F359746

General Info

Members Datasets Scaffolds Average Seq Length
248 146 496 238

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100277185|Ga0068852_1002771851
Length 233
Sequence MRKNIVAAIAVLFLLPAAFASATPETPASTGNSPYPKMAPLDRYLIADQNAEIKLARTAAPASISDGAEVMVLGRNGYTTALCLIERSWANPTNDAEFWNPSLRAPICFNRAAAETFVPIYLMKTKLVLAGKSPNDVFKATTLAFSTHQLPALAPGAMCYMMSKQQYLNDSGKSWHPHLMYFAPPGAEKSWGANLPGSPVIAADDPQERTXIXXVVVHKWSDGTPAPLEHAMK

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 1.21
Rhizosphere 91.53
Stem 0
Stem Tuber 0
Unclassified 20.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100277185 3300005616 Bacteria 1615
2 Ga0070683_100036792 3300005329 Bacteria 4480
3 Ga0070683_100067354 3300005329 Bacteria 3335
4 Ga0070670_100018967 3300005331 Bacteria 5899
5 Ga0068868_100002039 3300005338 Bacteria 13893
6 Ga0068868_100077556 3300005338 Bacteria 2658
7 Ga0070689_100228955 3300005340 Unclassified 1527
8 Ga0070714_100069135 3300005435 Bacteria 3049
9 Ga0070714_100204831 3300005435 Bacteria 1806
10 Ga0070714_100215768 3300005435 Bacteria 1761
11 Ga0070713_100089288 3300005436 Bacteria 2647
12 Ga0070713_100303177 3300005436 Bacteria 1471
13 Ga0070713_100639442 3300005436 Unclassified 1013
14 Ga0070713_100832506 3300005436 Bacteria 885
15 Ga0070711_100097684 3300005439 Bacteria 2130
16 Ga0070708_100323184 3300005445 Unclassified 1454
17 Ga0070681_10015690 3300005458 Bacteria 7548
18 Ga0070681_10056227 3300005458 Bacteria 3917
19 Ga0068867_100078257 3300005459 Unclassified 2487
20 Ga0070706_100513416 3300005467 Bacteria 1115
21 Ga0070707_100301499 3300005468 Unclassified 1557
22 Ga0070707_100306246 3300005468 Bacteria 1544
23 Ga0070698_100144266 3300005471 Bacteria 2331
24 Ga0070698_100501255 3300005471 Bacteria 1152
25 Ga0070679_100029546 3300005530 Bacteria 5409
26 Ga0070679_100114998 3300005530 Bacteria 2676
27 Ga0070679_100520238 3300005530 Unclassified 1134
28 Ga0070684_100032973 3300005535 Bacteria 4419
29 Ga0070684_100094077 3300005535 Bacteria 2669
30 Ga0070684_100465747 3300005535 Unclassified 1169
31 Ga0068853_100280407 3300005539 Bacteria 1536
32 Ga0068853_100308053 3300005539 Bacteria 1465
33 Ga0070696_100193325 3300005546 Unclassified 1515
34 Ga0068855_100004538 3300005563 Bacteria 16959
35 Ga0068855_100599442 3300005563 Unclassified 1188
36 Ga0070664_100163817 3300005564 Unclassified 1969
37 Ga0070664_100783023 3300005564 Bacteria 891
38 Ga0068857_100006777 3300005577 Bacteria 9857
39 Ga0068857_100409998 3300005577 Bacteria 1262
40 Ga0068854_100113962 3300005578 Unclassified 2043
41 Ga0068856_100015992 3300005614 Bacteria 7252
42 Ga0068856_100317277 3300005614 Bacteria 1576
43 Ga0068856_100371613 3300005614 Bacteria 1449
44 Ga0068856_100671272 3300005614 Unclassified 1057
45 Ga0068852_100862581 3300005616 Unclassified 921
46 Ga0068859_100034849 3300005617 Bacteria 5050
47 Ga0068866_10005594 3300005718 Bacteria 5198
48 Ga0068870_10116443 3300005840 Unclassified 1533
49 Ga0068863_100271280 3300005841 Unclassified 1642
50 Ga0068858_100032612 3300005842 Bacteria 4836
51 Ga0068860_100022931 3300005843 Bacteria 6037
52 Ga0070717_10018551 3300006028 Bacteria 5436
53 Ga0070717_10520452 3300006028 Bacteria 1076
54 Ga0070717_10810039 3300006028 Unclassified 852
55 Ga0070716_100058623 3300006173 Bacteria 2216
56 Ga0070712_100155647 3300006175 Unclassified 1760
57 Ga0070712_100229473 3300006175 Bacteria 1474
58 Ga0070712_100455887 3300006175 Bacteria 1065
59 Ga0097621_100013061 3300006237 Bacteria 6176
60 Ga0068871_100111159 3300006358 Unclassified 2305
61 Ga0075428_100489208 3300006844 Bacteria 1316
62 Ga0075433_10237815 3300006852 Bacteria 1617
63 Ga0075434_100074112 3300006871 Bacteria 3397
64 Ga0075434_100242915 3300006871 Bacteria 1820
65 Ga0075429_100044349 3300006880 Bacteria 3869
66 Ga0097620_100034850 3300006931 Bacteria 5050
67 Ga0075435_100038502 3300007076 Bacteria 3812
68 Ga0105240_10057047 3300009093 Bacteria 4883
69 Ga0105240_10057874 3300009093 Bacteria 4839
70 Ga0105240_10214787 3300009093 Bacteria 2245
71 Ga0105245_10044780 3300009098 Bacteria 3951
72 Ga0105245_10120365 3300009098 Unclassified 2452
73 Ga0105247_10110765 3300009101 Bacteria 1767
74 Ga0114129_10243753 3300009147 Bacteria 2415
75 Ga0105242_10559991 3300009176 Unclassified 1097
76 Ga0105248_10000006 3300009177 Bacteria 595060
77 Ga0105237_10061377 3300009545 Bacteria 3758
78 Ga0105237_10146392 3300009545 Unclassified 2357
79 Ga0105238_10119883 3300009551 Unclassified 2611
80 Ga0105238_10399982 3300009551 Bacteria 1367
81 Ga0105238_10975568 3300009551 Bacteria 868
82 Ga0105246_10053153 3300011119 Bacteria 2787
83 Ga0157373_10025403 3300013100 Bacteria 4285
84 Ga0157373_10265370 3300013100 Bacteria 1215
85 Ga0157370_10023388 3300013104 Bacteria 6134
86 Ga0157370_10125631 3300013104 Bacteria 2394
87 Ga0157370_10269784 3300013104 Unclassified 1572
88 Ga0157369_10002572 3300013105 Bacteria 21718
89 Ga0157369_10039690 3300013105 Bacteria 5143
90 Ga0157369_10126009 3300013105 Bacteria 2715
91 Ga0157369_10786657 3300013105 Unclassified 978
92 Ga0157374_10001091 3300013296 Bacteria 23359
93 Ga0157374_10109788 3300013296 Bacteria 2652
94 Ga0157374_10246165 3300013296 Bacteria 1759
95 Ga0157378_10000721 3300013297 Bacteria 30851
96 Ga0157378_10138793 3300013297 Bacteria 2256
97 Ga0157372_10001892 3300013307 Bacteria 22713
98 Ga0157372_10044298 3300013307 Bacteria 4930
99 Ga0157372_10049104 3300013307 Bacteria 4691
100 Ga0157372_10051676 3300013307 Bacteria 4574
101 Ga0157372_10058151 3300013307 Bacteria 4321
102 Ga0157372_10314967 3300013307 Bacteria 1822
103 Ga0163163_10134863 3300014325 Unclassified 2509
104 Ga0206353_10878928 3300020082 Unclassified 1901
105 Ga0213872_10001772 3300021361 Bacteria 13482
106 Ga0213872_10002536 3300021361 Bacteria 10640
107 Ga0213872_10007918 3300021361 Bacteria 5184
108 Ga0213875_10119537 3300021388 Bacteria 1231
109 Ga0207642_10050129 3300025899 Unclassified 1881
110 Ga0207685_10169883 3300025905 Bacteria 1003
111 Ga0207699_10125527 3300025906 Bacteria 1666
112 Ga0207699_10382351 3300025906 Bacteria 999
113 Ga0207643_10113026 3300025908 Bacteria 1602
114 Ga0207684_10055279 3300025910 Bacteria 3368
115 Ga0207707_10040208 3300025912 Bacteria 4084
116 Ga0207707_10053368 3300025912 Bacteria 3519
117 Ga0207695_10008507 3300025913 Bacteria 12831
118 Ga0207695_10174051 3300025913 Bacteria 2076
119 Ga0207695_10330441 3300025913 Unclassified 1413
120 Ga0207695_10376316 3300025913 Bacteria 1306
121 Ga0207671_10545783 3300025914 Unclassified 924
122 Ga0207693_10187451 3300025915 Bacteria 1628
123 Ga0207693_10466429 3300025915 Bacteria 986
124 Ga0207663_10132541 3300025916 Bacteria 1724
125 Ga0207660_10353332 3300025917 Bacteria 1178
126 Ga0207652_10054496 3300025921 Unclassified 3438
127 Ga0207652_10189984 3300025921 Bacteria 1847
128 Ga0207652_10349360 3300025921 Bacteria 1335
129 Ga0207652_10448524 3300025921 Unclassified 1163
130 Ga0207646_10393493 3300025922 Unclassified 1252
131 Ga0207687_10077090 3300025927 Unclassified 2396
132 Ga0207700_10164289 3300025928 Bacteria 1846
133 Ga0207700_10346934 3300025928 Bacteria 1292
134 Ga0207664_10091445 3300025929 Unclassified 2495
135 Ga0207664_10291869 3300025929 Bacteria 1433
136 Ga0207664_10418635 3300025929 Bacteria 1193
137 Ga0207664_10680814 3300025929 Bacteria 925
138 Ga0207664_10722226 3300025929 Bacteria 896
139 Ga0207665_10037396 3300025939 Bacteria 3231
140 Ga0207665_10079499 3300025939 Bacteria 2254
141 Ga0207665_10289042 3300025939 Bacteria 1222
142 Ga0207711_10000007 3300025941 Bacteria 759410
143 Ga0207661_10047664 3300025944 Bacteria 3402
144 Ga0207667_10027687 3300025949 Bacteria 6165
145 Ga0207667_10086046 3300025949 Bacteria 3254
146 Ga0207667_10611603 3300025949 Unclassified 1098
147 Ga0207640_10147196 3300025981 Unclassified 1725
148 Ga0207677_10151951 3300026023 Bacteria 1787
149 Ga0207703_10292610 3300026035 Unclassified 1482
150 Ga0207639_10282643 3300026041 Bacteria 1460
151 Ga0207639_10345692 3300026041 Bacteria 1327
152 Ga0207678_10333836 3300026067 Bacteria 1305
153 Ga0207702_10220971 3300026078 Unclassified 1765
154 Ga0207702_10449274 3300026078 Bacteria 1250
155 Ga0207702_10479636 3300026078 Unclassified 1210
156 Ga0207641_10645352 3300026088 Unclassified 1039
157 Ga0207648_10016533 3300026089 Bacteria 6738
158 Ga0207674_10002284 3300026116 Bacteria 24303
159 Ga0207674_10334933 3300026116 Bacteria 1463
160 Ga0268264_10045056 3300028381 Unclassified 3662
161 Ga0265338_10144059 3300028800 Bacteria 1862
162 Ga0265765_1003862 3300030879 Unclassified 1519
163 Ga0265325_10010035 3300031241 Bacteria 5502
164 Ga0265325_10011437 3300031241 Bacteria 5101
165 Ga0265325_10102582 3300031241 Bacteria 1399
166 Ga0265329_10111348 3300031242 Unclassified 875
167 Ga0265340_10055379 3300031247 Bacteria 1910
168 Ga0265340_10068172 3300031247 Bacteria 1690
169 Ga0265316_10032349 3300031344 Bacteria 4269
170 Ga0265316_10071764 3300031344 Bacteria 2669
171 Ga0265316_10145410 3300031344 Bacteria 1778
172 Ga0265342_10021819 3300031712 Bacteria 4082
173 Ga0373936_0025839 3300035113 Bacteria 2298
174 Ga0373945_0227073 3300035116 Unclassified 782
175 Ga0373943_0158723 3300035170 Bacteria 1230
176 Ga0373924_0109562 3300035410 Bacteria 1193
177 Ga0373935_0099891 3300035692 Bacteria 1911
178 Ga0373935_0314101 3300035692 Unclassified 1110
179 Ga0373927_0001769 3300035695 Bacteria 16123
180 Ga0373927_0007864 3300035695 Bacteria 7211
181 Ga0373947_0013336 3300035725 Bacteria 4709
182 Ga0373947_0129723 3300035725 Bacteria 1608
183 Ga0373937_0013594 3300036401 Bacteria 7172
184 Ga0373925_0000953 3300037068 Bacteria 26333
185 Ga0373925_0004593 3300037068 Bacteria 10431
186 Ga0373925_0035362 3300037068 Bacteria 3685
187 Ga0373925_0060918 3300037068 Bacteria 2834
188 Ga0395898_0079480 3300037466 Unclassified 3164
189 Ga0436364_0088220 3300037853 Unclassified 1496
190 Ga0436364_0169131 3300037853 Bacteria 4225
191 Ga0436364_0714352 3300037853 Bacteria 5046
192 Ga0436364_1218649 3300037853 Bacteria 2544
193 Ga0436364_1285733 3300037853 Bacteria 880
194 Ga0436365_0372006 3300039437 Bacteria 907
195 Ga0436365_1682398 3300039437 Unclassified 1034
196 Ga0436365_1740070 3300039437 Bacteria 1147
197 Ga0436360_0740647 3300039438 Bacteria 948
198 Ga0436361_0088245 3300039447 Bacteria 2791
199 Ga0436361_0353478 3300039447 Bacteria 2228
200 Ga0436361_0675473 3300039447 Bacteria 17719
201 Ga0436363_0186099 3300039450 Bacteria 2854
202 Ga0436363_0329360 3300039450 Bacteria 816
203 Ga0436363_0790918 3300039450 Bacteria 1144
204 Ga0436363_1550415 3300039450 Unclassified 1023
205 Ga0436363_1583838 3300039450 Bacteria 1030
206 Ga0436362_1130809 3300039453 Bacteria 1259
207 Ga0466963_0080220 3300044694 Bacteria 2209
208 Ga0466957_0211272 3300044842 Unclassified 1278
209 Ga0466967_0172874 3300045976 Bacteria 2034
210 Ga0495580_0001583 3300046472 Bacteria 19978
211 Ga0495580_0016043 3300046472 Bacteria 5632
212 Ga0495580_0042654 3300046472 Bacteria 3231
213 Ga0495580_0249329 3300046472 Bacteria 1216
214 Ga0495580_0327453 3300046472 Bacteria 1041
215 Ga0495582_0159844 3300046473 Bacteria 1281
216 Ga0495585_0074929 3300046492 Bacteria 1841
217 Ga0495594_0000945 3300046499 Bacteria 15065
218 Ga0495631_0034454 3300046518 Bacteria 2270
219 Ga0495644_0000012 3300046523 Bacteria 94927
220 Ga0495586_0435279 3300046535 Bacteria 756
221 Ga0495633_0018209 3300046558 Bacteria 3572
222 Ga0495625_0047355 3300046660 Bacteria 3100
223 Ga0495623_0012066 3300046679 Bacteria 5596
224 Ga0495669_0002276 3300046684 Bacteria 7877
225 Ga0495670_0070885 3300046691 Bacteria 1764
226 Ga0495589_0052112 3300046794 Bacteria 2022
227 Ga0495581_0036575 3300047315 Bacteria 2841
228 Ga0495674_0039420 3300047319 Bacteria 4235
229 Ga0495674_0060482 3300047319 Bacteria 3305
230 Ga0495674_0558140 3300047319 Unclassified 911
231 Ga0495675_0025357 3300047444 Bacteria 3780
232 Ga0495677_0091007 3300047445 Bacteria 1149
233 Ga0495673_0054690 3300047469 Bacteria 1735
234 Ga0495684_0072751 3300047471 Bacteria 2612
235 Ga0495684_0094335 3300047471 Bacteria 2266
236 Ga0495602_0113437 3300048088 Bacteria 2196
237 Ga0496100_1161678 3300048903 Bacteria 609
238 Ga0496112_0223897 3300048915 Bacteria 1837
239 Ga0496115_0039554 3300048918 Unclassified 3746
240 Ga0496120_0200074 3300048923 Bacteria 968
241 Ga0496126_0001093 3300048929 Bacteria 45526
242 Ga0496126_0001926 3300048929 Bacteria 29609
243 nmdc:mga05p37_256604_c1 3300050507 Bacteria 2095
244 nmdc:mga09592_37925_c1 3300050508 Bacteria 4044
245 nmdc:mga0n895_5134_c1 3300050512 Bacteria 10883
246 nmdc:mga0rr50_47740_c1 3300050513 Bacteria 3161
247 nmdc:mga0a205_257560_c1 3300050515 Bacteria 1623
248 Ga0500595_005890 3300053119 Bacteria 5279
249 Ga0068852_100277185
250 Ga0070683_100036792
251 Ga0070683_100067354
252 Ga0070670_100018967
253 Ga0068868_100002039
254 Ga0068868_100077556
255 Ga0070689_100228955
256 Ga0070714_100069135
257 Ga0070714_100204831
258 Ga0070714_100215768
259 Ga0070713_100089288
260 Ga0070713_100303177
261 Ga0070713_100639442
262 Ga0070713_100832506
263 Ga0070711_100097684
264 Ga0070708_100323184
265 Ga0070681_10015690
266 Ga0070681_10056227
267 Ga0068867_100078257
268 Ga0070706_100513416
269 Ga0070707_100301499
270 Ga0070707_100306246
271 Ga0070698_100144266
272 Ga0070698_100501255
273 Ga0070679_100029546
274 Ga0070679_100114998
275 Ga0070679_100520238
276 Ga0070684_100032973
277 Ga0070684_100094077
278 Ga0070684_100465747
279 Ga0068853_100280407
280 Ga0068853_100308053
281 Ga0070696_100193325
282 Ga0068855_100004538
283 Ga0068855_100599442
284 Ga0070664_100163817
285 Ga0070664_100783023
286 Ga0068857_100006777
287 Ga0068857_100409998
288 Ga0068854_100113962
289 Ga0068856_100015992
290 Ga0068856_100317277
291 Ga0068856_100371613
292 Ga0068856_100671272
293 Ga0068852_100862581
294 Ga0068859_100034849
295 Ga0068866_10005594
296 Ga0068870_10116443
297 Ga0068863_100271280
298 Ga0068858_100032612
299 Ga0068860_100022931
300 Ga0070717_10018551
301 Ga0070717_10520452
302 Ga0070717_10810039
303 Ga0070716_100058623
304 Ga0070712_100155647
305 Ga0070712_100229473
306 Ga0070712_100455887
307 Ga0097621_100013061
308 Ga0068871_100111159
309 Ga0075428_100489208
310 Ga0075433_10237815
311 Ga0075434_100074112
312 Ga0075434_100242915
313 Ga0075429_100044349
314 Ga0097620_100034850
315 Ga0075435_100038502
316 Ga0105240_10057047
317 Ga0105240_10057874
318 Ga0105240_10214787
319 Ga0105245_10044780
320 Ga0105245_10120365
321 Ga0105247_10110765
322 Ga0114129_10243753
323 Ga0105242_10559991
324 Ga0105248_10000006
325 Ga0105237_10061377
326 Ga0105237_10146392
327 Ga0105238_10119883
328 Ga0105238_10399982
329 Ga0105238_10975568
330 Ga0105246_10053153
331 Ga0157373_10025403
332 Ga0157373_10265370
333 Ga0157370_10023388
334 Ga0157370_10125631
335 Ga0157370_10269784
336 Ga0157369_10002572
337 Ga0157369_10039690
338 Ga0157369_10126009
339 Ga0157369_10786657
340 Ga0157374_10001091
341 Ga0157374_10109788
342 Ga0157374_10246165
343 Ga0157378_10000721
344 Ga0157378_10138793
345 Ga0157372_10001892
346 Ga0157372_10044298
347 Ga0157372_10049104
348 Ga0157372_10051676
349 Ga0157372_10058151
350 Ga0157372_10314967
351 Ga0163163_10134863
352 Ga0206353_10878928
353 Ga0213872_10001772
354 Ga0213872_10002536
355 Ga0213872_10007918
356 Ga0213875_10119537
357 Ga0207642_10050129
358 Ga0207685_10169883
359 Ga0207699_10125527
360 Ga0207699_10382351
361 Ga0207643_10113026
362 Ga0207684_10055279
363 Ga0207707_10040208
364 Ga0207707_10053368
365 Ga0207695_10008507
366 Ga0207695_10174051
367 Ga0207695_10330441
368 Ga0207695_10376316
369 Ga0207671_10545783
370 Ga0207693_10187451
371 Ga0207693_10466429
372 Ga0207663_10132541
373 Ga0207660_10353332
374 Ga0207652_10054496
375 Ga0207652_10189984
376 Ga0207652_10349360
377 Ga0207652_10448524
378 Ga0207646_10393493
379 Ga0207687_10077090
380 Ga0207700_10164289
381 Ga0207700_10346934
382 Ga0207664_10091445
383 Ga0207664_10291869
384 Ga0207664_10418635
385 Ga0207664_10680814
386 Ga0207664_10722226
387 Ga0207665_10037396
388 Ga0207665_10079499
389 Ga0207665_10289042
390 Ga0207711_10000007
391 Ga0207661_10047664
392 Ga0207667_10027687
393 Ga0207667_10086046
394 Ga0207667_10611603
395 Ga0207640_10147196
396 Ga0207677_10151951
397 Ga0207703_10292610
398 Ga0207639_10282643
399 Ga0207639_10345692
400 Ga0207678_10333836
401 Ga0207702_10220971
402 Ga0207702_10449274
403 Ga0207702_10479636
404 Ga0207641_10645352
405 Ga0207648_10016533
406 Ga0207674_10002284
407 Ga0207674_10334933
408 Ga0268264_10045056
409 Ga0265338_10144059
410 Ga0265765_1003862
411 Ga0265325_10010035
412 Ga0265325_10011437
413 Ga0265325_10102582
414 Ga0265329_10111348
415 Ga0265340_10055379
416 Ga0265340_10068172
417 Ga0265316_10032349
418 Ga0265316_10071764
419 Ga0265316_10145410
420 Ga0265342_10021819
421 Ga0373936_0025839
422 Ga0373945_0227073
423 Ga0373943_0158723
424 Ga0373924_0109562
425 Ga0373935_0099891
426 Ga0373935_0314101
427 Ga0373927_0001769
428 Ga0373927_0007864
429 Ga0373947_0013336
430 Ga0373947_0129723
431 Ga0373937_0013594
432 Ga0373925_0000953
433 Ga0373925_0004593
434 Ga0373925_0035362
435 Ga0373925_0060918
436 Ga0395898_0079480
437 Ga0436364_0088220
438 Ga0436364_0169131
439 Ga0436364_0714352
440 Ga0436364_1218649
441 Ga0436364_1285733
442 Ga0436365_0372006
443 Ga0436365_1682398
444 Ga0436365_1740070
445 Ga0436360_0740647
446 Ga0436361_0088245
447 Ga0436361_0353478
448 Ga0436361_0675473
449 Ga0436363_0186099
450 Ga0436363_0329360
451 Ga0436363_0790918
452 Ga0436363_1550415
453 Ga0436363_1583838
454 Ga0436362_1130809
455 Ga0466963_0080220
456 Ga0466957_0211272
457 Ga0466967_0172874
458 Ga0495580_0001583
459 Ga0495580_0016043
460 Ga0495580_0042654
461 Ga0495580_0249329
462 Ga0495580_0327453
463 Ga0495582_0159844
464 Ga0495585_0074929
465 Ga0495594_0000945
466 Ga0495631_0034454
467 Ga0495644_0000012
468 Ga0495586_0435279
469 Ga0495633_0018209
470 Ga0495625_0047355
471 Ga0495623_0012066
472 Ga0495669_0002276
473 Ga0495670_0070885
474 Ga0495589_0052112
475 Ga0495581_0036575
476 Ga0495674_0039420
477 Ga0495674_0060482
478 Ga0495674_0558140
479 Ga0495675_0025357
480 Ga0495677_0091007
481 Ga0495673_0054690
482 Ga0495684_0072751
483 Ga0495684_0094335
484 Ga0495602_0113437
485 Ga0496100_1161678
486 Ga0496112_0223897
487 Ga0496115_0039554
488 Ga0496120_0200074
489 Ga0496126_0001093
490 Ga0496126_0001926
491 nmdc:mga05p37_256604_c1
492 nmdc:mga09592_37925_c1
493 nmdc:mga0n895_5134_c1
494 nmdc:mga0rr50_47740_c1
495 nmdc:mga0a205_257560_c1
496 Ga0500595_005890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nj3-assembly1.cif.gz_F 1918 h1n1 viral influenza polymerase heterotrimer with nb8196 core 0.6845 198 221
7nil-assembly1.cif.gz_F 1918 h1n1 viral influenza polymerase heterotrimer with nb8190 core 0.6824 198 221
6itq-assembly1.cif.gz_B crystal structure of cortisol complexed with its nanobody at ph 10.5 0.6674 198 221
7te8-assembly2.cif.gz_B ca14-cbd-db21 ternary complex 0.6611 198 221
6ql6-assembly1.cif.gz_B structure of fatty acid synthase complex from saccharomyces cerevisiae at 2.9 angstrom 0.6156 185 224
ID Description Score Start End Superfamily
2uv9A07 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6264 185 223 3.30.70.2490
af_P32834_265_445_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.5979 204 224 2.40.70.10
af_Q9VZS0_60_247_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.5772 185 222 3.40.50.1000
af_D3ZRL1_14_105_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5592 198 221 2.60.40.10
af_X1WH23_265_467_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5541 182 224 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A5M8SNE3-F1-model_v4 Uncharacterized protein 0.9745 36 233
AF-A0A525L9F1-F1-model_v4 Uncharacterized protein 0.9727 44 230
AF-A0A5M8SNE3-F1-model_v4 Uncharacterized protein 0.9697 36 233
AF-A0A5M8T562-F1-model_v4 Uncharacterized protein 0.9649 24 236
AF-A0A369UPF8-F1-model_v4 Uncharacterized protein 0.9611 36 236

Map