F360016

General Info

Members Datasets Scaffolds Average Seq Length
248 169 496 170

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10189345|Ga0307414_101893452
Length 205
Sequence MSTQNTAGVTGEHTTDGRPHSATSLTPFLAIPRARDAIDFYRDVFGATVVDVTEFGDVVAHADLDFGLGRLQLGEPSPEYHLVAAPQGDDDCYSLGLYVSDVDSVVERAVAAGALVREAPSDFVSGDRFASIRDPFGVRWSVMTRVEDLSDEESARRVAEWAASFTSQPTDGANSGRAPRPRTPPAAAPRRCAGSPADWDGSGRG

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
23 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
39 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
63 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
64 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
65 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
77 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
78 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
85 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
86 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
87 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
88 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
89 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
90 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
91 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
92 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
93 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
94 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
95 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
96 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
97 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
139 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
140 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
141 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
142 2643221630 Microbacterium sp. Root322 Isolate Unclassified
143 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
144 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
145 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
146 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
147 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
148 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
149 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
150 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
151 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
152 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
153 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
154 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
155 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
156 2919395869 Microbacterium resistens 2980 Isolate Unclassified
157 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
158 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
159 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
160 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
161 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
162 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
163 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
164 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
165 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
166 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
167 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
168 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
169 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.1
Metatranscriptomes 0.81
Isolates 12.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.42
Nodule 0
Rhizoplane 18.15
Rhizosphere 66.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10189345 3300032004 Bacteria 1663
2 Ga0065714_10070294 3300005288 Bacteria 3907
3 Ga0065714_10088660 3300005288 Bacteria 2009
4 Ga0070658_10037443 3300005327 Bacteria 3911
5 Ga0070683_100055477 3300005329 Bacteria 3677
6 Ga0070670_100002049 3300005331 Bacteria 16496
7 Ga0070677_10186180 3300005333 Bacteria 992
8 Ga0070666_10151444 3300005335 Bacteria 1618
9 Ga0070680_100048599 3300005336 Bacteria 3458
10 Ga0070680_100286877 3300005336 Bacteria 1395
11 Ga0070661_100008783 3300005344 Bacteria 6992
12 Ga0070675_100035441 3300005354 Bacteria 4055
13 Ga0070675_100080045 3300005354 Bacteria 2723
14 Ga0070671_100374015 3300005355 Bacteria 1217
15 Ga0070674_100189495 3300005356 Bacteria 1581
16 Ga0070674_100409087 3300005356 Bacteria 1110
17 Ga0070659_100151064 3300005366 Bacteria 1895
18 Ga0070667_100394789 3300005367 Bacteria 1258
19 Ga0070667_100694945 3300005367 Bacteria 941
20 Ga0070681_10387970 3300005458 Bacteria 1307
21 Ga0070698_100628446 3300005471 Bacteria 1015
22 Ga0070679_100499378 3300005530 Bacteria 1161
23 Ga0070684_100019434 3300005535 Bacteria 5620
24 Ga0070672_100002782 3300005543 Bacteria 11217
25 Ga0070672_100205489 3300005543 Bacteria 1648
26 Ga0075363_100692053 3300006048 Bacteria 615
27 Ga0075429_100475713 3300006880 Bacteria 1095
28 Ga0105251_10106126 3300009011 Bacteria 1282
29 Ga0105244_10001493 3300009036 Bacteria 18767
30 Ga0105244_10002077 3300009036 Bacteria 15410
31 Ga0114129_10754237 3300009147 Bacteria 1246
32 Ga0114129_10886041 3300009147 Bacteria 1132
33 Ga0105248_10590264 3300009177 Bacteria 1253
34 Ga0105237_10269844 3300009545 Bacteria 1704
35 Ga0105246_10002640 3300011119 Bacteria 10861
36 Ga0105246_10017003 3300011119 Bacteria 4618
37 Ga0157371_10031863 3300013102 Bacteria 3796
38 Ga0157370_10034404 3300013104 Bacteria 4935
39 Ga0157370_10327497 3300013104 Bacteria 1413
40 Ga0157369_10002384 3300013105 Bacteria 22576
41 Ga0157369_10486092 3300013105 Bacteria 1278
42 Ga0171462_1004 3300013250 Bacteria 678877
43 Ga0163162_10002493 3300013306 Bacteria 17400
44 Ga0163162_10114470 3300013306 Bacteria 2796
45 Ga0157372_10497073 3300013307 Bacteria 1422
46 Ga0157375_10003050 3300013308 Bacteria 14540
47 Ga0157375_10104107 3300013308 Bacteria 2926
48 Ga0163163_10178058 3300014325 Bacteria 2173
49 Ga0206356_10194948 3300020070 Bacteria 3263
50 Ga0206353_12053788 3300020082 Bacteria 3275
51 Ga0209646_1000092 3300025246 Bacteria 185930
52 Ga0209051_1002838 3300025303 Bacteria 11940
53 Ga0207655_1001669 3300025728 Bacteria 19609
54 Ga0207655_1024067 3300025728 Bacteria 2995
55 Ga0207682_10171091 3300025893 Bacteria 988
56 Ga0207645_10223458 3300025907 Bacteria 1242
57 Ga0207705_10020582 3300025909 Bacteria 4711
58 Ga0207707_10035077 3300025912 Bacteria 4387
59 Ga0207660_10055930 3300025917 Bacteria 2822
60 Ga0207660_10498023 3300025917 Bacteria 988
61 Ga0207649_10040079 3300025920 Bacteria 2844
62 Ga0207652_10012130 3300025921 Bacteria 6962
63 Ga0207650_10001695 3300025925 Bacteria 15665
64 Ga0207659_10227779 3300025926 Bacteria 1502
65 Ga0207659_10343008 3300025926 Bacteria 1237
66 Ga0207644_10727279 3300025931 Bacteria 828
67 Ga0207690_10468170 3300025932 Bacteria 1015
68 Ga0207709_10178465 3300025935 Bacteria 1497
69 Ga0207669_10186645 3300025937 Bacteria 1492
70 Ga0207669_10462154 3300025937 Bacteria 1008
71 Ga0207691_10001757 3300025940 Bacteria 21334
72 Ga0207661_10088108 3300025944 Bacteria 2579
73 Ga0207658_10806591 3300025986 Bacteria 852
74 Ga0207683_10023813 3300026121 Bacteria 5268
75 Ga0207428_10638908 3300027907 Bacteria 765
76 Ga0307515_10004996 3300028794 Bacteria 27058
77 Ga0307512_10012348 3300030522 Bacteria 8065
78 Ga0307408_100155968 3300031548 Bacteria 1808
79 Ga0316575_10003880 3300031665 Bacteria 5220
80 Ga0316579_10005814 3300031691 Bacteria 4998
81 Ga0316576_10023434 3300031727 Bacteria 4300
82 Ga0316578_10048752 3300031728 Bacteria 2474
83 Ga0307405_10562959 3300031731 Bacteria 924
84 Ga0307413_10075378 3300031824 Bacteria 2141
85 Ga0307413_10652783 3300031824 Bacteria 868
86 Ga0307410_10037631 3300031852 Bacteria 3162
87 Ga0307406_10000710 3300031901 Bacteria 18737
88 Ga0307406_10011403 3300031901 Bacteria 5044
89 Ga0307406_10068119 3300031901 Bacteria 2323
90 Ga0307407_10053277 3300031903 Bacteria 2327
91 Ga0307412_10148911 3300031911 Bacteria 1724
92 Ga0307412_10204899 3300031911 Bacteria 1501
93 Ga0307412_10556415 3300031911 Bacteria 964
94 Ga0307409_100060693 3300031995 Bacteria 2950
95 Ga0307416_100100944 3300032002 Bacteria 2511
96 Ga0307416_100517767 3300032002 Bacteria 1260
97 Ga0307414_10028501 3300032004 Bacteria 3624
98 Ga0307414_10037079 3300032004 Bacteria 3261
99 Ga0307414_10547546 3300032004 Bacteria 1031
100 Ga0307414_10780637 3300032004 Bacteria 870
101 Ga0307411_10025991 3300032005 Bacteria 3517
102 Ga0307411_11268632 3300032005 Bacteria 670
103 Ga0307415_100006947 3300032126 Bacteria 6150
104 Ga0316583_10021150 3300032133 Bacteria 2333
105 Ga0316585_10118368 3300032137 Bacteria 871
106 Ga0316574_0019370 3300035398 Bacteria 4012
107 Ga0316582_0004865 3300036647 Bacteria 6856
108 Ga0316584_0024457 3300036712 Bacteria 4420
109 Ga0395898_0090100 3300037466 Bacteria 2952
110 Ga0395905_0425891 3300037471 Bacteria 1224
111 Ga0395901_0016019 3300038443 Bacteria 7637
112 Ga0395901_0048316 3300038443 Bacteria 4419
113 Ga0439436_0025907 3300041404 Bacteria 1721
114 Ga0439438_052278 3300041405 Bacteria 1036
115 Ga0439439_0048071 3300041406 Bacteria 1115
116 Ga0439466_0020659 3300041411 Bacteria 2345
117 Ga0439465_0045019 3300041413 Bacteria 1434
118 Ga0451837_1144354 3300041494 Bacteria 927
119 Ga0439433_0008449 3300041999 Bacteria 2233
120 Ga0439442_003173 3300042002 Bacteria 3252
121 Ga0439449_0028201 3300042007 Bacteria 2092
122 Ga0439457_014089 3300042014 Bacteria 1792
123 Ga0450920_008112 3300042122 Bacteria 1914
124 Ga0450920_025737 3300042122 Bacteria 1146
125 Ga0450907_000739 3300042146 Bacteria 8333
126 Ga0439434_0001504 3300042435 Bacteria 6707
127 Ga0439434_0036939 3300042435 Bacteria 1495
128 Ga0450918_002276 3300042531 Bacteria 3638
129 Ga0466965_0000012 3300044683 Bacteria 100611
130 Ga0466965_0185559 3300044683 Bacteria 1098
131 Ga0466966_0090401 3300044684 Bacteria 1901
132 Ga0466970_0101371 3300044765 Bacteria 1568
133 Ga0466960_0080363 3300044901 Bacteria 1641
134 Ga0495645_0024162 3300046543 Bacteria 4409
135 Ga0495588_0107780 3300046674 Bacteria 1467
136 Ga0496100_0001370 3300048903 Bacteria 11941
137 Ga0496100_0053530 3300048903 Bacteria 2628
138 Ga0496101_0015825 3300048904 Bacteria 5090
139 Ga0496101_0160383 3300048904 Bacteria 1724
140 Ga0496101_0392426 3300048904 Bacteria 1092
141 Ga0496102_0002277 3300048905 Bacteria 16427
142 Ga0496102_0123867 3300048905 Bacteria 2415
143 Ga0496102_0301585 3300048905 Bacteria 1510
144 Ga0496102_0451941 3300048905 Bacteria 1205
145 Ga0496103_0001252 3300048906 Bacteria 17342
146 Ga0496103_0062461 3300048906 Bacteria 2318
147 Ga0496103_0190803 3300048906 Bacteria 1317
148 Ga0496104_0160620 3300048907 Bacteria 2155
149 Ga0496104_0180487 3300048907 Bacteria 2021
150 Ga0496104_0631176 3300048907 Bacteria 981
151 Ga0496105_0003048 3300048908 Bacteria 12319
152 Ga0496105_0852265 3300048908 Bacteria 689
153 Ga0496106_0004613 3300048909 Bacteria 10222
154 Ga0496106_0127588 3300048909 Bacteria 1993
155 Ga0496107_0000708 3300048910 Bacteria 19021
156 Ga0496107_0019378 3300048910 Bacteria 4800
157 Ga0496107_0152472 3300048910 Bacteria 1710
158 Ga0496108_0034294 3300048911 Bacteria 4216
159 Ga0496108_0103930 3300048911 Bacteria 2424
160 Ga0496108_0302595 3300048911 Bacteria 1393
161 Ga0496108_1443479 3300048911 Bacteria 574
162 Ga0496109_0001003 3300048912 Bacteria 23333
163 Ga0496109_0206633 3300048912 Bacteria 1846
164 Ga0496109_0298054 3300048912 Bacteria 1520
165 Ga0496110_0002516 3300048913 Bacteria 13773
166 Ga0496110_0143557 3300048913 Bacteria 2158
167 Ga0496111_0004223 3300048914 Bacteria 9047
168 Ga0496111_0056491 3300048914 Bacteria 2840
169 Ga0496111_0068378 3300048914 Bacteria 2581
170 Ga0496112_0077520 3300048915 Bacteria 3287
171 Ga0496112_0163596 3300048915 Bacteria 2191
172 Ga0496113_0020675 3300048916 Bacteria 4633
173 Ga0496113_0074307 3300048916 Bacteria 2591
174 Ga0496113_0561331 3300048916 Bacteria 915
175 Ga0496114_0004215 3300048917 Bacteria 11142
176 Ga0496114_0007087 3300048917 Bacteria 8843
177 Ga0496114_0058877 3300048917 Bacteria 3208
178 Ga0496114_0149097 3300048917 Bacteria 2029
179 Ga0496114_0664794 3300048917 Bacteria 915
180 Ga0496115_0006924 3300048918 Bacteria 8329
181 Ga0496117_0004827 3300048920 Bacteria 14574
182 Ga0496119_0002548 3300048922 Bacteria 19838
183 Ga0496119_0371067 3300048922 Bacteria 688
184 Ga0496119_0493651 3300048922 Bacteria 571
185 Ga0496122_0014629 3300048925 Bacteria 7573
186 Ga0496122_0029606 3300048925 Bacteria 4613
187 Ga0496122_0115704 3300048925 Bacteria 1746
188 Ga0496122_0142064 3300048925 Bacteria 1500
189 Ga0496125_0041387 3300048928 Bacteria 3939
190 Ga0496125_0055687 3300048928 Bacteria 3219
191 Ga0496126_0004899 3300048929 Bacteria 15641
192 Ga0496126_0074608 3300048929 Bacteria 3012
193 Ga0496126_0222771 3300048929 Bacteria 1583
194 Ga0496126_0345461 3300048929 Bacteria 1218
195 Ga0501032_0008721 3300049569 Bacteria 7383
196 Ga0501032_0164472 3300049569 Bacteria 1456
197 Ga0501033_0220868 3300049570 Bacteria 1349
198 Ga0501034_0027069 3300049571 Bacteria 5834
199 Ga0501034_0100020 3300049571 Bacteria 2894
200 Ga0501037_0143709 3300049573 Bacteria 1707
201 Ga0501037_0536276 3300049573 Bacteria 791
202 Ga0501038_0014717 3300049574 Bacteria 7128
203 Ga0501038_0030040 3300049574 Bacteria 4811
204 Ga0501038_0107174 3300049574 Bacteria 2318
205 Ga0501038_0357066 3300049574 Bacteria 1137
206 Ga0501039_0603793 3300049575 Bacteria 860
207 Ga0501043_0423387 3300049579 Bacteria 1003
208 Ga0501047_0005658 3300049581 Bacteria 11766
209 Ga0501047_0276613 3300049581 Bacteria 1524
210 Ga0501070_0005515 3300049586 Bacteria 10794
211 Ga0501070_0116662 3300049586 Bacteria 2205
212 Ga0501243_012939 3300049675 Bacteria 1321
213 nmdc:mga00v17_250054_c1 3300050491 Bacteria 1149
214 nmdc:mga00v17_9177_c1 3300050491 Bacteria 5340
215 nmdc:mga05p37_148028_c1 3300050507 Bacteria 2874
216 nmdc:mga06r32_828221_c1 3300050510 Bacteria 885
217 Ga0500646_0152848 3300053090 Bacteria 765
218 Ga0500660_173411 3300053100 Bacteria 793
219 2515855115 2515154155 Bacteria 7985436
220 2643732157 2643221542 Bacteria 3563959
221 2644170964 2643221630 Bacteria 3601215
222 2738889692 2738541308 Bacteria 7020677
223 2747953363 2747842429 Bacteria 3914386
224 2852646657 2852646457 Bacteria 3408613
225 2852664497 2852663356 Bacteria 4090475
226 2857710652 2857710386 Bacteria 3186771
227 2857727027 2857723135 Bacteria 4217853
228 2857733003 2857729791 Bacteria 4040535
229 2857743174 2857740372 Bacteria 4782044
230 2904497168 2904497146 Bacteria 4731781
231 2904780385 2904776348 Bacteria 4658726
232 2910813882 2910809715 Bacteria 4982797
233 2919038368 2919034639 Bacteria 4763403
234 2919393663 2919391150 Bacteria 4884741
235 2919396102 2919395869 Bacteria 3704152
236 2919540099 2919538618 Bacteria 4677069
237 2932398426 2932398195 Bacteria 3847976
238 2932428942 2932426870 Bacteria 4547726
239 2939678100 2939674588 Bacteria 4844420
240 2945942992 2945941187 Bacteria 4682474
241 2945960403 2945956166 Bacteria 5110334
242 2945971071 2945968032 Bacteria 4111363
243 2946038716 2946037020 Bacteria 4900426
244 2946043420 2946041624 Bacteria 4191385
245 2946081643 2946080515 Bacteria 4310960
246 2995726779 2995726249 Bacteria 3470435
247 8004183759 8004182704 Bacteria 3391155
248 8004212994 8004212874 Bacteria 2861420
249 Ga0307414_10189345
250 Ga0065714_10070294
251 Ga0065714_10088660
252 Ga0070658_10037443
253 Ga0070683_100055477
254 Ga0070670_100002049
255 Ga0070677_10186180
256 Ga0070666_10151444
257 Ga0070680_100048599
258 Ga0070680_100286877
259 Ga0070661_100008783
260 Ga0070675_100035441
261 Ga0070675_100080045
262 Ga0070671_100374015
263 Ga0070674_100189495
264 Ga0070674_100409087
265 Ga0070659_100151064
266 Ga0070667_100394789
267 Ga0070667_100694945
268 Ga0070681_10387970
269 Ga0070698_100628446
270 Ga0070679_100499378
271 Ga0070684_100019434
272 Ga0070672_100002782
273 Ga0070672_100205489
274 Ga0075363_100692053
275 Ga0075429_100475713
276 Ga0105251_10106126
277 Ga0105244_10001493
278 Ga0105244_10002077
279 Ga0114129_10754237
280 Ga0114129_10886041
281 Ga0105248_10590264
282 Ga0105237_10269844
283 Ga0105246_10002640
284 Ga0105246_10017003
285 Ga0157371_10031863
286 Ga0157370_10034404
287 Ga0157370_10327497
288 Ga0157369_10002384
289 Ga0157369_10486092
290 Ga0171462_1004
291 Ga0163162_10002493
292 Ga0163162_10114470
293 Ga0157372_10497073
294 Ga0157375_10003050
295 Ga0157375_10104107
296 Ga0163163_10178058
297 Ga0206356_10194948
298 Ga0206353_12053788
299 Ga0209646_1000092
300 Ga0209051_1002838
301 Ga0207655_1001669
302 Ga0207655_1024067
303 Ga0207682_10171091
304 Ga0207645_10223458
305 Ga0207705_10020582
306 Ga0207707_10035077
307 Ga0207660_10055930
308 Ga0207660_10498023
309 Ga0207649_10040079
310 Ga0207652_10012130
311 Ga0207650_10001695
312 Ga0207659_10227779
313 Ga0207659_10343008
314 Ga0207644_10727279
315 Ga0207690_10468170
316 Ga0207709_10178465
317 Ga0207669_10186645
318 Ga0207669_10462154
319 Ga0207691_10001757
320 Ga0207661_10088108
321 Ga0207658_10806591
322 Ga0207683_10023813
323 Ga0207428_10638908
324 Ga0307515_10004996
325 Ga0307512_10012348
326 Ga0307408_100155968
327 Ga0316575_10003880
328 Ga0316579_10005814
329 Ga0316576_10023434
330 Ga0316578_10048752
331 Ga0307405_10562959
332 Ga0307413_10075378
333 Ga0307413_10652783
334 Ga0307410_10037631
335 Ga0307406_10000710
336 Ga0307406_10011403
337 Ga0307406_10068119
338 Ga0307407_10053277
339 Ga0307412_10148911
340 Ga0307412_10204899
341 Ga0307412_10556415
342 Ga0307409_100060693
343 Ga0307416_100100944
344 Ga0307416_100517767
345 Ga0307414_10028501
346 Ga0307414_10037079
347 Ga0307414_10547546
348 Ga0307414_10780637
349 Ga0307411_10025991
350 Ga0307411_11268632
351 Ga0307415_100006947
352 Ga0316583_10021150
353 Ga0316585_10118368
354 Ga0316574_0019370
355 Ga0316582_0004865
356 Ga0316584_0024457
357 Ga0395898_0090100
358 Ga0395905_0425891
359 Ga0395901_0016019
360 Ga0395901_0048316
361 Ga0439436_0025907
362 Ga0439438_052278
363 Ga0439439_0048071
364 Ga0439466_0020659
365 Ga0439465_0045019
366 Ga0451837_1144354
367 Ga0439433_0008449
368 Ga0439442_003173
369 Ga0439449_0028201
370 Ga0439457_014089
371 Ga0450920_008112
372 Ga0450920_025737
373 Ga0450907_000739
374 Ga0439434_0001504
375 Ga0439434_0036939
376 Ga0450918_002276
377 Ga0466965_0000012
378 Ga0466965_0185559
379 Ga0466966_0090401
380 Ga0466970_0101371
381 Ga0466960_0080363
382 Ga0495645_0024162
383 Ga0495588_0107780
384 Ga0496100_0001370
385 Ga0496100_0053530
386 Ga0496101_0015825
387 Ga0496101_0160383
388 Ga0496101_0392426
389 Ga0496102_0002277
390 Ga0496102_0123867
391 Ga0496102_0301585
392 Ga0496102_0451941
393 Ga0496103_0001252
394 Ga0496103_0062461
395 Ga0496103_0190803
396 Ga0496104_0160620
397 Ga0496104_0180487
398 Ga0496104_0631176
399 Ga0496105_0003048
400 Ga0496105_0852265
401 Ga0496106_0004613
402 Ga0496106_0127588
403 Ga0496107_0000708
404 Ga0496107_0019378
405 Ga0496107_0152472
406 Ga0496108_0034294
407 Ga0496108_0103930
408 Ga0496108_0302595
409 Ga0496108_1443479
410 Ga0496109_0001003
411 Ga0496109_0206633
412 Ga0496109_0298054
413 Ga0496110_0002516
414 Ga0496110_0143557
415 Ga0496111_0004223
416 Ga0496111_0056491
417 Ga0496111_0068378
418 Ga0496112_0077520
419 Ga0496112_0163596
420 Ga0496113_0020675
421 Ga0496113_0074307
422 Ga0496113_0561331
423 Ga0496114_0004215
424 Ga0496114_0007087
425 Ga0496114_0058877
426 Ga0496114_0149097
427 Ga0496114_0664794
428 Ga0496115_0006924
429 Ga0496117_0004827
430 Ga0496119_0002548
431 Ga0496119_0371067
432 Ga0496119_0493651
433 Ga0496122_0014629
434 Ga0496122_0029606
435 Ga0496122_0115704
436 Ga0496122_0142064
437 Ga0496125_0041387
438 Ga0496125_0055687
439 Ga0496126_0004899
440 Ga0496126_0074608
441 Ga0496126_0222771
442 Ga0496126_0345461
443 Ga0501032_0008721
444 Ga0501032_0164472
445 Ga0501033_0220868
446 Ga0501034_0027069
447 Ga0501034_0100020
448 Ga0501037_0143709
449 Ga0501037_0536276
450 Ga0501038_0014717
451 Ga0501038_0030040
452 Ga0501038_0107174
453 Ga0501038_0357066
454 Ga0501039_0603793
455 Ga0501043_0423387
456 Ga0501047_0005658
457 Ga0501047_0276613
458 Ga0501070_0005515
459 Ga0501070_0116662
460 Ga0501243_012939
461 nmdc:mga00v17_250054_c1
462 nmdc:mga00v17_9177_c1
463 nmdc:mga05p37_148028_c1
464 nmdc:mga06r32_828221_c1
465 Ga0500646_0152848
466 Ga0500660_173411
467 2515855115
468 2643732157
469 2644170964
470 2738889692
471 2747953363
472 2852646657
473 2852664497
474 2857710652
475 2857727027
476 2857733003
477 2857743174
478 2904497168
479 2904780385
480 2910813882
481 2919038368
482 2919393663
483 2919396102
484 2919540099
485 2932398426
486 2932428942
487 2939678100
488 2945942992
489 2945960403
490 2945971071
491 2946038716
492 2946043420
493 2946081643
494 2995726779
495 8004183759
496 8004212994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

19

142

0.9

PF18029

Glyoxalase_6

Glyoxalase-like domain

28

143

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.8226 33 155
2p7q-assembly4.cif.gz_B crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.8215 36 163
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.8044 33 155
2p7p-assembly4.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.8018 33 165
2p7q-assembly4.cif.gz_D-2 crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.7948 36 168
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8899 102 155 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8604 103 152 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8556 104 168 3.30.720.110
3itwB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8523 33 87 3.30.720.120
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8481 102 155 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7Y9J282-F1-model_v4 PhnB protein 0.983 19 173
AF-A0A061LWE4-F1-model_v4 Glyoxalase 0.9802 14 173
AF-A0A5C8HRD2-F1-model_v4 VOC family protein 0.9791 16 173
AF-A0A7L5Z5A7-F1-model_v4 VOC family protein 0.9743 35 174
AF-A0A3D9LDL0-F1-model_v4 PhnB protein 0.9734 17 176

Map