F359857

General Info

Members Datasets Scaffolds Average Seq Length
248 146 496 750

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10082782|Ga0105248_100827822
Length 797
Sequence MFRTLDRYVIRELLLPMGLSLVVLTFIVTVPTILRDAEALIVKGIAWSTFVHVLVLLLPSSLSLTIPMSVLLGILIAFGRLSSDREFVALQACGVSPFRLIRPVAIVALXXTAAAAHQIIVALPDANQTFREITFNVIANRAESNVKPRVFYSEFPNRTIYARDVIPGGWRDVFLADTSQPNETTVYFAKEGRLLVDRAKGSVALELTNGTRHTTSMTKPDEYEGGDYERVLIHVDPNTVFPNIKPVKTPIEMTIAELNVSIAEAAAKNEPAYVQLFDIQQKFAFPAACLVLALIGLALGVSNRKDSQFSSFVLGFGVIFAYYVVLWTVRAAAFAGRIPASLGPWIPNIIFGAAGVALLLWRARSADQPIRISVPAFWRRDDADTAAAGEPGHDVSAREGRGPARRVVLVIRVPQVDLSRFPRPALLDWYVSRQYLRIFFLGLFGLLGIFYISTFMDLADKLFRGAATTPMVLRYFIFQTPQYVYYIIPMSALVATLVTVGLMTKNSELVVMRACGISLYRTAAPLLLFAAASSAVLFTLQEHVIAYSNRAADRVNRVIRSLPPASFGALDRRWVVGENGDIYHYEFFDPKKNEFREFAIYHLDPMRWGLRSMTRASRVAQTRRAGADDGVALGWSGFFGWSREFSETMQGTVRKTSVRYTPFGERTLPLESPGYFKTDEPDAALMTYGQLKEYVAQLQVGGYNVMPYMVALQRKVAFPFVTVVMTLLAVPFAVTTGRRGALYGVGAAIVLAIIYWMTLSICAAIGAGGLLPPMLAAWTPNILFGAAAAYLILTVRT

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
97 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
98 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
99 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
100 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
103 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.42
Rhizosphere 97.58
Stem 0
Stem Tuber 0
Unclassified 8.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10082782 3300009177 Bacteria 3609
2 JGI25406J46586_10000183 3300003203 Bacteria 28210
3 Ga0065712_10000746 3300005290 Bacteria 17125
4 Ga0065715_10095445 3300005293 Bacteria 4079
5 Ga0065707_10000704 3300005295 Bacteria 18194
6 Ga0070676_10026682 3300005328 Bacteria 3270
7 Ga0070690_100025833 3300005330 Bacteria 3618
8 Ga0068869_100010422 3300005334 Bacteria 6062
9 Ga0068869_100059447 3300005334 Bacteria 2798
10 Ga0070666_10042945 3300005335 Bacteria 3026
11 Ga0068868_100020849 3300005338 Bacteria 4932
12 Ga0070660_100018753 3300005339 Bacteria 5061
13 Ga0070687_100009241 3300005343 Bacteria 4216
14 Ga0070687_100016058 3300005343 Bacteria 3403
15 Ga0070668_100031460 3300005347 Bacteria 4037
16 Ga0070669_100009271 3300005353 Bacteria 7010
17 Ga0070675_100012342 3300005354 Bacteria 6696
18 Ga0070675_100013414 3300005354 Bacteria 6440
19 Ga0070675_100040879 3300005354 Unclassified 3787
20 Ga0070674_100000322 3300005356 Bacteria 23676
21 Ga0070674_100005582 3300005356 Bacteria 7281
22 Ga0070673_100007261 3300005364 Bacteria 7294
23 Ga0070673_100044858 3300005364 Bacteria 3425
24 Ga0070667_100060387 3300005367 Bacteria 3208
25 Ga0070714_100098319 3300005435 Unclassified 2574
26 Ga0070700_100018449 3300005441 Bacteria 4011
27 Ga0070678_100019358 3300005456 Unclassified 4434
28 Ga0070662_100015147 3300005457 Bacteria 5159
29 Ga0068867_100037573 3300005459 Bacteria 3520
30 Ga0070707_100019374 3300005468 Bacteria 6410
31 Ga0070698_100005718 3300005471 Bacteria 13607
32 Ga0070698_100038432 3300005471 Unclassified 4931
33 Ga0070699_100003152 3300005518 Bacteria 14593
34 Ga0070699_100007871 3300005518 Bacteria 9260
35 Ga0070672_100023426 3300005543 Unclassified 4552
36 Ga0070672_100036329 3300005543 Unclassified 3753
37 Ga0070686_100005076 3300005544 Bacteria 7267
38 Ga0070686_100018699 3300005544 Unclassified 4073
39 Ga0070665_100009032 3300005548 Bacteria 10099
40 Ga0070665_100027348 3300005548 Bacteria 5745
41 Ga0070665_100031832 3300005548 Bacteria 5309
42 Ga0068854_100002889 3300005578 Bacteria 10681
43 Ga0068856_100019535 3300005614 Bacteria 6577
44 Ga0070702_100018192 3300005615 Bacteria 3640
45 Ga0068852_100031690 3300005616 Bacteria 4367
46 Ga0068859_100003733 3300005617 Bacteria 15515
47 Ga0068859_100011325 3300005617 Bacteria 8976
48 Ga0068864_100037485 3300005618 Bacteria 4137
49 Ga0068864_100108960 3300005618 Unclassified 2465
50 Ga0068861_100010277 3300005719 Bacteria 6497
51 Ga0068861_100052084 3300005719 Bacteria 3110
52 Ga0068870_10000715 3300005840 Bacteria 12741
53 Ga0068858_100001318 3300005842 Bacteria 25636
54 Ga0068858_100002817 3300005842 Bacteria 17483
55 Ga0068858_100036356 3300005842 Bacteria 4567
56 Ga0068858_100091817 3300005842 Bacteria 2826
57 Ga0068858_100115600 3300005842 Bacteria 2507
58 Ga0068860_100005521 3300005843 Bacteria 12801
59 Ga0068862_100014314 3300005844 Bacteria 6580
60 Ga0068862_100040126 3300005844 Unclassified 3979
61 Ga0068862_100046050 3300005844 Bacteria 3723
62 Ga0081539_10000460 3300005985 Bacteria 86291
63 Ga0081539_10002838 3300005985 Bacteria 23104
64 Ga0081539_10013517 3300005985 Bacteria 6141
65 Ga0097621_100008783 3300006237 Bacteria 7300
66 Ga0097621_100013088 3300006237 Bacteria 6171
67 Ga0068871_100005504 3300006358 Bacteria 8884
68 Ga0068871_100014193 3300006358 Bacteria 5931
69 Ga0075428_100000011 3300006844 Bacteria 194129
70 Ga0075428_100068893 3300006844 Unclassified 3870
71 Ga0075430_100000482 3300006846 Bacteria 29804
72 Ga0075431_100000361 3300006847 Bacteria 36002
73 Ga0075433_10000018 3300006852 Bacteria 63744
74 Ga0075434_100002150 3300006871 Bacteria 17166
75 Ga0075434_100004115 3300006871 Bacteria 13050
76 Ga0075434_100004549 3300006871 Bacteria 12523
77 Ga0075434_100038226 3300006871 Bacteria 4754
78 Ga0075429_100005846 3300006880 Bacteria 10615
79 Ga0068865_100021497 3300006881 Unclassified 4196
80 Ga0075436_100001403 3300006914 Bacteria 16384
81 Ga0075436_100003106 3300006914 Bacteria 11381
82 Ga0097620_100003733 3300006931 Bacteria 15515
83 Ga0097620_100011325 3300006931 Bacteria 8976
84 Ga0075435_100001064 3300007076 Bacteria 17442
85 Ga0075435_100002607 3300007076 Bacteria 12027
86 Ga0075435_100003047 3300007076 Bacteria 11295
87 Ga0075435_100005900 3300007076 Bacteria 8618
88 Ga0075435_100012794 3300007076 Bacteria 6217
89 Ga0075435_100013783 3300007076 Bacteria 6025
90 Ga0105240_10010556 3300009093 Bacteria 12972
91 Ga0111539_10000011 3300009094 Bacteria 356900
92 Ga0111539_10000056 3300009094 Bacteria 114878
93 Ga0111539_10002590 3300009094 Bacteria 23947
94 Ga0111539_10005421 3300009094 Bacteria 16505
95 Ga0111539_10006107 3300009094 Bacteria 15548
96 Ga0111539_10006380 3300009094 Bacteria 15210
97 Ga0111539_10010393 3300009094 Bacteria 11717
98 Ga0111539_10015182 3300009094 Bacteria 9593
99 Ga0111539_10034701 3300009094 Bacteria 6112
100 Ga0111539_10044635 3300009094 Bacteria 5309
101 Ga0105245_10028376 3300009098 Bacteria 4937
102 Ga0105247_10025639 3300009101 Bacteria 3557
103 Ga0114129_10002052 3300009147 Bacteria 27655
104 Ga0114129_10005354 3300009147 Bacteria 18110
105 Ga0114129_10007434 3300009147 Bacteria 15603
106 Ga0114129_10011267 3300009147 Bacteria 12744
107 Ga0114129_10014092 3300009147 Bacteria 11389
108 Ga0114129_10019366 3300009147 Bacteria 9692
109 Ga0114129_10153435 3300009147 Bacteria 3151
110 Ga0105242_10027799 3300009176 Bacteria 4497
111 Ga0105248_10043391 3300009177 Bacteria 5042
112 Ga0105249_10063121 3300009553 Bacteria 3403
113 Ga0105249_10095393 3300009553 Bacteria 2789
114 Ga0163162_10104716 3300013306 Bacteria 2924
115 Ga0157375_10103183 3300013308 Unclassified 2938
116 Ga0157375_10129450 3300013308 Bacteria 2642
117 Ga0163163_10026423 3300014325 Bacteria 5549
118 Ga0157380_10006332 3300014326 Bacteria 8320
119 Ga0157380_10007297 3300014326 Bacteria 7846
120 Ga0157377_10015651 3300014745 Unclassified 3886
121 Ga0157377_10018693 3300014745 Bacteria 3606
122 Ga0157379_10013051 3300014968 Bacteria 7275
123 Ga0157379_10013632 3300014968 Bacteria 7123
124 Ga0157379_10083871 3300014968 Bacteria 2856
125 Ga0157376_10008526 3300014969 Bacteria 7403
126 Ga0157376_10011789 3300014969 Bacteria 6459
127 Ga0163161_10039604 3300017792 Bacteria 3384
128 Ga0207682_10010108 3300025893 Bacteria 3704
129 Ga0207682_10012284 3300025893 Bacteria 3344
130 Ga0207710_10011422 3300025900 Bacteria 3739
131 Ga0207688_10000113 3300025901 Bacteria 32645
132 Ga0207643_10000149 3300025908 Bacteria 47771
133 Ga0207643_10006156 3300025908 Bacteria 6421
134 Ga0207662_10027040 3300025918 Bacteria 3311
135 Ga0207657_10001144 3300025919 Bacteria 28206
136 Ga0207646_10062235 3300025922 Bacteria 3332
137 Ga0207659_10001050 3300025926 Bacteria 16372
138 Ga0207659_10001652 3300025926 Bacteria 13258
139 Ga0207706_10026844 3300025933 Bacteria 5155
140 Ga0207686_10004305 3300025934 Bacteria 7633
141 Ga0207686_10020220 3300025934 Bacteria 3800
142 Ga0207669_10001412 3300025937 Bacteria 10221
143 Ga0207704_10015612 3300025938 Bacteria 3875
144 Ga0207691_10082700 3300025940 Unclassified 2883
145 Ga0207689_10001601 3300025942 Bacteria 21426
146 Ga0207689_10018725 3300025942 Bacteria 5839
147 Ga0207712_10014234 3300025961 Bacteria 5110
148 Ga0207640_10002907 3300025981 Bacteria 9198
149 Ga0207703_10003829 3300026035 Bacteria 12502
150 Ga0207703_10008710 3300026035 Bacteria 8008
151 Ga0207708_10017368 3300026075 Bacteria 5417
152 Ga0207708_10027675 3300026075 Bacteria 4294
153 Ga0207641_10054745 3300026088 Bacteria 3387
154 Ga0207648_10036840 3300026089 Unclassified 4309
155 Ga0207648_10054867 3300026089 Bacteria 3480
156 Ga0207676_10045640 3300026095 Unclassified 3387
157 Ga0207676_10055665 3300026095 Bacteria 3107
158 Ga0207675_100000796 3300026118 Bacteria 31302
159 Ga0207675_100022302 3300026118 Bacteria 5896
160 Ga0207675_100045211 3300026118 Bacteria 4114
161 Ga0207428_10000212 3300027907 Bacteria 80663
162 Ga0207428_10000512 3300027907 Bacteria 46347
163 Ga0207428_10001107 3300027907 Bacteria 29337
164 Ga0207428_10016986 3300027907 Bacteria 6253
165 Ga0207428_10071478 3300027907 Bacteria 2725
166 Ga0268266_10023609 3300028379 Bacteria 5235
167 Ga0268266_10031224 3300028379 Bacteria 4522
168 Ga0268265_10012043 3300028380 Bacteria 5855
169 Ga0268265_10025761 3300028380 Bacteria 4178
170 Ga0307413_10011957 3300031824 Bacteria 4296
171 Ga0307409_100023281 3300031995 Bacteria 4288
172 Ga0373948_0000989 3300034817 Bacteria 3817
173 Ga0373958_0000558 3300034819 Bacteria 4631
174 Ga0373938_0001125 3300034957 Bacteria 4302
175 Ga0373949_0001532 3300035090 Bacteria 6542
176 Ga0373951_0003521 3300035091 Bacteria 3788
177 Ga0373932_0000719 3300035112 Bacteria 9988
178 Ga0373941_0002082 3300035115 Bacteria 4344
179 Ga0373960_0000577 3300035121 Bacteria 7469
180 Ga0373937_0021869 3300036401 Bacteria 5743
181 Ga0451576_0006769 3300045051 Bacteria 13946
182 Ga0451576_0026188 3300045051 Bacteria 6274
183 Ga0495603_0013677 3300046455 Unclassified 4910
184 Ga0495629_0068959 3300046459 Unclassified 2467
185 Ga0495608_0021350 3300046511 Bacteria 4443
186 Ga0495628_0010401 3300046516 Bacteria 7902
187 Ga0495643_0003849 3300046522 Bacteria 10807
188 Ga0495645_0000774 3300046543 Bacteria 21888
189 Ga0495634_0064809 3300046642 Unclassified 2422
190 Ga0495658_0015704 3300046683 Bacteria 3888
191 Ga0495669_0018723 3300046684 Bacteria 2980
192 Ga0495613_0000598 3300046689 Bacteria 29033
193 Ga0495674_0088454 3300047319 Unclassified 2649
194 Ga0495684_0002960 3300047471 Bacteria 13369
195 Ga0496101_0001418 3300048904 Bacteria 14342
196 Ga0496104_0032393 3300048907 Bacteria 4864
197 Ga0496105_0021196 3300048908 Bacteria 5258
198 Ga0496112_0002012 3300048915 Bacteria 16080
199 Ga0496114_0000128 3300048917 Bacteria 54547
200 Ga0496114_0063459 3300048917 Bacteria 3093
201 Ga0501036_0057284 3300049572 Bacteria 3301
202 Ga0501036_0082419 3300049572 Unclassified 2719
203 Ga0501039_0088626 3300049575 Bacteria 2410
204 Ga0501040_0007984 3300049576 Bacteria 6869
205 Ga0501041_0002207 3300049577 Bacteria 11002
206 Ga0501042_0015217 3300049578 Bacteria 5264
207 Ga0501042_0018752 3300049578 Bacteria 4795
208 Ga0501042_0040322 3300049578 Bacteria 3320
209 Ga0501072_0011639 3300049588 Bacteria 6721
210 Ga0501072_0045707 3300049588 Bacteria 3444
211 Ga0501075_0000268 3300049591 Bacteria 28521
212 Ga0501075_0039423 3300049591 Bacteria 3536
213 Ga0501075_0043382 3300049591 Bacteria 3374
214 Ga0501076_0001484 3300049592 Bacteria 15718
215 Ga0501076_0002648 3300049592 Bacteria 12357
216 Ga0501076_0012653 3300049592 Bacteria 6316
217 Ga0501079_0007053 3300049741 Bacteria 8478
218 Ga0501080_0032434 3300049742 Bacteria 4872
219 Ga0501081_0003859 3300049743 Bacteria 9603
220 Ga0501081_0015012 3300049743 Bacteria 5112
221 Ga0501045_0018727 3300049824 Bacteria 4929
222 nmdc:mga05p37_10162_c1 3300050507 Bacteria 11170
223 nmdc:mga05p37_13156_c1 3300050507 Bacteria 9904
224 nmdc:mga05p37_17189_c1 3300050507 Bacteria 8726
225 nmdc:mga05p37_20722_c1 3300050507 Bacteria 6249
226 nmdc:mga09592_5409_c1 3300050508 Bacteria 10374
227 nmdc:mga0qj67_25622_c1 3300050509 Unclassified 4558
228 nmdc:mga08y16_10304_c1 3300050511 Bacteria 9810
229 nmdc:mga08y16_12_c1 3300050511 Bacteria 438455
230 nmdc:mga08y16_16079_c1 3300050511 Bacteria 7869
231 nmdc:mga08y16_1982_c1 3300050511 Bacteria 20887
232 nmdc:mga08y16_2138_c1 3300050511 Bacteria 20263
233 nmdc:mga08y16_46400_c1 3300050511 Bacteria 4549
234 nmdc:mga08y16_8307_c1 3300050511 Bacteria 10866
235 nmdc:mga0n895_38930_c1 3300050512 Bacteria 4609
236 nmdc:mga0n895_47664_c1 3300050512 Bacteria 4190
237 nmdc:mga0n895_650_c1 3300050512 Bacteria 24250
238 nmdc:mga0n895_66611_c1 3300050512 Bacteria 3566
239 nmdc:mga0rr50_10789_c1 3300050513 Bacteria 5823
240 nmdc:mga0rr50_1752_c1 3300050513 Bacteria 11975
241 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
242 nmdc:mga08x19_15283_c1 3300050514 Bacteria 4669
243 Ga0495601_0009487 3300053077 Bacteria 5759
244 Ga0501084_0005139 3300054114 Bacteria 10714
245 Ga0590074_000024 3300059423 Bacteria 14836
246 Ga0501082_0001760 3300060353 Bacteria 19055
247 Ga0530510_0003453 3300061734 Bacteria 10865
248 Ga0530510_0004739 3300061734 Bacteria 9414
249 Ga0105248_10082782
250 JGI25406J46586_10000183
251 Ga0065712_10000746
252 Ga0065715_10095445
253 Ga0065707_10000704
254 Ga0070676_10026682
255 Ga0070690_100025833
256 Ga0068869_100010422
257 Ga0068869_100059447
258 Ga0070666_10042945
259 Ga0068868_100020849
260 Ga0070660_100018753
261 Ga0070687_100009241
262 Ga0070687_100016058
263 Ga0070668_100031460
264 Ga0070669_100009271
265 Ga0070675_100012342
266 Ga0070675_100013414
267 Ga0070675_100040879
268 Ga0070674_100000322
269 Ga0070674_100005582
270 Ga0070673_100007261
271 Ga0070673_100044858
272 Ga0070667_100060387
273 Ga0070714_100098319
274 Ga0070700_100018449
275 Ga0070678_100019358
276 Ga0070662_100015147
277 Ga0068867_100037573
278 Ga0070707_100019374
279 Ga0070698_100005718
280 Ga0070698_100038432
281 Ga0070699_100003152
282 Ga0070699_100007871
283 Ga0070672_100023426
284 Ga0070672_100036329
285 Ga0070686_100005076
286 Ga0070686_100018699
287 Ga0070665_100009032
288 Ga0070665_100027348
289 Ga0070665_100031832
290 Ga0068854_100002889
291 Ga0068856_100019535
292 Ga0070702_100018192
293 Ga0068852_100031690
294 Ga0068859_100003733
295 Ga0068859_100011325
296 Ga0068864_100037485
297 Ga0068864_100108960
298 Ga0068861_100010277
299 Ga0068861_100052084
300 Ga0068870_10000715
301 Ga0068858_100001318
302 Ga0068858_100002817
303 Ga0068858_100036356
304 Ga0068858_100091817
305 Ga0068858_100115600
306 Ga0068860_100005521
307 Ga0068862_100014314
308 Ga0068862_100040126
309 Ga0068862_100046050
310 Ga0081539_10000460
311 Ga0081539_10002838
312 Ga0081539_10013517
313 Ga0097621_100008783
314 Ga0097621_100013088
315 Ga0068871_100005504
316 Ga0068871_100014193
317 Ga0075428_100000011
318 Ga0075428_100068893
319 Ga0075430_100000482
320 Ga0075431_100000361
321 Ga0075433_10000018
322 Ga0075434_100002150
323 Ga0075434_100004115
324 Ga0075434_100004549
325 Ga0075434_100038226
326 Ga0075429_100005846
327 Ga0068865_100021497
328 Ga0075436_100001403
329 Ga0075436_100003106
330 Ga0097620_100003733
331 Ga0097620_100011325
332 Ga0075435_100001064
333 Ga0075435_100002607
334 Ga0075435_100003047
335 Ga0075435_100005900
336 Ga0075435_100012794
337 Ga0075435_100013783
338 Ga0105240_10010556
339 Ga0111539_10000011
340 Ga0111539_10000056
341 Ga0111539_10002590
342 Ga0111539_10005421
343 Ga0111539_10006107
344 Ga0111539_10006380
345 Ga0111539_10010393
346 Ga0111539_10015182
347 Ga0111539_10034701
348 Ga0111539_10044635
349 Ga0105245_10028376
350 Ga0105247_10025639
351 Ga0114129_10002052
352 Ga0114129_10005354
353 Ga0114129_10007434
354 Ga0114129_10011267
355 Ga0114129_10014092
356 Ga0114129_10019366
357 Ga0114129_10153435
358 Ga0105242_10027799
359 Ga0105248_10043391
360 Ga0105249_10063121
361 Ga0105249_10095393
362 Ga0163162_10104716
363 Ga0157375_10103183
364 Ga0157375_10129450
365 Ga0163163_10026423
366 Ga0157380_10006332
367 Ga0157380_10007297
368 Ga0157377_10015651
369 Ga0157377_10018693
370 Ga0157379_10013051
371 Ga0157379_10013632
372 Ga0157379_10083871
373 Ga0157376_10008526
374 Ga0157376_10011789
375 Ga0163161_10039604
376 Ga0207682_10010108
377 Ga0207682_10012284
378 Ga0207710_10011422
379 Ga0207688_10000113
380 Ga0207643_10000149
381 Ga0207643_10006156
382 Ga0207662_10027040
383 Ga0207657_10001144
384 Ga0207646_10062235
385 Ga0207659_10001050
386 Ga0207659_10001652
387 Ga0207706_10026844
388 Ga0207686_10004305
389 Ga0207686_10020220
390 Ga0207669_10001412
391 Ga0207704_10015612
392 Ga0207691_10082700
393 Ga0207689_10001601
394 Ga0207689_10018725
395 Ga0207712_10014234
396 Ga0207640_10002907
397 Ga0207703_10003829
398 Ga0207703_10008710
399 Ga0207708_10017368
400 Ga0207708_10027675
401 Ga0207641_10054745
402 Ga0207648_10036840
403 Ga0207648_10054867
404 Ga0207676_10045640
405 Ga0207676_10055665
406 Ga0207675_100000796
407 Ga0207675_100022302
408 Ga0207675_100045211
409 Ga0207428_10000212
410 Ga0207428_10000512
411 Ga0207428_10001107
412 Ga0207428_10016986
413 Ga0207428_10071478
414 Ga0268266_10023609
415 Ga0268266_10031224
416 Ga0268265_10012043
417 Ga0268265_10025761
418 Ga0307413_10011957
419 Ga0307409_100023281
420 Ga0373948_0000989
421 Ga0373958_0000558
422 Ga0373938_0001125
423 Ga0373949_0001532
424 Ga0373951_0003521
425 Ga0373932_0000719
426 Ga0373941_0002082
427 Ga0373960_0000577
428 Ga0373937_0021869
429 Ga0451576_0006769
430 Ga0451576_0026188
431 Ga0495603_0013677
432 Ga0495629_0068959
433 Ga0495608_0021350
434 Ga0495628_0010401
435 Ga0495643_0003849
436 Ga0495645_0000774
437 Ga0495634_0064809
438 Ga0495658_0015704
439 Ga0495669_0018723
440 Ga0495613_0000598
441 Ga0495674_0088454
442 Ga0495684_0002960
443 Ga0496101_0001418
444 Ga0496104_0032393
445 Ga0496105_0021196
446 Ga0496112_0002012
447 Ga0496114_0000128
448 Ga0496114_0063459
449 Ga0501036_0057284
450 Ga0501036_0082419
451 Ga0501039_0088626
452 Ga0501040_0007984
453 Ga0501041_0002207
454 Ga0501042_0015217
455 Ga0501042_0018752
456 Ga0501042_0040322
457 Ga0501072_0011639
458 Ga0501072_0045707
459 Ga0501075_0000268
460 Ga0501075_0039423
461 Ga0501075_0043382
462 Ga0501076_0001484
463 Ga0501076_0002648
464 Ga0501076_0012653
465 Ga0501079_0007053
466 Ga0501080_0032434
467 Ga0501081_0003859
468 Ga0501081_0015012
469 Ga0501045_0018727
470 nmdc:mga05p37_10162_c1
471 nmdc:mga05p37_13156_c1
472 nmdc:mga05p37_17189_c1
473 nmdc:mga05p37_20722_c1
474 nmdc:mga09592_5409_c1
475 nmdc:mga0qj67_25622_c1
476 nmdc:mga08y16_10304_c1
477 nmdc:mga08y16_12_c1
478 nmdc:mga08y16_16079_c1
479 nmdc:mga08y16_1982_c1
480 nmdc:mga08y16_2138_c1
481 nmdc:mga08y16_46400_c1
482 nmdc:mga08y16_8307_c1
483 nmdc:mga0n895_38930_c1
484 nmdc:mga0n895_47664_c1
485 nmdc:mga0n895_650_c1
486 nmdc:mga0n895_66611_c1
487 nmdc:mga0rr50_10789_c1
488 nmdc:mga0rr50_1752_c1
489 nmdc:mga0rr50_8_c1
490 nmdc:mga08x19_15283_c1
491 Ga0495601_0009487
492 Ga0501084_0005139
493 Ga0590074_000024
494 Ga0501082_0001760
495 Ga0530510_0003453
496 Ga0530510_0004739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03739

LptF_LptG

Lipopolysaccharide export system permease LptF/LptG

7

362

0.97

PF03739

LptF_LptG

Lipopolysaccharide export system permease LptF/LptG

429

794

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s8n-assembly1.cif.gz_G cryo-em structure of lptb2fgc in complex with lipopolysaccharide 0.812 374 718
6mi7-assembly1.cif.gz_G nucleotide-free cryo-em structure of e.coli lptb2fgc 0.8013 374 716
6s8n-assembly1.cif.gz_G cryo-em structure of lptb2fgc in complex with lipopolysaccharide 0.7989 374 718
6s8h-assembly1.cif.gz_G cryo-em structure of lptb2fg in complex with lps 0.7982 373 716
6mit-assembly1.cif.gz_G lptbfgc from enterobacter cloacae 0.7935 373 718
ID Description Score Start End Superfamily
af_P32774_58_118_2.30.18.10 Mainly Beta;Roll;TATA box binding Protein, subunit D; domain 2;Transcription factor IIA (TFIIA), beta-barrel domain 0.7512 170 209 2.30.18.10
af_Q4D131_41_117_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.7285 161 208 2.30.30.100
3my2A00 Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain 0.6149 516 604 2.60.450.10
5gmke00 Mainly Beta;Roll;SH3 type barrels.; 0.5576 156 210 2.30.30.100
af_O74483_1_71_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.5415 158 207 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A7X7RVS6-F1-model_v4 LptF/LptG family permease 0.9339 370 507 GO:0015920
GO:0043190
AF-A0A3C1W1Q8-F1-model_v4 deleted 0.9147 373 507
AF-A0A356E3V0-F1-model_v4 Permease 0.9139 368 507 GO:0015920
GO:0043190
AF-A0A651FW52-F1-model_v4 LptF/LptG family permease 0.9054 372 507 GO:0015920
GO:0043190
AF-A0A382LY99-F1-model_v4 Permease YjgP/YjgQ family protein 0.8906 372 511 GO:0015920
GO:0043190

Map