F359373

General Info

Members Datasets Scaffolds Average Seq Length
247 172 494 123

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0017290|Ga0501032_0017290_2202_2627
Length 141
Sequence MRSATRRVMVEETPSGEEHAMAVTAFQDLPLADRDREWDGAAAEKRVRAWAKAQDEPNEKYRDAHVWYDADAKDNFTAYKLLIADVVGGRLEAVPRGVFAAAAVMQGSRGGVDLPQKDRDRVRSHLAKYYAKLDETPPWES

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
85 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
86 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
87 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
88 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
89 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
90 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
91 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
92 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
93 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
94 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
97 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
98 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
165 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
170 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
171 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
172 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.17
Metatranscriptomes 1.21
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 16.6
Rhizosphere 71.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0017290 3300049569 Bacteria 5064
2 LJQas_1023179 3300000549 Bacteria 721
3 Ga0070690_100662188 3300005330 Bacteria 798
4 Ga0070666_10209525 3300005335 Bacteria 1372
5 Ga0070682_100306346 3300005337 Bacteria 1168
6 Ga0070682_101565322 3300005337 Bacteria 569
7 Ga0068868_100373600 3300005338 Bacteria 1225
8 Ga0070671_100343077 3300005355 Bacteria 1274
9 Ga0070674_100177658 3300005356 Bacteria 1628
10 Ga0070688_101074006 3300005365 Bacteria 642
11 Ga0070659_101268680 3300005366 Bacteria 653
12 Ga0070709_10441739 3300005434 Bacteria 978
13 Ga0070710_10080873 3300005437 Bacteria 1896
14 Ga0070711_100163729 3300005439 Bacteria 1688
15 Ga0070711_100600084 3300005439 Bacteria 918
16 Ga0070696_100424736 3300005546 Bacteria 1044
17 Ga0070665_100640069 3300005548 Bacteria 1076
18 Ga0070704_100704231 3300005549 Bacteria 896
19 Ga0068864_100140188 3300005618 Bacteria 2180
20 Ga0068864_100862985 3300005618 Bacteria 892
21 Ga0068866_10475021 3300005718 Bacteria 822
22 Ga0068863_100075816 3300005841 Bacteria 3182
23 Ga0068858_100702651 3300005842 Bacteria 984
24 Ga0068860_102453115 3300005843 Bacteria 541
25 Ga0081455_10099091 3300005937 Bacteria 2345
26 Ga0081455_10202861 3300005937 Bacteria 1484
27 Ga0081455_10595408 3300005937 Bacteria 722
28 Ga0070716_100366830 3300006173 Bacteria 1025
29 Ga0097621_100099263 3300006237 Bacteria 2447
30 Ga0075370_10242682 3300006353 Bacteria 1067
31 Ga0075428_101049454 3300006844 Bacteria 862
32 Ga0075436_100817330 3300006914 Bacteria 694
33 Ga0105240_10889536 3300009093 Bacteria 959
34 Ga0105245_10063405 3300009098 Bacteria 3337
35 Ga0105245_10882771 3300009098 Bacteria 935
36 Ga0105247_10248647 3300009101 Bacteria 1214
37 Ga0105243_11337880 3300009148 Bacteria 735
38 Ga0105248_10135125 3300009177 Bacteria 2782
39 Ga0105248_10368169 3300009177 Bacteria 1618
40 Ga0105249_10592676 3300009553 Bacteria 1162
41 Ga0157370_10043623 3300013104 Bacteria 4315
42 Ga0157369_10086325 3300013105 Bacteria 3351
43 Ga0163162_11216803 3300013306 Bacteria 855
44 Ga0157375_11033744 3300013308 Bacteria 960
45 Ga0157375_11506366 3300013308 Bacteria 794
46 Ga0163163_11256295 3300014325 Bacteria 803
47 Ga0157380_11902024 3300014326 Bacteria 655
48 Ga0182008_10721529 3300014497 Bacteria 571
49 Ga0157377_11282838 3300014745 Bacteria 571
50 Ga0163161_11022433 3300017792 Bacteria 706
51 Ga0206350_10461251 3300020080 Bacteria 867
52 Ga0213875_10013100 3300021388 Bacteria 4079
53 Ga0224712_10070204 3300022467 Bacteria 1420
54 Ga0224712_10384648 3300022467 Bacteria 667
55 Ga0207692_10068895 3300025898 Bacteria 1857
56 Ga0207680_10234002 3300025903 Bacteria 1263
57 Ga0207695_10909993 3300025913 Bacteria 759
58 Ga0207693_10026163 3300025915 Bacteria 4619
59 Ga0207664_10529650 3300025929 Bacteria 1056
60 Ga0207644_10787262 3300025931 Bacteria 795
61 Ga0207709_10188412 3300025935 Bacteria 1463
62 Ga0207669_10560837 3300025937 Bacteria 923
63 Ga0207669_11326065 3300025937 Bacteria 612
64 Ga0207665_10390538 3300025939 Bacteria 1058
65 Ga0207691_10530990 3300025940 Bacteria 998
66 Ga0207711_10493919 3300025941 Bacteria 1140
67 Ga0207661_10100058 3300025944 Bacteria 2433
68 Ga0207712_10202428 3300025961 Bacteria 1575
69 Ga0207677_12164650 3300026023 Bacteria 517
70 Ga0207703_11664451 3300026035 Bacteria 614
71 Ga0207641_10429655 3300026088 Bacteria 1273
72 Ga0207683_10950864 3300026121 Bacteria 798
73 Ga0207698_11201794 3300026142 Bacteria 772
74 Ga0268266_10732146 3300028379 Bacteria 954
75 Ga0307408_100326393 3300031548 Bacteria 1295
76 Ga0307408_100458074 3300031548 Bacteria 1108
77 Ga0307405_10335454 3300031731 Bacteria 1160
78 Ga0307405_10790314 3300031731 Bacteria 794
79 Ga0307406_11417249 3300031901 Bacteria 609
80 Ga0307407_10169088 3300031903 Bacteria 1438
81 Ga0307407_10279421 3300031903 Bacteria 1156
82 Ga0307412_10858747 3300031911 Bacteria 792
83 Ga0307412_10866522 3300031911 Bacteria 789
84 Ga0307409_100002663 3300031995 Bacteria 9402
85 Ga0307409_100267041 3300031995 Bacteria 1574
86 Ga0307409_100670515 3300031995 Bacteria 1033
87 Ga0307409_100689297 3300031995 Bacteria 1020
88 Ga0307416_100001009 3300032002 Bacteria 14922
89 Ga0307416_101697222 3300032002 Bacteria 736
90 Ga0307416_101912022 3300032002 Bacteria 697
91 Ga0307414_11167759 3300032004 Bacteria 712
92 Ga0307411_10561064 3300032005 Bacteria 976
93 Ga0307411_11905837 3300032005 Bacteria 553
94 Ga0307415_100000866 3300032126 Bacteria 13842
95 Ga0307415_100277458 3300032126 Bacteria 1376
96 Ga0307415_100378028 3300032126 Bacteria 1202
97 Ga0373953_0096171 3300035117 Bacteria 1243
98 Ga0373954_0526699 3300035118 Bacteria 586
99 Ga0373943_0327795 3300035170 Bacteria 874
100 Ga0373931_0186406 3300035691 Bacteria 1232
101 Ga0373933_0209926 3300035724 Bacteria 1247
102 Ga0373947_0483648 3300035725 Bacteria 840
103 Ga0373937_1042189 3300036401 Bacteria 767
104 Ga0373937_1770476 3300036401 Bacteria 564
105 Ga0373925_0007438 3300037068 Bacteria 7990
106 Ga0373925_0559992 3300037068 Bacteria 940
107 Ga0373925_0869629 3300037068 Bacteria 743
108 Ga0436364_1129594 3300037853 Bacteria 3100
109 Ga0436364_1222714 3300037853 Bacteria 7373
110 Ga0451789_0354231 3300041443 Bacteria 1850
111 Ga0451791_0181731 3300041451 Bacteria 1370
112 Ga0451793_0820578 3300041452 Bacteria 831
113 Ga0451795_1049983 3300041456 Bacteria 548
114 Ga0451802_0960404 3300041460 Bacteria 739
115 Ga0451833_0751507 3300041491 Bacteria 664
116 Ga0451839_0849046 3300041496 Bacteria 837
117 Ga0451841_0464634 3300041498 Bacteria 598
118 Ga0451841_0587828 3300041498 Bacteria 2463
119 Ga0451849_0786288 3300041505 Bacteria 678
120 Ga0451851_0319498 3300041507 Bacteria 919
121 Ga0451843_0180638 3300041509 Bacteria 788
122 Ga0451853_0170198 3300041512 Bacteria 3336
123 Ga0451853_2490836 3300041512 Bacteria 1311
124 Ga0439448_0018919 3300042005 Bacteria 2116
125 Ga0439450_010824 3300042008 Bacteria 1770
126 Ga0450900_062481 3300042136 Bacteria 583
127 Ga0466965_0007053 3300044683 Bacteria 5142
128 Ga0466961_0092539 3300044693 Bacteria 1908
129 Ga0466963_0129234 3300044694 Bacteria 1744
130 Ga0466963_0357450 3300044694 Bacteria 1029
131 Ga0466970_0001885 3300044765 Bacteria 10139
132 Ga0466957_0056410 3300044842 Bacteria 2402
133 Ga0466958_0455093 3300045836 Bacteria 829
134 Ga0466958_0863996 3300045836 Bacteria 590
135 Ga0466967_0644778 3300045976 Bacteria 1047
136 Ga0495638_0071965 3300046460 Bacteria 2114
137 Ga0495608_0909894 3300046511 Bacteria 515
138 Ga0495600_0657263 3300046809 Bacteria 633
139 Ga0495676_0841488 3300047321 Bacteria 589
140 Ga0495680_0442657 3300047322 Bacteria 891
141 Ga0495675_0042408 3300047444 Bacteria 2899
142 Ga0495593_0248682 3300047673 Bacteria 890
143 Ga0495602_0210794 3300048088 Bacteria 1475
144 Ga0496100_0002367 3300048903 Bacteria 9542
145 Ga0496100_0020813 3300048903 Bacteria 3940
146 Ga0496100_1465981 3300048903 Bacteria 539
147 Ga0496101_0000404 3300048904 Bacteria 28116
148 Ga0496101_0001714 3300048904 Bacteria 13127
149 Ga0496101_0194020 3300048904 Bacteria 1568
150 Ga0496101_0273875 3300048904 Bacteria 1318
151 Ga0496102_0002641 3300048905 Bacteria 15224
152 Ga0496102_0125018 3300048905 Bacteria 2404
153 Ga0496102_0129718 3300048905 Bacteria 2359
154 Ga0496102_0244171 3300048905 Bacteria 1693
155 Ga0496103_0000847 3300048906 Bacteria 22384
156 Ga0496103_0296109 3300048906 Bacteria 1041
157 Ga0496104_0000702 3300048907 Bacteria 28778
158 Ga0496104_0020247 3300048907 Bacteria 6097
159 Ga0496104_0805086 3300048907 Bacteria 846
160 Ga0496105_0026602 3300048908 Bacteria 4721
161 Ga0496105_0042925 3300048908 Bacteria 3729
162 Ga0496105_0291085 3300048908 Bacteria 1315
163 Ga0496106_0016825 3300048909 Bacteria 5410
164 Ga0496107_0190079 3300048910 Bacteria 1525
165 Ga0496108_0129905 3300048911 Bacteria 2166
166 Ga0496108_0687498 3300048911 Bacteria 888
167 Ga0496109_0167569 3300048912 Bacteria 2060
168 Ga0496109_0236013 3300048912 Bacteria 1721
169 Ga0496109_1029575 3300048912 Bacteria 761
170 Ga0496110_0321876 3300048913 Bacteria 1409
171 Ga0496111_0199272 3300048914 Bacteria 1488
172 Ga0496111_0213717 3300048914 Bacteria 1433
173 Ga0496112_0048146 3300048915 Bacteria 4180
174 Ga0496113_0019129 3300048916 Bacteria 4785
175 Ga0496114_0003123 3300048917 Bacteria 12707
176 Ga0496114_0172340 3300048917 Bacteria 1886
177 Ga0496114_0346650 3300048917 Bacteria 1313
178 Ga0496114_0472918 3300048917 Bacteria 1109
179 Ga0496115_0039722 3300048918 Bacteria 3738
180 Ga0496119_0105729 3300048922 Bacteria 1572
181 Ga0496122_0003629 3300048925 Bacteria 20074
182 Ga0496123_0026102 3300048926 Bacteria 4387
183 Ga0496124_0082888 3300048927 Bacteria 2632
184 Ga0496124_0279398 3300048927 Bacteria 1218
185 Ga0496124_0515434 3300048927 Bacteria 798
186 Ga0496126_0017393 3300048929 Bacteria 7162
187 Ga0496126_0023025 3300048929 Bacteria 6042
188 Ga0496126_1238459 3300048929 Bacteria 547
189 Ga0501031_0160750 3300049568 Bacteria 1468
190 Ga0501032_0009937 3300049569 Bacteria 6871
191 Ga0501033_0490823 3300049570 Bacteria 850
192 Ga0501033_0860203 3300049570 Bacteria 611
193 Ga0501034_0016466 3300049571 Bacteria 7587
194 Ga0501034_0040094 3300049571 Bacteria 4742
195 Ga0501034_0687384 3300049571 Bacteria 922
196 Ga0501036_0065988 3300049572 Bacteria 3062
197 Ga0501036_0294764 3300049572 Bacteria 1357
198 Ga0501037_0000299 3300049573 Bacteria 41921
199 Ga0501037_0110903 3300049573 Bacteria 1977
200 Ga0501037_0142788 3300049573 Bacteria 1713
201 Ga0501038_0001253 3300049574 Bacteria 23031
202 Ga0501038_0014907 3300049574 Bacteria 7077
203 Ga0501038_0566873 3300049574 Bacteria 862
204 Ga0501039_0015226 3300049575 Bacteria 5886
205 Ga0501040_1048778 3300049576 Bacteria 591
206 Ga0501043_0000565 3300049579 Bacteria 33122
207 Ga0501046_0117405 3300049580 Bacteria 2027
208 Ga0501047_0671083 3300049581 Bacteria 855
209 Ga0501067_0005676 3300049583 Bacteria 6928
210 Ga0501067_0180188 3300049583 Bacteria 1177
211 Ga0501067_0230228 3300049583 Bacteria 1031
212 Ga0501068_0007563 3300049584 Bacteria 6014
213 Ga0501069_0421625 3300049585 Bacteria 791
214 Ga0501069_0621519 3300049585 Bacteria 649
215 Ga0501070_0000259 3300049586 Bacteria 50030
216 Ga0501070_0078778 3300049586 Bacteria 2726
217 Ga0501071_0308460 3300049587 Bacteria 1201
218 Ga0501071_0487115 3300049587 Bacteria 945
219 Ga0501073_0004325 3300049589 Bacteria 10662
220 Ga0501073_0067463 3300049589 Bacteria 2494
221 Ga0501073_0838593 3300049589 Bacteria 633
222 Ga0501074_0032067 3300049590 Bacteria 3808
223 Ga0501079_0025924 3300049741 Bacteria 4497
224 Ga0501080_0024981 3300049742 Bacteria 5542
225 Ga0501083_0017933 3300049744 Bacteria 4937
226 Ga0501035_0091922 3300049822 Bacteria 2670
227 Ga0501035_0779677 3300049822 Bacteria 765
228 Ga0501044_0004792 3300049823 Bacteria 15135
229 Ga0501044_0110640 3300049823 Bacteria 2755
230 Ga0501044_0447419 3300049823 Bacteria 1199
231 Ga0501045_0331855 3300049824 Bacteria 1132
232 Ga0501212_060081 3300049851 Bacteria 657
233 nmdc:mga07m45_224729_c1 3300050496 Bacteria 1092
234 nmdc:mga0n895_670875_c1 3300050512 Bacteria 1034
235 nmdc:mga0rr50_673862_c1 3300050513 Bacteria 882
236 Ga0495619_1001248 3300053085 Bacteria 559
237 Ga0500589_357284 3300053147 Bacteria 500
238 Ga0500604_0038885 3300053151 Bacteria 1429
239 Ga0500616_0001767 3300053153 Bacteria 19753
240 Ga0501084_0056791 3300054114 Bacteria 3275
241 Ga0501084_0387891 3300054114 Bacteria 1180
242 Ga0501082_0132726 3300060353 Bacteria 2160
243 Ga0501082_0291207 3300060353 Bacteria 1421
244 2644504535 2643221690 Bacteria 4654705
245 2644523980 2643221694 Bacteria 4392972
246 2644668077 2643221722 Bacteria 4247614
247 2884997310 2884994152 Bacteria 4492978
248 Ga0501032_0017290
249 LJQas_1023179
250 Ga0070690_100662188
251 Ga0070666_10209525
252 Ga0070682_100306346
253 Ga0070682_101565322
254 Ga0068868_100373600
255 Ga0070671_100343077
256 Ga0070674_100177658
257 Ga0070688_101074006
258 Ga0070659_101268680
259 Ga0070709_10441739
260 Ga0070710_10080873
261 Ga0070711_100163729
262 Ga0070711_100600084
263 Ga0070696_100424736
264 Ga0070665_100640069
265 Ga0070704_100704231
266 Ga0068864_100140188
267 Ga0068864_100862985
268 Ga0068866_10475021
269 Ga0068863_100075816
270 Ga0068858_100702651
271 Ga0068860_102453115
272 Ga0081455_10099091
273 Ga0081455_10202861
274 Ga0081455_10595408
275 Ga0070716_100366830
276 Ga0097621_100099263
277 Ga0075370_10242682
278 Ga0075428_101049454
279 Ga0075436_100817330
280 Ga0105240_10889536
281 Ga0105245_10063405
282 Ga0105245_10882771
283 Ga0105247_10248647
284 Ga0105243_11337880
285 Ga0105248_10135125
286 Ga0105248_10368169
287 Ga0105249_10592676
288 Ga0157370_10043623
289 Ga0157369_10086325
290 Ga0163162_11216803
291 Ga0157375_11033744
292 Ga0157375_11506366
293 Ga0163163_11256295
294 Ga0157380_11902024
295 Ga0182008_10721529
296 Ga0157377_11282838
297 Ga0163161_11022433
298 Ga0206350_10461251
299 Ga0213875_10013100
300 Ga0224712_10070204
301 Ga0224712_10384648
302 Ga0207692_10068895
303 Ga0207680_10234002
304 Ga0207695_10909993
305 Ga0207693_10026163
306 Ga0207664_10529650
307 Ga0207644_10787262
308 Ga0207709_10188412
309 Ga0207669_10560837
310 Ga0207669_11326065
311 Ga0207665_10390538
312 Ga0207691_10530990
313 Ga0207711_10493919
314 Ga0207661_10100058
315 Ga0207712_10202428
316 Ga0207677_12164650
317 Ga0207703_11664451
318 Ga0207641_10429655
319 Ga0207683_10950864
320 Ga0207698_11201794
321 Ga0268266_10732146
322 Ga0307408_100326393
323 Ga0307408_100458074
324 Ga0307405_10335454
325 Ga0307405_10790314
326 Ga0307406_11417249
327 Ga0307407_10169088
328 Ga0307407_10279421
329 Ga0307412_10858747
330 Ga0307412_10866522
331 Ga0307409_100002663
332 Ga0307409_100267041
333 Ga0307409_100670515
334 Ga0307409_100689297
335 Ga0307416_100001009
336 Ga0307416_101697222
337 Ga0307416_101912022
338 Ga0307414_11167759
339 Ga0307411_10561064
340 Ga0307411_11905837
341 Ga0307415_100000866
342 Ga0307415_100277458
343 Ga0307415_100378028
344 Ga0373953_0096171
345 Ga0373954_0526699
346 Ga0373943_0327795
347 Ga0373931_0186406
348 Ga0373933_0209926
349 Ga0373947_0483648
350 Ga0373937_1042189
351 Ga0373937_1770476
352 Ga0373925_0007438
353 Ga0373925_0559992
354 Ga0373925_0869629
355 Ga0436364_1129594
356 Ga0436364_1222714
357 Ga0451789_0354231
358 Ga0451791_0181731
359 Ga0451793_0820578
360 Ga0451795_1049983
361 Ga0451802_0960404
362 Ga0451833_0751507
363 Ga0451839_0849046
364 Ga0451841_0464634
365 Ga0451841_0587828
366 Ga0451849_0786288
367 Ga0451851_0319498
368 Ga0451843_0180638
369 Ga0451853_0170198
370 Ga0451853_2490836
371 Ga0439448_0018919
372 Ga0439450_010824
373 Ga0450900_062481
374 Ga0466965_0007053
375 Ga0466961_0092539
376 Ga0466963_0129234
377 Ga0466963_0357450
378 Ga0466970_0001885
379 Ga0466957_0056410
380 Ga0466958_0455093
381 Ga0466958_0863996
382 Ga0466967_0644778
383 Ga0495638_0071965
384 Ga0495608_0909894
385 Ga0495600_0657263
386 Ga0495676_0841488
387 Ga0495680_0442657
388 Ga0495675_0042408
389 Ga0495593_0248682
390 Ga0495602_0210794
391 Ga0496100_0002367
392 Ga0496100_0020813
393 Ga0496100_1465981
394 Ga0496101_0000404
395 Ga0496101_0001714
396 Ga0496101_0194020
397 Ga0496101_0273875
398 Ga0496102_0002641
399 Ga0496102_0125018
400 Ga0496102_0129718
401 Ga0496102_0244171
402 Ga0496103_0000847
403 Ga0496103_0296109
404 Ga0496104_0000702
405 Ga0496104_0020247
406 Ga0496104_0805086
407 Ga0496105_0026602
408 Ga0496105_0042925
409 Ga0496105_0291085
410 Ga0496106_0016825
411 Ga0496107_0190079
412 Ga0496108_0129905
413 Ga0496108_0687498
414 Ga0496109_0167569
415 Ga0496109_0236013
416 Ga0496109_1029575
417 Ga0496110_0321876
418 Ga0496111_0199272
419 Ga0496111_0213717
420 Ga0496112_0048146
421 Ga0496113_0019129
422 Ga0496114_0003123
423 Ga0496114_0172340
424 Ga0496114_0346650
425 Ga0496114_0472918
426 Ga0496115_0039722
427 Ga0496119_0105729
428 Ga0496122_0003629
429 Ga0496123_0026102
430 Ga0496124_0082888
431 Ga0496124_0279398
432 Ga0496124_0515434
433 Ga0496126_0017393
434 Ga0496126_0023025
435 Ga0496126_1238459
436 Ga0501031_0160750
437 Ga0501032_0009937
438 Ga0501033_0490823
439 Ga0501033_0860203
440 Ga0501034_0016466
441 Ga0501034_0040094
442 Ga0501034_0687384
443 Ga0501036_0065988
444 Ga0501036_0294764
445 Ga0501037_0000299
446 Ga0501037_0110903
447 Ga0501037_0142788
448 Ga0501038_0001253
449 Ga0501038_0014907
450 Ga0501038_0566873
451 Ga0501039_0015226
452 Ga0501040_1048778
453 Ga0501043_0000565
454 Ga0501046_0117405
455 Ga0501047_0671083
456 Ga0501067_0005676
457 Ga0501067_0180188
458 Ga0501067_0230228
459 Ga0501068_0007563
460 Ga0501069_0421625
461 Ga0501069_0621519
462 Ga0501070_0000259
463 Ga0501070_0078778
464 Ga0501071_0308460
465 Ga0501071_0487115
466 Ga0501073_0004325
467 Ga0501073_0067463
468 Ga0501073_0838593
469 Ga0501074_0032067
470 Ga0501079_0025924
471 Ga0501080_0024981
472 Ga0501083_0017933
473 Ga0501035_0091922
474 Ga0501035_0779677
475 Ga0501044_0004792
476 Ga0501044_0110640
477 Ga0501044_0447419
478 Ga0501045_0331855
479 Ga0501212_060081
480 nmdc:mga07m45_224729_c1
481 nmdc:mga0n895_670875_c1
482 nmdc:mga0rr50_673862_c1
483 Ga0495619_1001248
484 Ga0500589_357284
485 Ga0500604_0038885
486 Ga0500616_0001767
487 Ga0501084_0056791
488 Ga0501084_0387891
489 Ga0501082_0132726
490 Ga0501082_0291207
491 2644504535
492 2644523980
493 2644668077
494 2884997310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wb4-assembly1.cif.gz_L cryo-em structure of the nr subunit from x. laevis npc 0.6915 76 111
5ep8-assembly1.cif.gz_B x-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis with sulfate ion 0.6487 88 116
5x87-assembly1.cif.gz_D crystal structure of a bacterial bestrophin homolog from klebsiella pneumoniae with a mutation l177t 0.6162 75 114
6iv3-assembly1.cif.gz_D crystal structure of a bacterial bestrophin homolog from klebsiella pneumoniae with a mutation w252a 0.6136 74 114
6ivo-assembly1.cif.gz_C crystal structure of a membrane protein p208a 0.6104 76 114
ID Description Score Start End Superfamily
af_O13644_34_273_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7319 76 113 1.20.58.70
af_A0A1D6GFA6_147_272_1.20.58.1210 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Exo84p, N-terminal helical domain 0.7111 76 113 1.20.58.1210
af_A0A0R4IFN9_1411_1532_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.7056 76 112 1.20.120.350
af_I1M6L1_1_137_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7038 76 114 1.20.58.70
3zdmB00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.6914 78 117 1.20.5.420
ID Description Score Start End GO Terms
AF-A0A1F5QSZ1-F1-model_v4 Uncharacterized protein 0.9842 8 113
AF-A0A1I3K9G5-F1-model_v4 Uncharacterized protein 0.9753 2 121
AF-A0A5M3WAZ9-F1-model_v4 Uncharacterized protein 0.9716 2 121
AF-A0A2W4NJ42-F1-model_v4 Uncharacterized protein 0.9678 71 120
AF-A0A1H6EZK4-F1-model_v4 Uncharacterized protein 0.9671 1 121

Map