F360107

General Info

Members Datasets Scaffolds Average Seq Length
248 188 496 269

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0003692|Ga0466969_0003692_4148_5056
Length 302
Sequence VVVTASSGDSAPTTRTCVPRKLAGGRDCARVAGVSDLRVTTRNARFQQWEALLANRTKRQRAGEFLVHGVRPITLAVEHGWPLSALLYPAGRRLSKWAGELLDTTRATRVAMAPDLLAELGEKDADAAPELIAVATLPPDDLSRIPVRPDFLGVVFDRPTSPGNIGSVIRSADAFGAHGVIVAGHAADVYDPRSVRASTGSLFALPVVRADSAAKVLEWIRAQPVTTQVVGTDENGTAVVDRHSLTGPTLLVIGNETAGMSNAWRGACDHVLSIPIGGAASSLNAANAASIVLYEVARQRRL

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
128 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
129 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
170 2501939600 Micromonospora sp. L5 Isolate Unclassified
171 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
172 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
173 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
174 2558860280 Kutzneria sp. 744 Isolate Unclassified
175 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
176 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
177 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
178 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
179 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
180 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
181 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
182 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
183 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
184 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
185 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
186 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
187 649633069 Micromonospora sp. L5 Isolate Unclassified
188 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.53
Metatranscriptomes 0.81
Isolates 7.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 5.24
Rhizosphere 87.9
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0003692 3300044656 Bacteria 8147
2 JGI24737J22298_10006841 3300001990 Bacteria 3874
3 JGI24735J21928_10042018 3300002067 Bacteria 1332
4 rootH2_10262475 3300003320 Bacteria 1290
5 rootH1_10359332 3300003323 Bacteria 1760
6 JGI25407J50210_10019240 3300003373 Bacteria 1775
7 Ga0070658_10026962 3300005327 Bacteria 4613
8 Ga0070676_10109807 3300005328 Bacteria 1716
9 Ga0070683_100063569 3300005329 Bacteria 3433
10 Ga0068869_100002346 3300005334 Bacteria 11391
11 Ga0070661_100006318 3300005344 Bacteria 8173
12 Ga0070692_10026397 3300005345 Bacteria 2870
13 Ga0070668_100094770 3300005347 Bacteria 2357
14 Ga0070668_100368993 3300005347 Bacteria 1219
15 Ga0070671_100026821 3300005355 Bacteria 4738
16 Ga0070671_100261266 3300005355 Bacteria 1472
17 Ga0070673_100029181 3300005364 Bacteria 4111
18 Ga0070659_100081622 3300005366 Bacteria 2582
19 Ga0070667_100364334 3300005367 Bacteria 1311
20 Ga0070709_10002604 3300005434 Bacteria 9744
21 Ga0070709_10046867 3300005434 Bacteria 2690
22 Ga0070714_100000182 3300005435 Bacteria 50060
23 Ga0070714_100288149 3300005435 Bacteria 1527
24 Ga0070710_10007794 3300005437 Bacteria 5197
25 Ga0070710_10065931 3300005437 Bacteria 2075
26 Ga0070711_100304841 3300005439 Bacteria 1268
27 Ga0070681_10035755 3300005458 Bacteria 4989
28 Ga0068867_100289969 3300005459 Bacteria 1345
29 Ga0070679_100039513 3300005530 Bacteria 4689
30 Ga0068853_100071934 3300005539 Bacteria 3013
31 Ga0070672_100208796 3300005543 Bacteria 1635
32 Ga0070693_100037128 3300005547 Bacteria 2714
33 Ga0070665_100366254 3300005548 Unclassified 1448
34 Ga0070664_100344482 3300005564 Bacteria 1354
35 Ga0068854_100033242 3300005578 Bacteria 3595
36 Ga0068856_100106863 3300005614 Bacteria 2794
37 Ga0068856_100435353 3300005614 Bacteria 1331
38 Ga0068852_100022896 3300005616 Bacteria 5019
39 Ga0068852_100334145 3300005616 Bacteria 1475
40 Ga0068859_100061735 3300005617 Bacteria 3777
41 Ga0068851_10152866 3300005834 Bacteria 1263
42 Ga0068870_10000371 3300005840 Bacteria 16836
43 Ga0068863_100096729 3300005841 Bacteria 2803
44 Ga0068858_100017430 3300005842 Bacteria 6736
45 Ga0081455_10001991 3300005937 Bacteria 24400
46 Ga0081538_10001486 3300005981 Bacteria 24075
47 Ga0081540_1068017 3300005983 Bacteria 1661
48 Ga0081539_10002028 3300005985 Bacteria 30520
49 Ga0070717_10202507 3300006028 Bacteria 1739
50 Ga0070717_10203842 3300006028 Bacteria 1733
51 Ga0070716_100001616 3300006173 Bacteria 10157
52 Ga0068871_100062888 3300006358 Bacteria 3034
53 Ga0075428_100000728 3300006844 Bacteria 34185
54 Ga0075428_100006048 3300006844 Bacteria 13445
55 Ga0075428_100061415 3300006844 Bacteria 4115
56 Ga0075428_100152359 3300006844 Bacteria 2511
57 Ga0075428_100485206 3300006844 Bacteria 1323
58 Ga0075430_100002213 3300006846 Bacteria 16120
59 Ga0075430_100002599 3300006846 Bacteria 15073
60 Ga0075431_100019700 3300006847 Bacteria 6884
61 Ga0075431_100035206 3300006847 Bacteria 5155
62 Ga0075431_100260251 3300006847 Bacteria 1761
63 Ga0075429_100001092 3300006880 Bacteria 21833
64 Ga0075429_100018832 3300006880 Bacteria 5980
65 Ga0075429_100023891 3300006880 Bacteria 5304
66 Ga0075429_100062365 3300006880 Bacteria 3248
67 Ga0075429_100256924 3300006880 Bacteria 1530
68 Ga0075436_100009808 3300006914 Bacteria 6549
69 Ga0097620_100061733 3300006931 Bacteria 3777
70 Ga0075435_100004529 3300007076 Bacteria 9555
71 Ga0105251_10082238 3300009011 Bacteria 1487
72 Ga0105240_10571095 3300009093 Bacteria 1249
73 Ga0105245_10018661 3300009098 Bacteria 6067
74 Ga0105245_10021743 3300009098 Bacteria 5632
75 Ga0105247_10009301 3300009101 Bacteria 5967
76 Ga0114129_10000988 3300009147 Bacteria 37163
77 Ga0114129_10001766 3300009147 Bacteria 29481
78 Ga0114129_10010114 3300009147 Bacteria 13448
79 Ga0114129_10159022 3300009147 Bacteria 3088
80 Ga0114129_10185330 3300009147 Bacteria 2829
81 Ga0114129_10517294 3300009147 Bacteria 1556
82 Ga0114129_10604671 3300009147 Bacteria 1420
83 Ga0105243_10038012 3300009148 Bacteria 3746
84 Ga0105243_10313548 3300009148 Bacteria 1426
85 Ga0105241_10092834 3300009174 Bacteria 2384
86 Ga0105242_10212530 3300009176 Bacteria 1725
87 Ga0105248_10045442 3300009177 Bacteria 4925
88 Ga0105248_10433285 3300009177 Bacteria 1481
89 Ga0105246_10000293 3300011119 Bacteria 26148
90 Ga0157373_10092507 3300013100 Bacteria 2130
91 Ga0157370_10045647 3300013104 Bacteria 4202
92 Ga0157369_10182415 3300013105 Unclassified 2208
93 Ga0157369_10228898 3300013105 Bacteria 1944
94 Ga0157369_10413996 3300013105 Bacteria 1398
95 Ga0157375_10160110 3300013308 Bacteria 2392
96 Ga0157377_10094445 3300014745 Bacteria 1771
97 Ga0157379_10083481 3300014968 Bacteria 2863
98 Ga0157376_10062934 3300014969 Bacteria 3123
99 Ga0206354_11160639 3300020081 Bacteria 3011
100 Ga0206353_11920547 3300020082 Bacteria 3737
101 Ga0207656_10061773 3300025321 Bacteria 1645
102 Ga0207713_1055887 3300025735 Bacteria 1537
103 Ga0207692_10024586 3300025898 Bacteria 2802
104 Ga0207692_10113594 3300025898 Bacteria 1506
105 Ga0207710_10032368 3300025900 Bacteria 2290
106 Ga0207685_10000827 3300025905 Bacteria 5759
107 Ga0207699_10040403 3300025906 Bacteria 2688
108 Ga0207645_10107148 3300025907 Bacteria 1807
109 Ga0207643_10000022 3300025908 Bacteria 105173
110 Ga0207654_10072286 3300025911 Bacteria 2053
111 Ga0207663_10200521 3300025916 Bacteria 1439
112 Ga0207660_10085057 3300025917 Bacteria 2332
113 Ga0207657_10204271 3300025919 Bacteria 1588
114 Ga0207649_10027390 3300025920 Bacteria 3343
115 Ga0207694_10168051 3300025924 Bacteria 1774
116 Ga0207687_10010510 3300025927 Bacteria 6047
117 Ga0207700_10026980 3300025928 Bacteria 4014
118 Ga0207700_10118326 3300025928 Bacteria 2144
119 Ga0207700_10387141 3300025928 Bacteria 1224
120 Ga0207664_10000185 3300025929 Bacteria 47364
121 Ga0207664_10063520 3300025929 Bacteria 2951
122 Ga0207664_10525105 3300025929 Bacteria 1061
123 Ga0207709_10103629 3300025935 Bacteria 1886
124 Ga0207704_10295872 3300025938 Bacteria 1238
125 Ga0207665_10002796 3300025939 Bacteria 11696
126 Ga0207691_10015226 3300025940 Bacteria 7316
127 Ga0207689_10005316 3300025942 Bacteria 11541
128 Ga0207661_10002483 3300025944 Bacteria 12682
129 Ga0207679_10011821 3300025945 Bacteria 5672
130 Ga0207667_10266197 3300025949 Bacteria 1753
131 Ga0207651_10516206 3300025960 Bacteria 1035
132 Ga0207640_10011075 3300025981 Bacteria 5095
133 Ga0207658_10206623 3300025986 Bacteria 1643
134 Ga0207677_10073695 3300026023 Bacteria 2419
135 Ga0207639_10035266 3300026041 Bacteria 3701
136 Ga0207678_10001333 3300026067 Bacteria 22773
137 Ga0207708_10015814 3300026075 Bacteria 5663
138 Ga0207702_10048314 3300026078 Bacteria 3588
139 Ga0207641_10271821 3300026088 Bacteria 1590
140 Ga0207641_10366379 3300026088 Bacteria 1377
141 Ga0207648_10317911 3300026089 Bacteria 1399
142 Ga0207674_10033965 3300026116 Bacteria 5335
143 Ga0207674_10057168 3300026116 Bacteria 3955
144 Ga0207674_10445521 3300026116 Bacteria 1251
145 Ga0207674_10620374 3300026116 Bacteria 1044
146 Ga0207675_100779394 3300026118 Bacteria 969
147 Ga0207683_10000171 3300026121 Bacteria 56009
148 Ga0268266_10140249 3300028379 Bacteria 2169
149 Ga0307515_10029325 3300028794 Bacteria 9306
150 Ga0307515_10436656 3300028794 Bacteria 927
151 Ga0307511_10001458 3300030521 Bacteria 24986
152 Ga0307405_10146632 3300031731 Bacteria 1654
153 Ga0307405_10359836 3300031731 Bacteria 1125
154 Ga0307413_10009123 3300031824 Bacteria 4730
155 Ga0326468_10000392 3300031889 Bacteria 4633
156 Ga0307406_10012702 3300031901 Bacteria 4803
157 Ga0307406_10221799 3300031901 Bacteria 1406
158 Ga0307406_10438268 3300031901 Bacteria 1045
159 Ga0307407_10007947 3300031903 Bacteria 4835
160 Ga0307409_100003948 3300031995 Bacteria 8216
161 Ga0307414_10250518 3300032004 Bacteria 1472
162 Ga0307415_100011947 3300032126 Bacteria 4998
163 Ga0373938_0031662 3300034957 Bacteria 1135
164 Ga0373941_0005146 3300035115 Bacteria 3058
165 Ga0373942_0001273 3300035207 Bacteria 6598
166 Ga0395900_0173425 3300037418 Bacteria 2194
167 Ga0395898_0029850 3300037466 Bacteria 5458
168 Ga0436364_0237542 3300037853 Bacteria 47348
169 Ga0436363_1114018 3300039450 Bacteria 1650
170 Ga0439448_0076072 3300042005 Bacteria 1123
171 Ga0439459_0012898 3300042438 Bacteria 1496
172 Ga0439440_0067464 3300042993 Bacteria 925
173 Ga0466969_0008333 3300044656 Bacteria 5498
174 Ga0466965_0056131 3300044683 Bacteria 1961
175 Ga0466965_0152746 3300044683 Bacteria 1207
176 Ga0466966_0004811 3300044684 Bacteria 8879
177 Ga0466961_0003927 3300044693 Bacteria 9303
178 Ga0466961_0251225 3300044693 Bacteria 1086
179 Ga0466959_0005508 3300045049 Bacteria 8683
180 Ga0495629_0042940 3300046459 Bacteria 3176
181 Ga0495651_0087776 3300046462 Bacteria 2338
182 Ga0495594_0111901 3300046499 Bacteria 1540
183 Ga0495628_0157147 3300046516 Bacteria 1729
184 Ga0495630_0234550 3300046517 Bacteria 1402
185 Ga0495652_0157873 3300046529 Bacteria 1764
186 Ga0495587_0188359 3300046536 Bacteria 1169
187 Ga0495645_0181712 3300046543 Bacteria 1441
188 Ga0495634_0211062 3300046642 Bacteria 1202
189 Ga0495623_0036859 3300046679 Bacteria 3132
190 Ga0495646_0039058 3300046680 Bacteria 2928
191 Ga0495604_0006451 3300047317 Bacteria 9304
192 Ga0495675_0006072 3300047444 Bacteria 7393
193 Ga0495675_0018073 3300047444 Bacteria 4470
194 Ga0496101_0061584 3300048904 Bacteria 2726
195 Ga0496103_0061064 3300048906 Bacteria 2344
196 Ga0496104_0002025 3300048907 Bacteria 17601
197 Ga0496105_0017243 3300048908 Bacteria 5784
198 Ga0496108_0203037 3300048911 Bacteria 1720
199 Ga0496109_0118796 3300048912 Bacteria 2461
200 Ga0496109_0264462 3300048912 Bacteria 1620
201 Ga0496110_0006321 3300048913 Bacteria 9357
202 Ga0496110_0037673 3300048913 Bacteria 4204
203 Ga0496112_0002456 3300048915 Bacteria 14946
204 Ga0496112_0534161 3300048915 Bacteria 1107
205 Ga0496113_0030602 3300048916 Bacteria 3898
206 Ga0496115_0235178 3300048918 Bacteria 1510
207 Ga0501076_0387448 3300049592 Bacteria 1149
208 nmdc:mga05p37_1362_c1 3300050507 Bacteria 21254
209 nmdc:mga05p37_70500_c1 3300050507 Bacteria 4299
210 nmdc:mga05p37_72902_c1 3300050507 Bacteria 4226
211 nmdc:mga09592_104230_c1 3300050508 Bacteria 2430
212 nmdc:mga09592_127122_c1 3300050508 Bacteria 2192
213 nmdc:mga09592_178174_c1 3300050508 Bacteria 1838
214 nmdc:mga09592_18581_c1 3300050508 Bacteria 5703
215 nmdc:mga09592_72_c1 3300050508 Bacteria 56957
216 nmdc:mga0qj67_14047_c1 3300050509 Bacteria 6048
217 nmdc:mga0qj67_48_c1 3300050509 Bacteria 85487
218 nmdc:mga0qj67_5984_c1 3300050509 Bacteria 8912
219 nmdc:mga06r32_19846_c1 3300050510 Bacteria 6177
220 nmdc:mga06r32_39608_c1 3300050510 Bacteria 4473
221 nmdc:mga06r32_436_c1 3300050510 Bacteria 35325
222 nmdc:mga0n895_288525_c1 3300050512 Bacteria 1664
223 nmdc:mga0rr50_38001_c1 3300050513 Bacteria 3480
224 nmdc:mga08x19_41031_c1 3300050514 Bacteria 2947
225 Ga0495601_0047725 3300053077 Bacteria 2696
226 Ga0495612_0006919 3300053078 Bacteria 4640
227 Ga0495655_0021683 3300053083 Bacteria 1457
228 Ga0495619_0006562 3300053085 Bacteria 7361
229 Ga0500641_0036894 3300053096 Bacteria 1957
230 2501942912 2501939600 Bacteria 6907073
231 2515719305 2515154129 Bacteria 5584369
232 2515855452 2515154155 Bacteria 7985436
233 2516083644 2515154202 Bacteria 5471270
234 2559422595 2558860280 Bacteria 11429938
235 2676474311 2675903058 Bacteria 6822861
236 2795781163 2795385470 Bacteria 8317180
237 2804844970 2802429296 Bacteria 7227771
238 2816421250 2816332119 Bacteria 8120218
239 2819743594 2818991472 Bacteria 10089953
240 2827633220 2827628540 Bacteria 6858585
241 2839986876 2839986021 Bacteria 3685650
242 2848552513 2848551377 Bacteria 3720646
243 2856860121 2856858025 Bacteria 7255264
244 2891329765 2891326441 Bacteria 6439512
245 2990049832 2990044586 Bacteria 6603797
246 2990088572 2990088156 Bacteria 6657676
247 649810604 649633069 Bacteria 6962533
248 8025418935 8025413630 Bacteria 7014048
249 Ga0466969_0003692
250 JGI24737J22298_10006841
251 JGI24735J21928_10042018
252 rootH2_10262475
253 rootH1_10359332
254 JGI25407J50210_10019240
255 Ga0070658_10026962
256 Ga0070676_10109807
257 Ga0070683_100063569
258 Ga0068869_100002346
259 Ga0070661_100006318
260 Ga0070692_10026397
261 Ga0070668_100094770
262 Ga0070668_100368993
263 Ga0070671_100026821
264 Ga0070671_100261266
265 Ga0070673_100029181
266 Ga0070659_100081622
267 Ga0070667_100364334
268 Ga0070709_10002604
269 Ga0070709_10046867
270 Ga0070714_100000182
271 Ga0070714_100288149
272 Ga0070710_10007794
273 Ga0070710_10065931
274 Ga0070711_100304841
275 Ga0070681_10035755
276 Ga0068867_100289969
277 Ga0070679_100039513
278 Ga0068853_100071934
279 Ga0070672_100208796
280 Ga0070693_100037128
281 Ga0070665_100366254
282 Ga0070664_100344482
283 Ga0068854_100033242
284 Ga0068856_100106863
285 Ga0068856_100435353
286 Ga0068852_100022896
287 Ga0068852_100334145
288 Ga0068859_100061735
289 Ga0068851_10152866
290 Ga0068870_10000371
291 Ga0068863_100096729
292 Ga0068858_100017430
293 Ga0081455_10001991
294 Ga0081538_10001486
295 Ga0081540_1068017
296 Ga0081539_10002028
297 Ga0070717_10202507
298 Ga0070717_10203842
299 Ga0070716_100001616
300 Ga0068871_100062888
301 Ga0075428_100000728
302 Ga0075428_100006048
303 Ga0075428_100061415
304 Ga0075428_100152359
305 Ga0075428_100485206
306 Ga0075430_100002213
307 Ga0075430_100002599
308 Ga0075431_100019700
309 Ga0075431_100035206
310 Ga0075431_100260251
311 Ga0075429_100001092
312 Ga0075429_100018832
313 Ga0075429_100023891
314 Ga0075429_100062365
315 Ga0075429_100256924
316 Ga0075436_100009808
317 Ga0097620_100061733
318 Ga0075435_100004529
319 Ga0105251_10082238
320 Ga0105240_10571095
321 Ga0105245_10018661
322 Ga0105245_10021743
323 Ga0105247_10009301
324 Ga0114129_10000988
325 Ga0114129_10001766
326 Ga0114129_10010114
327 Ga0114129_10159022
328 Ga0114129_10185330
329 Ga0114129_10517294
330 Ga0114129_10604671
331 Ga0105243_10038012
332 Ga0105243_10313548
333 Ga0105241_10092834
334 Ga0105242_10212530
335 Ga0105248_10045442
336 Ga0105248_10433285
337 Ga0105246_10000293
338 Ga0157373_10092507
339 Ga0157370_10045647
340 Ga0157369_10182415
341 Ga0157369_10228898
342 Ga0157369_10413996
343 Ga0157375_10160110
344 Ga0157377_10094445
345 Ga0157379_10083481
346 Ga0157376_10062934
347 Ga0206354_11160639
348 Ga0206353_11920547
349 Ga0207656_10061773
350 Ga0207713_1055887
351 Ga0207692_10024586
352 Ga0207692_10113594
353 Ga0207710_10032368
354 Ga0207685_10000827
355 Ga0207699_10040403
356 Ga0207645_10107148
357 Ga0207643_10000022
358 Ga0207654_10072286
359 Ga0207663_10200521
360 Ga0207660_10085057
361 Ga0207657_10204271
362 Ga0207649_10027390
363 Ga0207694_10168051
364 Ga0207687_10010510
365 Ga0207700_10026980
366 Ga0207700_10118326
367 Ga0207700_10387141
368 Ga0207664_10000185
369 Ga0207664_10063520
370 Ga0207664_10525105
371 Ga0207709_10103629
372 Ga0207704_10295872
373 Ga0207665_10002796
374 Ga0207691_10015226
375 Ga0207689_10005316
376 Ga0207661_10002483
377 Ga0207679_10011821
378 Ga0207667_10266197
379 Ga0207651_10516206
380 Ga0207640_10011075
381 Ga0207658_10206623
382 Ga0207677_10073695
383 Ga0207639_10035266
384 Ga0207678_10001333
385 Ga0207708_10015814
386 Ga0207702_10048314
387 Ga0207641_10271821
388 Ga0207641_10366379
389 Ga0207648_10317911
390 Ga0207674_10033965
391 Ga0207674_10057168
392 Ga0207674_10445521
393 Ga0207674_10620374
394 Ga0207675_100779394
395 Ga0207683_10000171
396 Ga0268266_10140249
397 Ga0307515_10029325
398 Ga0307515_10436656
399 Ga0307511_10001458
400 Ga0307405_10146632
401 Ga0307405_10359836
402 Ga0307413_10009123
403 Ga0326468_10000392
404 Ga0307406_10012702
405 Ga0307406_10221799
406 Ga0307406_10438268
407 Ga0307407_10007947
408 Ga0307409_100003948
409 Ga0307414_10250518
410 Ga0307415_100011947
411 Ga0373938_0031662
412 Ga0373941_0005146
413 Ga0373942_0001273
414 Ga0395900_0173425
415 Ga0395898_0029850
416 Ga0436364_0237542
417 Ga0436363_1114018
418 Ga0439448_0076072
419 Ga0439459_0012898
420 Ga0439440_0067464
421 Ga0466969_0008333
422 Ga0466965_0056131
423 Ga0466965_0152746
424 Ga0466966_0004811
425 Ga0466961_0003927
426 Ga0466961_0251225
427 Ga0466959_0005508
428 Ga0495629_0042940
429 Ga0495651_0087776
430 Ga0495594_0111901
431 Ga0495628_0157147
432 Ga0495630_0234550
433 Ga0495652_0157873
434 Ga0495587_0188359
435 Ga0495645_0181712
436 Ga0495634_0211062
437 Ga0495623_0036859
438 Ga0495646_0039058
439 Ga0495604_0006451
440 Ga0495675_0006072
441 Ga0495675_0018073
442 Ga0496101_0061584
443 Ga0496103_0061064
444 Ga0496104_0002025
445 Ga0496105_0017243
446 Ga0496108_0203037
447 Ga0496109_0118796
448 Ga0496109_0264462
449 Ga0496110_0006321
450 Ga0496110_0037673
451 Ga0496112_0002456
452 Ga0496112_0534161
453 Ga0496113_0030602
454 Ga0496115_0235178
455 Ga0501076_0387448
456 nmdc:mga05p37_1362_c1
457 nmdc:mga05p37_70500_c1
458 nmdc:mga05p37_72902_c1
459 nmdc:mga09592_104230_c1
460 nmdc:mga09592_127122_c1
461 nmdc:mga09592_178174_c1
462 nmdc:mga09592_18581_c1
463 nmdc:mga09592_72_c1
464 nmdc:mga0qj67_14047_c1
465 nmdc:mga0qj67_48_c1
466 nmdc:mga0qj67_5984_c1
467 nmdc:mga06r32_19846_c1
468 nmdc:mga06r32_39608_c1
469 nmdc:mga06r32_436_c1
470 nmdc:mga0n895_288525_c1
471 nmdc:mga0rr50_38001_c1
472 nmdc:mga08x19_41031_c1
473 Ga0495601_0047725
474 Ga0495612_0006919
475 Ga0495655_0021683
476 Ga0495619_0006562
477 Ga0500641_0036894
478 2501942912
479 2515719305
480 2515855452
481 2516083644
482 2559422595
483 2676474311
484 2795781163
485 2804844970
486 2816421250
487 2819743594
488 2827633220
489 2839986876
490 2848552513
491 2856860121
492 2891329765
493 2990049832
494 2990088572
495 649810604
496 8025418935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22655

SpoU_sub_bind_like

SpoU L30e-like domain

43

133

0.98

PF00588

SpoU_methylase

SpoU rRNA Methylase family

152

294

0.95

PF22435

MRM3-like_sub_bind

MRM3-like substrate binding domain

43

126

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x7p-assembly1.cif.gz_A crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes in complex with the cofactor adomet 0.9589 10 266
1x7o-assembly1.cif.gz_B crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes 0.9586 11 268
1x7p-assembly1.cif.gz_B crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes in complex with the cofactor adomet 0.9566 11 269
1x7p-assembly1.cif.gz_B crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes in complex with the cofactor adomet 0.953 11 269
1x7o-assembly1.cif.gz_B crystal structure of the spou methyltransferase avirb from streptomyces viridochromogenes 0.9404 11 268
ID Description Score Start End Superfamily
1x7pB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9648 110 269 3.40.1280.10
af_P9WFY5_148_322_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9436 115 267 3.40.1280.10
1x7pB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9418 110 269 3.40.1280.10
af_Q2G2M3_73_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.937 117 266 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9367 115 266 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A7V6VKG9-F1-model_v4 RNA methyltransferase 0.9754 1 235 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A4Q7WC53-F1-model_v4 deleted 0.9728 1 269
AF-A0A4Q7WC53-F1-model_v4 deleted 0.9692 1 269
AF-A0A1W6DUR9-F1-model_v4 tRNA methyltransferase 0.9675 33 269 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A7V6VKG9-F1-model_v4 RNA methyltransferase 0.9553 1 235 GO:0003723
GO:0006396
GO:0008173
GO:0032259

Map