F359314

General Info

Members Datasets Scaffolds Average Seq Length
247 177 494 274

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0014418|Ga0495656_0014418_1808_2812
Length 334
Sequence MEHRQQRIAPRRYSSKPDSPSRRWGSNAGRSQAFGFRPNPSPSLSPPMPEGDTIHRAAATLQRAIGGQIVTRFESVLPKLTRVDADAPMRGRTVDRVEARGKHLLIWFSGDLVLRTHMRMNGSWHIYRPGERWQRPHRDMRIVIETAAMHAVAFTVPVAEFVTSHELANHDVIAELGPDPLSDNFNAEEAIERMQAHGDVEIADVLLDQTVIAGIGNVYKSEVLFGARINPFVRVAALTRDQLAEIVAVGMRFMRANVVSGFSRTGAGASASGGIVTYAGLRRTTGRADPSARLWVYGRGGQPCRRCGAPISRRKQGPFARSTYWCEQCQQEPC

Samples

Sample ID Description Type Environment
1 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
121 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
175 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 97.98
Stem 0
Stem Tuber 0
Unclassified 17.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495656_0014418 3300046615 Bacteria 2963
2 rootH1_10010212 3300003323 Bacteria 6665
3 Ga0065712_10000198 3300005290 Bacteria 23246
4 Ga0065707_10014136 3300005295 Bacteria 2900
5 Ga0070658_10052919 3300005327 Unclassified 3294
6 Ga0070658_10102345 3300005327 Bacteria 2369
7 Ga0070683_100126885 3300005329 Unclassified 2412
8 Ga0070690_100094976 3300005330 Unclassified 1968
9 Ga0070666_10149091 3300005335 Bacteria 1632
10 Ga0070680_100472697 3300005336 Unclassified 1071
11 Ga0070689_100002704 3300005340 Bacteria 11609
12 Ga0070692_10036039 3300005345 Unclassified 2509
13 Ga0070692_10044628 3300005345 Unclassified 2284
14 Ga0070669_100007309 3300005353 Bacteria 7921
15 Ga0070675_100009974 3300005354 Bacteria 7407
16 Ga0070675_100020266 3300005354 Bacteria 5305
17 Ga0070675_100022613 3300005354 Bacteria 5024
18 Ga0070675_100076119 3300005354 Bacteria 2791
19 Ga0070674_100410214 3300005356 Bacteria 1109
20 Ga0070673_100009580 3300005364 Bacteria 6509
21 Ga0070688_100028588 3300005365 Bacteria 3330
22 Ga0070688_100036436 3300005365 Bacteria 2992
23 Ga0070688_100066315 3300005365 Bacteria 2297
24 Ga0070659_100214170 3300005366 Bacteria 1588
25 Ga0070709_10017201 3300005434 Unclassified 4142
26 Ga0070709_10172990 3300005434 Bacteria 1511
27 Ga0070713_100038193 3300005436 Unclassified 3888
28 Ga0070713_100110318 3300005436 Bacteria 2398
29 Ga0070713_100480856 3300005436 Bacteria 1170
30 Ga0070701_10004292 3300005438 Bacteria 5752
31 Ga0070711_100084933 3300005439 Bacteria 2265
32 Ga0070711_100514276 3300005439 Bacteria 989
33 Ga0070705_100000680 3300005440 Bacteria 19483
34 Ga0070705_100010820 3300005440 Bacteria 4580
35 Ga0070700_100100585 3300005441 Bacteria 1904
36 Ga0070700_100123374 3300005441 Bacteria 1739
37 Ga0070694_100008607 3300005444 Bacteria 6248
38 Ga0070694_100056752 3300005444 Bacteria 2660
39 Ga0068867_100001721 3300005459 Bacteria 15245
40 Ga0068867_100293665 3300005459 Bacteria 1337
41 Ga0070685_10065588 3300005466 Unclassified 2137
42 Ga0070706_100042847 3300005467 Bacteria 4182
43 Ga0070707_100015308 3300005468 Bacteria 7196
44 Ga0070699_100024355 3300005518 Bacteria 5216
45 Ga0070684_100143440 3300005535 Bacteria 2161
46 Ga0070684_100595992 3300005535 Unclassified 1027
47 Ga0070697_100521113 3300005536 Bacteria 1041
48 Ga0070672_100187864 3300005543 Bacteria 1724
49 Ga0070672_100450847 3300005543 Bacteria 1108
50 Ga0070695_100000031 3300005545 Bacteria 53175
51 Ga0070695_100115103 3300005545 Bacteria 1832
52 Ga0070695_100220237 3300005545 Bacteria 1367
53 Ga0070696_100045705 3300005546 Bacteria 3034
54 Ga0070704_100004539 3300005549 Bacteria 8020
55 Ga0070704_100347061 3300005549 Bacteria 1252
56 Ga0070704_100668779 3300005549 Bacteria 918
57 Ga0070664_100041614 3300005564 Bacteria 3878
58 Ga0068857_100017249 3300005577 Bacteria 6326
59 Ga0068857_100403983 3300005577 Unclassified 1271
60 Ga0068852_100360477 3300005616 Bacteria 1422
61 Ga0068859_100004016 3300005617 Bacteria 14998
62 Ga0068859_100199204 3300005617 Unclassified 2087
63 Ga0068864_100014902 3300005618 Bacteria 6458
64 Ga0068861_100012353 3300005719 Bacteria 5954
65 Ga0068870_10035931 3300005840 Bacteria 2546
66 Ga0068863_100197014 3300005841 Unclassified 1936
67 Ga0068862_100046232 3300005844 Bacteria 3714
68 Ga0081539_10026320 3300005985 Bacteria 3715
69 Ga0070717_10141010 3300006028 Bacteria 2079
70 Ga0070717_10181512 3300006028 Bacteria 1835
71 Ga0070716_100001911 3300006173 Bacteria 9469
72 Ga0070712_100046699 3300006175 Bacteria 2995
73 Ga0075428_100012214 3300006844 Bacteria 9549
74 Ga0075428_100201193 3300006844 Unclassified 2153
75 Ga0075431_100179585 3300006847 Bacteria 2172
76 Ga0075431_100439710 3300006847 Unclassified 1301
77 Ga0075433_10132908 3300006852 Bacteria 2211
78 Ga0075434_100002465 3300006871 Bacteria 16285
79 Ga0075434_100094813 3300006871 Bacteria 2989
80 Ga0075429_100015079 3300006880 Bacteria 6697
81 Ga0075429_100060777 3300006880 Bacteria 3290
82 Ga0075429_100383961 3300006880 Unclassified 1230
83 Ga0097620_100004016 3300006931 Bacteria 14998
84 Ga0097620_100199199 3300006931 Unclassified 2087
85 Ga0105240_10045345 3300009093 Bacteria 5578
86 Ga0111539_10002116 3300009094 Bacteria 26536
87 Ga0111539_10005018 3300009094 Bacteria 17210
88 Ga0111539_10028189 3300009094 Bacteria 6855
89 Ga0111539_10088367 3300009094 Bacteria 3641
90 Ga0111539_10192807 3300009094 Unclassified 2377
91 Ga0111539_10235299 3300009094 Bacteria 2133
92 Ga0114129_10026157 3300009147 Bacteria 8264
93 Ga0114129_10077264 3300009147 Bacteria 4632
94 Ga0114129_10324169 3300009147 Bacteria 2047
95 Ga0105243_10099249 3300009148 Bacteria 2413
96 Ga0105243_10217486 3300009148 Bacteria 1686
97 Ga0105248_10544774 3300009177 Unclassified 1309
98 Ga0105237_10206399 3300009545 Unclassified 1965
99 Ga0105249_10295116 3300009553 Bacteria 1624
100 Ga0105239_10423272 3300010375 Bacteria 1509
101 Ga0157370_10113196 3300013104 Unclassified 2536
102 Ga0157374_10070226 3300013296 Bacteria 3299
103 Ga0163162_10603710 3300013306 Bacteria 1223
104 Ga0157375_10008719 3300013308 Bacteria 8884
105 Ga0163163_10071376 3300014325 Bacteria 3460
106 Ga0163163_10387668 3300014325 Unclassified 1455
107 Ga0157380_10195171 3300014326 Bacteria 1791
108 Ga0157377_10040293 3300014745 Bacteria 2586
109 Ga0157377_10158698 3300014745 Bacteria 1405
110 Ga0157379_10190801 3300014968 Bacteria 1852
111 Ga0213875_10000015 3300021388 Bacteria 280499
112 Ga0207692_10031371 3300025898 Bacteria 2545
113 Ga0207699_10013932 3300025906 Unclassified 4131
114 Ga0207645_10010676 3300025907 Bacteria 6299
115 Ga0207643_10085120 3300025908 Bacteria 1836
116 Ga0207705_10363935 3300025909 Unclassified 1115
117 Ga0207684_10491573 3300025910 Bacteria 1052
118 Ga0207695_10203120 3300025913 Bacteria 1895
119 Ga0207671_10208128 3300025914 Unclassified 1529
120 Ga0207660_10340707 3300025917 Bacteria 1200
121 Ga0207662_10009539 3300025918 Bacteria 5346
122 Ga0207646_10032493 3300025922 Bacteria 4723
123 Ga0207646_10532442 3300025922 Bacteria 1057
124 Ga0207681_10000596 3300025923 Bacteria 24573
125 Ga0207650_10088932 3300025925 Bacteria 2356
126 Ga0207659_10008641 3300025926 Bacteria 6336
127 Ga0207659_10013219 3300025926 Bacteria 5281
128 Ga0207700_10030968 3300025928 Bacteria 3795
129 Ga0207700_10084825 3300025928 Bacteria 2484
130 Ga0207706_10049513 3300025933 Bacteria 3713
131 Ga0207709_10131213 3300025935 Unclassified 1708
132 Ga0207709_10245773 3300025935 Bacteria 1304
133 Ga0207670_10001161 3300025936 Bacteria 13882
134 Ga0207665_10006009 3300025939 Bacteria 8065
135 Ga0207691_10122929 3300025940 Unclassified 2298
136 Ga0207691_10212363 3300025940 Bacteria 1680
137 Ga0207661_10029300 3300025944 Bacteria 4227
138 Ga0207679_10467211 3300025945 Bacteria 1121
139 Ga0207651_10135061 3300025960 Bacteria 1896
140 Ga0207651_10213451 3300025960 Bacteria 1555
141 Ga0207712_10155439 3300025961 Bacteria 1771
142 Ga0207708_10055116 3300026075 Bacteria 3031
143 Ga0207708_10109362 3300026075 Bacteria 2144
144 Ga0207648_10000675 3300026089 Bacteria 38246
145 Ga0207676_10001743 3300026095 Bacteria 15989
146 Ga0207674_10004709 3300026116 Bacteria 16358
147 Ga0207674_10419889 3300026116 Unclassified 1292
148 Ga0207675_100009203 3300026118 Bacteria 9264
149 Ga0207675_100072914 3300026118 Bacteria 3211
150 Ga0207683_10140908 3300026121 Bacteria 2173
151 Ga0207428_10000482 3300027907 Bacteria 48138
152 Ga0207428_10022173 3300027907 Bacteria 5361
153 Ga0207428_10040597 3300027907 Unclassified 3772
154 Ga0268265_10000160 3300028380 Bacteria 81960
155 Ga0307408_100030002 3300031548 Bacteria 3773
156 Ga0307408_100639927 3300031548 Unclassified 949
157 Ga0307405_10075675 3300031731 Bacteria 2181
158 Ga0307405_10349544 3300031731 Bacteria 1140
159 Ga0307413_10064060 3300031824 Bacteria 2282
160 Ga0307410_10006079 3300031852 Bacteria 6474
161 Ga0307410_10053589 3300031852 Bacteria 2730
162 Ga0307410_10099897 3300031852 Bacteria 2078
163 Ga0307406_10054212 3300031901 Bacteria 2558
164 Ga0307406_10118125 3300031901 Bacteria 1838
165 Ga0307407_10158830 3300031903 Bacteria 1477
166 Ga0307412_10007295 3300031911 Bacteria 6269
167 Ga0307412_10031656 3300031911 Bacteria 3343
168 Ga0307409_100029458 3300031995 Bacteria 3929
169 Ga0307416_100030285 3300032002 Bacteria 4058
170 Ga0307411_10039082 3300032005 Unclassified 2999
171 Ga0307411_10344149 3300032005 Bacteria 1213
172 Ga0307415_100225514 3300032126 Bacteria 1505
173 Ga0373954_0077409 3300035118 Bacteria 1586
174 Ga0373955_0149305 3300035172 Bacteria 1375
175 Ga0373925_0574157 3300037068 Bacteria 928
176 Ga0395905_0335071 3300037471 Bacteria 1404
177 Ga0436364_0814498 3300037853 Bacteria 116488
178 Ga0439453_0001003 3300041408 Bacteria 3445
179 Ga0450916_009233 3300042530 Bacteria 1215
180 Ga0466963_0070488 3300044694 Bacteria 2351
181 Ga0451576_0023011 3300045051 Bacteria 6754
182 Ga0495592_0034304 3300046454 Bacteria 3826
183 Ga0495651_0005358 3300046462 Bacteria 9787
184 Ga0495651_0380561 3300046462 Unclassified 926
185 Ga0495653_0130247 3300046463 Bacteria 1782
186 Ga0495580_0107264 3300046472 Bacteria 1940
187 Ga0495662_0081191 3300046476 Bacteria 1576
188 Ga0495664_0018777 3300046477 Bacteria 3967
189 Ga0495584_0037128 3300046491 Unclassified 2461
190 Ga0495594_0104320 3300046499 Bacteria 1596
191 Ga0495618_0058281 3300046514 Bacteria 2446
192 Ga0495628_0006674 3300046516 Bacteria 10064
193 Ga0495663_0029161 3300046525 Bacteria 1627
194 Ga0495642_0017841 3300046528 Unclassified 2773
195 Ga0495642_0102919 3300046528 Bacteria 1217
196 Ga0495587_0043492 3300046536 Bacteria 2675
197 Ga0495667_0045384 3300046559 Bacteria 2910
198 Ga0495634_0168500 3300046642 Bacteria 1377
199 Ga0495635_0026998 3300046663 Bacteria 3994
200 Ga0495659_0033249 3300046664 Unclassified 1809
201 Ga0495599_0008008 3300046678 Bacteria 6414
202 Ga0495623_0083814 3300046679 Bacteria 1968
203 Ga0495613_0040062 3300046689 Bacteria 3472
204 Ga0495600_0079414 3300046809 Bacteria 2142
205 Ga0495600_0218424 3300046809 Unclassified 1220
206 Ga0495604_0078108 3300047317 Bacteria 2485
207 Ga0495636_0006764 3300047318 Bacteria 4507
208 Ga0495675_0170107 3300047444 Bacteria 1339
209 Ga0495677_0041669 3300047445 Bacteria 1680
210 Ga0495685_007710 3300047447 Unclassified 3560
211 Ga0495602_0162349 3300048088 Bacteria 1743
212 Ga0496109_0238192 3300048912 Bacteria 1712
213 Ga0496113_0071005 3300048916 Bacteria 2648
214 Ga0501042_0005216 3300049578 Bacteria 8352
215 Ga0501047_0004559 3300049581 Bacteria 13028
216 Ga0501048_0092455 3300049582 Bacteria 2133
217 Ga0501067_0007635 3300049583 Bacteria 6012
218 Ga0501072_0243633 3300049588 Bacteria 1432
219 Ga0501075_0001194 3300049591 Bacteria 16795
220 Ga0501076_0045401 3300049592 Bacteria 3469
221 Ga0501079_0064904 3300049741 Unclassified 2816
222 Ga0501081_0390832 3300049743 Unclassified 1029
223 Ga0501044_0010250 3300049823 Bacteria 10179
224 nmdc:mga05p37_285372_c1 3300050507 Bacteria 1967
225 nmdc:mga05p37_57703_c1 3300050507 Bacteria 4781
226 nmdc:mga05p37_94435_c1 3300050507 Bacteria 3685
227 nmdc:mga09592_110509_c1 3300050508 Bacteria 2358
228 nmdc:mga0qj67_11060_c1 3300050509 Bacteria 6757
229 nmdc:mga06r32_187260_c1 3300050510 Bacteria 2057
230 nmdc:mga06r32_430653_c1 3300050510 Unclassified 1300
231 nmdc:mga06r32_75047_c1 3300050510 Bacteria 3280
232 nmdc:mga08y16_170462_c1 3300050511 Bacteria 2261
233 nmdc:mga08y16_200686_c1 3300050511 Bacteria 2067
234 nmdc:mga08y16_2250_c1 3300050511 Bacteria 19792
235 nmdc:mga08y16_271_c2 3300050511 Bacteria 9928
236 nmdc:mga08y16_3707_c1 3300050511 Bacteria 15904
237 nmdc:mga0n895_39461_c1 3300050512 Bacteria 4581
238 nmdc:mga0rr50_336375_c1 3300050513 Bacteria 1268
239 nmdc:mga0a205_188666_c1 3300050515 Bacteria 1954
240 Ga0495601_0108181 3300053077 Bacteria 1799
241 Ga0501084_0049876 3300054114 Unclassified 3504
242 Ga0590071_034227 3300059421 Bacteria 1215
243 Ga0590074_001376 3300059423 Unclassified 3893
244 Ga0590075_001051 3300059424 Bacteria 7126
245 Ga0590075_026128 3300059424 Unclassified 1469
246 Ga0590077_000455 3300059426 Bacteria 11491
247 Ga0501082_0001747 3300060353 Bacteria 19150
248 Ga0495656_0014418
249 rootH1_10010212
250 Ga0065712_10000198
251 Ga0065707_10014136
252 Ga0070658_10052919
253 Ga0070658_10102345
254 Ga0070683_100126885
255 Ga0070690_100094976
256 Ga0070666_10149091
257 Ga0070680_100472697
258 Ga0070689_100002704
259 Ga0070692_10036039
260 Ga0070692_10044628
261 Ga0070669_100007309
262 Ga0070675_100009974
263 Ga0070675_100020266
264 Ga0070675_100022613
265 Ga0070675_100076119
266 Ga0070674_100410214
267 Ga0070673_100009580
268 Ga0070688_100028588
269 Ga0070688_100036436
270 Ga0070688_100066315
271 Ga0070659_100214170
272 Ga0070709_10017201
273 Ga0070709_10172990
274 Ga0070713_100038193
275 Ga0070713_100110318
276 Ga0070713_100480856
277 Ga0070701_10004292
278 Ga0070711_100084933
279 Ga0070711_100514276
280 Ga0070705_100000680
281 Ga0070705_100010820
282 Ga0070700_100100585
283 Ga0070700_100123374
284 Ga0070694_100008607
285 Ga0070694_100056752
286 Ga0068867_100001721
287 Ga0068867_100293665
288 Ga0070685_10065588
289 Ga0070706_100042847
290 Ga0070707_100015308
291 Ga0070699_100024355
292 Ga0070684_100143440
293 Ga0070684_100595992
294 Ga0070697_100521113
295 Ga0070672_100187864
296 Ga0070672_100450847
297 Ga0070695_100000031
298 Ga0070695_100115103
299 Ga0070695_100220237
300 Ga0070696_100045705
301 Ga0070704_100004539
302 Ga0070704_100347061
303 Ga0070704_100668779
304 Ga0070664_100041614
305 Ga0068857_100017249
306 Ga0068857_100403983
307 Ga0068852_100360477
308 Ga0068859_100004016
309 Ga0068859_100199204
310 Ga0068864_100014902
311 Ga0068861_100012353
312 Ga0068870_10035931
313 Ga0068863_100197014
314 Ga0068862_100046232
315 Ga0081539_10026320
316 Ga0070717_10141010
317 Ga0070717_10181512
318 Ga0070716_100001911
319 Ga0070712_100046699
320 Ga0075428_100012214
321 Ga0075428_100201193
322 Ga0075431_100179585
323 Ga0075431_100439710
324 Ga0075433_10132908
325 Ga0075434_100002465
326 Ga0075434_100094813
327 Ga0075429_100015079
328 Ga0075429_100060777
329 Ga0075429_100383961
330 Ga0097620_100004016
331 Ga0097620_100199199
332 Ga0105240_10045345
333 Ga0111539_10002116
334 Ga0111539_10005018
335 Ga0111539_10028189
336 Ga0111539_10088367
337 Ga0111539_10192807
338 Ga0111539_10235299
339 Ga0114129_10026157
340 Ga0114129_10077264
341 Ga0114129_10324169
342 Ga0105243_10099249
343 Ga0105243_10217486
344 Ga0105248_10544774
345 Ga0105237_10206399
346 Ga0105249_10295116
347 Ga0105239_10423272
348 Ga0157370_10113196
349 Ga0157374_10070226
350 Ga0163162_10603710
351 Ga0157375_10008719
352 Ga0163163_10071376
353 Ga0163163_10387668
354 Ga0157380_10195171
355 Ga0157377_10040293
356 Ga0157377_10158698
357 Ga0157379_10190801
358 Ga0213875_10000015
359 Ga0207692_10031371
360 Ga0207699_10013932
361 Ga0207645_10010676
362 Ga0207643_10085120
363 Ga0207705_10363935
364 Ga0207684_10491573
365 Ga0207695_10203120
366 Ga0207671_10208128
367 Ga0207660_10340707
368 Ga0207662_10009539
369 Ga0207646_10032493
370 Ga0207646_10532442
371 Ga0207681_10000596
372 Ga0207650_10088932
373 Ga0207659_10008641
374 Ga0207659_10013219
375 Ga0207700_10030968
376 Ga0207700_10084825
377 Ga0207706_10049513
378 Ga0207709_10131213
379 Ga0207709_10245773
380 Ga0207670_10001161
381 Ga0207665_10006009
382 Ga0207691_10122929
383 Ga0207691_10212363
384 Ga0207661_10029300
385 Ga0207679_10467211
386 Ga0207651_10135061
387 Ga0207651_10213451
388 Ga0207712_10155439
389 Ga0207708_10055116
390 Ga0207708_10109362
391 Ga0207648_10000675
392 Ga0207676_10001743
393 Ga0207674_10004709
394 Ga0207674_10419889
395 Ga0207675_100009203
396 Ga0207675_100072914
397 Ga0207683_10140908
398 Ga0207428_10000482
399 Ga0207428_10022173
400 Ga0207428_10040597
401 Ga0268265_10000160
402 Ga0307408_100030002
403 Ga0307408_100639927
404 Ga0307405_10075675
405 Ga0307405_10349544
406 Ga0307413_10064060
407 Ga0307410_10006079
408 Ga0307410_10053589
409 Ga0307410_10099897
410 Ga0307406_10054212
411 Ga0307406_10118125
412 Ga0307407_10158830
413 Ga0307412_10007295
414 Ga0307412_10031656
415 Ga0307409_100029458
416 Ga0307416_100030285
417 Ga0307411_10039082
418 Ga0307411_10344149
419 Ga0307415_100225514
420 Ga0373954_0077409
421 Ga0373955_0149305
422 Ga0373925_0574157
423 Ga0395905_0335071
424 Ga0436364_0814498
425 Ga0439453_0001003
426 Ga0450916_009233
427 Ga0466963_0070488
428 Ga0451576_0023011
429 Ga0495592_0034304
430 Ga0495651_0005358
431 Ga0495651_0380561
432 Ga0495653_0130247
433 Ga0495580_0107264
434 Ga0495662_0081191
435 Ga0495664_0018777
436 Ga0495584_0037128
437 Ga0495594_0104320
438 Ga0495618_0058281
439 Ga0495628_0006674
440 Ga0495663_0029161
441 Ga0495642_0017841
442 Ga0495642_0102919
443 Ga0495587_0043492
444 Ga0495667_0045384
445 Ga0495634_0168500
446 Ga0495635_0026998
447 Ga0495659_0033249
448 Ga0495599_0008008
449 Ga0495623_0083814
450 Ga0495613_0040062
451 Ga0495600_0079414
452 Ga0495600_0218424
453 Ga0495604_0078108
454 Ga0495636_0006764
455 Ga0495675_0170107
456 Ga0495677_0041669
457 Ga0495685_007710
458 Ga0495602_0162349
459 Ga0496109_0238192
460 Ga0496113_0071005
461 Ga0501042_0005216
462 Ga0501047_0004559
463 Ga0501048_0092455
464 Ga0501067_0007635
465 Ga0501072_0243633
466 Ga0501075_0001194
467 Ga0501076_0045401
468 Ga0501079_0064904
469 Ga0501081_0390832
470 Ga0501044_0010250
471 nmdc:mga05p37_285372_c1
472 nmdc:mga05p37_57703_c1
473 nmdc:mga05p37_94435_c1
474 nmdc:mga09592_110509_c1
475 nmdc:mga0qj67_11060_c1
476 nmdc:mga06r32_187260_c1
477 nmdc:mga06r32_430653_c1
478 nmdc:mga06r32_75047_c1
479 nmdc:mga08y16_170462_c1
480 nmdc:mga08y16_200686_c1
481 nmdc:mga08y16_2250_c1
482 nmdc:mga08y16_271_c2
483 nmdc:mga08y16_3707_c1
484 nmdc:mga0n895_39461_c1
485 nmdc:mga0rr50_336375_c1
486 nmdc:mga0a205_188666_c1
487 Ga0495601_0108181
488 Ga0501084_0049876
489 Ga0590071_034227
490 Ga0590074_001376
491 Ga0590075_001051
492 Ga0590075_026128
493 Ga0590077_000455
494 Ga0501082_0001747

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

301

331

0.92

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

176

267

0.91

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

48

157

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oq4-assembly1.cif.gz_A crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate 0.8835 2 281
1k3x-assembly1.cif.gz_A crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with brominated-dna 0.8801 2 281
2oq4-assembly2.cif.gz_B crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate 0.8779 2 281
6fbu-assembly1.cif.gz_A crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate 0.8777 2 281
2oq4-assembly1.cif.gz_A crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate 0.8769 2 281
ID Description Score Start End Superfamily
af_P9WNC1_2_123_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9248 2 122 3.20.190.10
1q39A01 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9109 7 133 3.20.190.10
1q39A01 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.8897 7 133 3.20.190.10
af_P9WNC1_2_123_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.8598 2 122 3.20.190.10
af_P9WNC1_124_255_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.848 133 281 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A2V7U2J8-F1-model_v4 DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) 0.9453 1 281 GO:0000703
GO:0003684
GO:0006284
GO:0008270
GO:0140078
AF-A0A356TE17-F1-model_v4 DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) 0.9427 1 196 GO:0000703
GO:0003684
GO:0006284
GO:0008270
GO:0140078
AF-A0A4R9ENW0-F1-model_v4 DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) 0.9423 1 200 GO:0000703
GO:0003684
GO:0006284
GO:0008270
GO:0140078
AF-A0A3N5YN47-F1-model_v4 DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) 0.9417 1 281 GO:0000703
GO:0003684
GO:0006284
GO:0008270
GO:0140078
AF-A0A7V8WK75-F1-model_v4 Formamidopyrimidine-DNA glycosylase catalytic domain-containing protein 0.9392 1 176 GO:0000703
GO:0003676
GO:0006284
GO:0008270
GO:0140078

Map