206
488 Ga0590075_009228
489 Ga0501082_0011249
490 Ga0501082_0021558
491 Ga0530510_0056846
492 2515855995
493 2644447177
494 2676478911
495 2816424834
496 2827633850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

31

191

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4exa-assembly2.cif.gz_C crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8482 3 265
4exa-assembly1.cif.gz_B crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8352 3 265
4exa-assembly1.cif.gz_A crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8287 3 265
4exb-assembly2.cif.gz_C putative aldo-keto reductase from pseudomona aeruginosa 0.8276 3 261
4exa-assembly2.cif.gz_F crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.827 3 265
ID Description Score Start End Superfamily
af_Q9VGF2_1_211_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8607 1 158 3.20.20.100
4exaF00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.827 3 265 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8045 1 196 3.20.20.100
4exaF00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7852 3 265 3.20.20.100
af_Q5T2L2_5_129_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7802 2 105 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A3N0GT43-F1-model_v4 Aldo/keto reductase 0.9956 1 291 GO:0016491
AF-A0A1C0ZR58-F1-model_v4 Aldo/keto reductase 0.9931 1 286
AF-A0A3N0GT43-F1-model_v4 Aldo/keto reductase 0.9921 1 291 GO:0016491
AF-A0A7K1IXI3-F1-model_v4 Aldo/keto reductase 0.9879 3 104 GO:0016491
AF-A0A6J4U5Q5-F1-model_v4 Oxidoreductase, aldo/keto reductase family 0.9839 1 183

Map