F359286

General Info

Members Datasets Scaffolds Average Seq Length
247 165 494 437

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0054072|Ga0495638_0054072_804_2060
Length 406
Sequence VRERLFGGYSDADTERWLPEEHTSRRSDFARDRARLLHSSALRRLAAKTQVLSPTAGLDFARNRLTHSLEVAQVGRELATSLGLDPDVVDTACLAHDLGHPPFGHNGERALNTWAADIGGFEGNAQTLRILTRLEPKVFGDAGRSYGLNLTRASLDASCKYPWPEATSVADPSGRAKFGFYRDDLAVFEWMRVGAPERRLCIEAQVMDLSDDIAYSVHDFEDAIVNGYVDVAALGARVDHDALVSSMHAWAFDRLDSLDGWLETWSGSRLEQGRLKNLTSQLIGRFAHAATDATRSAFPLASLIRFDADVVVPREIQAEIAVLKGIVAAFVMSRNTRQPIYVQQRQVLASLADVLFATGDEHLDPGFAADWNAAADDAARKRVVVDQVASLTDQSALAWYERLVQR

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
13 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
14 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
19 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
23 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
24 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
25 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
27 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
36 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
37 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
38 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
39 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
40 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
43 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
44 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
45 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
46 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
47 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
48 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
49 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
50 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
51 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
52 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
53 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
54 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
55 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
56 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
57 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
58 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
59 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
60 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
61 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
62 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
63 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
77 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
78 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
79 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
82 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
85 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
86 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
87 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
88 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
89 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
90 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
91 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
92 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
93 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
94 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
96 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
97 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
98 2643221546 Microbacterium sp. Root53 Isolate Unclassified
99 2643221553 Microbacterium sp. Root553 Isolate Unclassified
100 2643221566 Microbacterium sp. Root166 Isolate Unclassified
101 2643221572 Leifsonia sp. Root60 Isolate Unclassified
102 2643221575 Microbacterium sp. Root61 Isolate Unclassified
103 2643221597 Microbacterium sp. Root180 Isolate Unclassified
104 2643221616 Leifsonia sp. Root227 Isolate Unclassified
105 2643221619 Agromyces sp. Root81 Isolate Unclassified
106 2643221630 Microbacterium sp. Root322 Isolate Unclassified
107 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
108 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
109 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
110 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
111 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
112 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
113 2773857759 Microbacterium sp. 1294 Isolate Unclassified
114 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
115 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
116 2808606372 Agromyces sp. 23-23 Isolate Unclassified
117 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
118 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
119 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
120 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
121 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
122 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
123 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
124 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
125 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
126 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
127 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
128 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
129 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
130 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
131 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
132 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
133 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
134 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
135 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
136 2919069694 Microbacterium sp. 1154 Isolate Unclassified
137 2919395869 Microbacterium resistens 2980 Isolate Unclassified
138 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
139 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
140 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
141 2928153084 Leifsonia sp. 563 Isolate Unclassified
142 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
143 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
144 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
145 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
146 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
147 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
148 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
149 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
150 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
151 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
152 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
153 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
154 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
155 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
156 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
157 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
158 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
159 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
160 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
161 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
162 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
163 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
164 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
165 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.64
Metatranscriptomes 1.62
Isolates 28.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.81
Bulb 0
Endosphere 13.77
Nodule 0
Rhizoplane 4.05
Rhizosphere 46.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0054072 3300046460 Bacteria 2497
2 Ga0006562J51391_1163932 3300003578 Bacteria 4840
3 Ga0006562J51391_1163933 3300003578 Bacteria 3973
4 Ga0055527_1000001 3300003760 Bacteria 850044
5 Ga0055529_1000018 3300003763 Bacteria 344344
6 Ga0070658_10000122 3300005327 Bacteria 69245
7 Ga0070658_10024474 3300005327 Bacteria 4843
8 Ga0070659_100131883 3300005366 Bacteria 2030
9 Ga0070667_100064375 3300005367 Bacteria 3111
10 Ga0068855_100052480 3300005563 Bacteria 4800
11 Ga0075365_10000821 3300006038 Bacteria 12815
12 Ga0075365_10010281 3300006038 Bacteria 5437
13 Ga0075365_10060063 3300006038 Bacteria 2535
14 Ga0075364_10004915 3300006051 Bacteria 7746
15 Ga0075364_10011085 3300006051 Bacteria 5472
16 Ga0075364_10012084 3300006051 Bacteria 5270
17 Ga0075367_10002793 3300006178 Bacteria 8095
18 Ga0075369_10002918 3300006186 Bacteria 6169
19 Ga0157371_10000825 3300013102 Bacteria 35495
20 Ga0157370_10004863 3300013104 Bacteria 15249
21 Ga0157369_10041280 3300013105 Bacteria 5037
22 Ga0171462_1003 3300013250 Bacteria 853796
23 Ga0157372_10380340 3300013307 Bacteria 1645
24 Ga0157380_10112384 3300014326 Bacteria 2292
25 Ga0206353_10309306 3300020082 Bacteria 4782
26 Ga0209672_100006 3300025228 Bacteria 1004497
27 Ga0209147_100868 3300025229 Bacteria 14017
28 Ga0207427_100329 3300025231 Bacteria 31805
29 Ga0209437_100739 3300025233 Bacteria 16245
30 Ga0209646_1000071 3300025246 Bacteria 228702
31 Ga0209148_1000015 3300025254 Bacteria 850103
32 Ga0209233_1000001 3300025261 Bacteria 2992747
33 Ga0209455_1000013 3300025272 Bacteria 850103
34 Ga0207655_1001264 3300025728 Bacteria 24120
35 Ga0207655_1013457 3300025728 Bacteria 4696
36 Ga0207705_10000006 3300025909 Bacteria 657147
37 Ga0207690_10077224 3300025932 Bacteria 2314
38 Ga0207667_10068052 3300025949 Bacteria 3709
39 Ga0207658_10004569 3300025986 Bacteria 9607
40 Ga0207678_10088024 3300026067 Bacteria 2654
41 Ga0207708_10278549 3300026075 Bacteria 1355
42 Ga0307405_10157002 3300031731 Bacteria 1607
43 Ga0307406_10000123 3300031901 Bacteria 45640
44 Ga0307406_10000833 3300031901 Bacteria 17322
45 Ga0307406_10021190 3300031901 Bacteria 3841
46 Ga0307412_10131981 3300031911 Bacteria 1816
47 Ga0307414_10031186 3300032004 Bacteria 3493
48 Ga0307414_10085967 3300032004 Bacteria 2319
49 Ga0395899_0000786 3300037312 Bacteria 31058
50 Ga0395900_0012475 3300037418 Bacteria 8689
51 Ga0395900_0017190 3300037418 Bacteria 7383
52 Ga0395898_0000752 3300037466 Bacteria 56634
53 Ga0466972_0071576 3300044658 Bacteria 1654
54 Ga0466965_0000007 3300044683 Bacteria 131940
55 Ga0466965_0136595 3300044683 Bacteria 1274
56 Ga0466970_0088600 3300044765 Bacteria 1678
57 Ga0466960_0026803 3300044901 Bacteria 2621
58 Ga0466960_0065700 3300044901 Bacteria 1792
59 Ga0495627_003056 3300046453 Bacteria 7624
60 Ga0496102_0008335 3300048905 Bacteria 8876
61 Ga0496105_0027056 3300048908 Bacteria 4681
62 Ga0496105_0094108 3300048908 Bacteria 2474
63 Ga0496105_0116803 3300048908 Bacteria 2201
64 Ga0496107_0039950 3300048910 Bacteria 3367
65 Ga0496110_0199402 3300048913 Bacteria 1818
66 Ga0496114_0022162 3300048917 Bacteria 5174
67 Ga0496114_0029021 3300048917 Bacteria 4544
68 Ga0496114_0072803 3300048917 Bacteria 2891
69 Ga0496114_0130365 3300048917 Bacteria 2171
70 Ga0496116_0015871 3300048919 Bacteria 5928
71 Ga0496117_0000053 3300048920 Bacteria 279396
72 Ga0496117_0000235 3300048920 Bacteria 104830
73 Ga0496117_0001321 3300048920 Bacteria 36462
74 Ga0496117_0010509 3300048920 Bacteria 8419
75 Ga0496117_0021676 3300048920 Bacteria 5186
76 Ga0496117_0021815 3300048920 Bacteria 5164
77 Ga0496118_0004020 3300048921 Bacteria 17887
78 Ga0496118_0009005 3300048921 Bacteria 10183
79 Ga0496118_0011404 3300048921 Bacteria 8678
80 Ga0496118_0179321 3300048921 Bacteria 1282
81 Ga0496119_0001919 3300048922 Bacteria 23793
82 Ga0496119_0006925 3300048922 Bacteria 10339
83 Ga0496119_0007470 3300048922 Bacteria 9832
84 Ga0496119_0014544 3300048922 Bacteria 6143
85 Ga0496120_0000567 3300048923 Bacteria 56364
86 Ga0496120_0001497 3300048923 Bacteria 27661
87 Ga0496120_0005583 3300048923 Bacteria 9984
88 Ga0496120_0013371 3300048923 Bacteria 5531
89 Ga0496121_0111467 3300048924 Bacteria 2086
90 Ga0496122_0000030 3300048925 Bacteria 331586
91 Ga0496122_0000200 3300048925 Bacteria 133548
92 Ga0496122_0005148 3300048925 Bacteria 15765
93 Ga0496122_0005464 3300048925 Bacteria 15128
94 Ga0496122_0006392 3300048925 Bacteria 13543
95 Ga0496122_0007477 3300048925 Bacteria 12125
96 Ga0496122_0028194 3300048925 Bacteria 4775
97 Ga0496123_0000024 3300048926 Bacteria 331587
98 Ga0496123_0000076 3300048926 Bacteria 194050
99 Ga0496123_0001137 3300048926 Bacteria 39763
100 Ga0496123_0008576 3300048926 Bacteria 9368
101 Ga0496123_0045043 3300048926 Bacteria 3010
102 Ga0496124_0005229 3300048927 Bacteria 14720
103 Ga0496124_0018523 3300048927 Bacteria 6518
104 Ga0496125_0000061 3300048928 Bacteria 262739
105 Ga0496125_0003878 3300048928 Bacteria 17678
106 Ga0496125_0008942 3300048928 Bacteria 10395
107 Ga0496125_0010555 3300048928 Bacteria 9337
108 Ga0496125_0013003 3300048928 Bacteria 8215
109 Ga0496125_0127056 3300048928 Bacteria 1804
110 Ga0496126_0006116 3300048929 Bacteria 13498
111 Ga0496126_0015806 3300048929 Bacteria 7580
112 Ga0496126_0024882 3300048929 Bacteria 5773
113 Ga0496126_0071372 3300048929 Bacteria 3091
114 Ga0496126_0250394 3300048929 Bacteria 1476
115 Ga0501031_0009585 3300049568 Bacteria 6304
116 Ga0501032_0021670 3300049569 Bacteria 4465
117 Ga0501032_0146398 3300049569 Bacteria 1555
118 Ga0501033_0045148 3300049570 Bacteria 3280
119 Ga0501034_0001058 3300049571 Bacteria 39041
120 Ga0501034_0008673 3300049571 Bacteria 10715
121 Ga0501034_0026658 3300049571 Bacteria 5881
122 Ga0501034_0037614 3300049571 Bacteria 4901
123 Ga0501034_0058590 3300049571 Bacteria 3870
124 Ga0501036_0017172 3300049572 Bacteria 6048
125 Ga0501037_0020133 3300049573 Bacteria 4927
126 Ga0501037_0027691 3300049573 Bacteria 4187
127 Ga0501038_0022798 3300049574 Bacteria 5604
128 Ga0501038_0024555 3300049574 Bacteria 5377
129 Ga0501039_0022670 3300049575 Bacteria 4818
130 Ga0501042_0004387 3300049578 Bacteria 8998
131 Ga0501042_0051188 3300049578 Bacteria 2946
132 Ga0501043_0002084 3300049579 Bacteria 17078
133 Ga0501043_0066652 3300049579 Bacteria 2827
134 Ga0501043_0103334 3300049579 Bacteria 2239
135 Ga0501043_0136744 3300049579 Bacteria 1919
136 Ga0501046_0007020 3300049580 Bacteria 9921
137 Ga0501046_0016535 3300049580 Bacteria 6172
138 Ga0501047_0018254 3300049581 Bacteria 6723
139 Ga0501047_0041426 3300049581 Bacteria 4450
140 Ga0501048_0008758 3300049582 Bacteria 7624
141 Ga0501068_0005470 3300049584 Bacteria 6957
142 Ga0501069_0024324 3300049585 Bacteria 3303
143 Ga0501070_0000088 3300049586 Bacteria 77423
144 Ga0501070_0002121 3300049586 Bacteria 17393
145 Ga0501070_0003134 3300049586 Bacteria 14398
146 Ga0501073_0004953 3300049589 Bacteria 9993
147 Ga0501073_0018727 3300049589 Bacteria 5006
148 Ga0501073_0032310 3300049589 Bacteria 3731
149 Ga0501080_0004313 3300049742 Bacteria 12631
150 Ga0501080_0064706 3300049742 Bacteria 3401
151 Ga0501083_0000052 3300049744 Bacteria 84349
152 Ga0501083_0005872 3300049744 Bacteria 8688
153 Ga0501083_0008200 3300049744 Bacteria 7386
154 Ga0501035_0044861 3300049822 Bacteria 3978
155 Ga0501035_0200523 3300049822 Bacteria 1711
156 Ga0501044_0019735 3300049823 Bacteria 7202
157 Ga0501045_0024257 3300049824 Bacteria 4353
158 nmdc:mga00v17_14524_c1 3300050491 Bacteria 4398
159 nmdc:mga00v17_37931_c1 3300050491 Bacteria 2879
160 nmdc:mga00v17_9571_c1 3300050491 Bacteria 5250
161 nmdc:mga0yw44_105304_c1 3300050492 Bacteria 1802
162 nmdc:mga0yw44_8845_c1 3300050492 Bacteria 5044
163 nmdc:mga07m45_12088_c1 3300050496 Bacteria 4554
164 Ga0500559_0000156 3300053136 Bacteria 53941
165 Ga0500568_0000026 3300053139 Bacteria 165582
166 Ga0500568_0000172 3300053139 Bacteria 56463
167 Ga0500568_0002072 3300053139 Bacteria 12162
168 Ga0500573_0000013 3300053140 Bacteria 196637
169 Ga0500573_0002729 3300053140 Bacteria 8922
170 Ga0500616_0000088 3300053153 Bacteria 191662
171 Ga0500616_0000156 3300053153 Bacteria 114514
172 Ga0500616_0001006 3300053153 Bacteria 30305
173 Ga0500616_0024134 3300053153 Bacteria 3384
174 Ga0500645_005906 3300053730 Bacteria 4436
175 Ga0501084_0057156 3300054114 Bacteria 3265
176 Ga0587084_003129 3300059477 Bacteria 1792
177 2587862591 2585428094 Bacteria 3604039
178 2588108524 2585428157 Bacteria 3018951
179 2643733507 2643221542 Bacteria 3563959
180 2643752300 2643221546 Bacteria 2910897
181 2643785997 2643221553 Bacteria 3544260
182 2643848271 2643221566 Bacteria 3460379
183 2643875421 2643221572 Bacteria 3614809
184 2643885404 2643221575 Bacteria 4022601
185 2643995712 2643221597 Bacteria 3347721
186 2644095960 2643221616 Bacteria 4066575
187 2644110756 2643221619 Bacteria 4158469
188 2644170082 2643221630 Bacteria 3601215
189 2644382476 2643221669 Bacteria 3611286
190 2644680413 2643221724 Bacteria 3593515
191 2730229867 2728369380 Bacteria 3620317
192 2747953452 2747842429 Bacteria 3914386
193 2758226102 2757320536 Bacteria 3629334
194 2774380357 2773857758 Bacteria 3592392
195 2774384539 2773857759 Bacteria 2963774
196 2808631170 2808606306 Bacteria 3608896
197 2808885662 2808606368 Bacteria 3174172
198 2808902305 2808606372 Bacteria 4649509
199 2809227457 2808606447 Bacteria 3572005
200 2812323132 2811994872 Bacteria 4121241
201 2821270026 2821268502 Bacteria 3750023
202 2833710975 2833709550 Bacteria 4008291
203 2844842367 2844841374 Bacteria 3917147
204 2852634218 2852632344 Bacteria 3463163
205 2852645665 2852643534 Bacteria 3013378
206 2852647488 2852646457 Bacteria 3408613
207 2852665419 2852663356 Bacteria 4090475
208 2857721626 2857720070 Bacteria 3189373
209 2857724041 2857723135 Bacteria 4217853
210 2857729988 2857729791 Bacteria 4040535
211 2857739692 2857737099 Bacteria 3104305
212 2862995855 2862993130 Bacteria 3860849
213 2870623766 2870622029 Bacteria 3643329
214 2870630374 2870628048 Bacteria 3696012
215 2895661513 2895660088 Bacteria 3782833
216 2904511974 2904509784 Bacteria 3520416
217 2908680890 2908678064 Bacteria 3482747
218 2919071552 2919069694 Bacteria 3622919
219 2919398785 2919395869 Bacteria 3704152
220 2919445979 2919443155 Bacteria 4072969
221 2928092273 2928090899 Bacteria 3158267
222 2928123210 2928121344 Bacteria 3972376
223 2928155970 2928153084 Bacteria 4020257
224 2935412713 2935409751 Bacteria 4179611
225 2939658257 2939657138 Bacteria 3740283
226 2939661301 2939660829 Bacteria 3784848
227 2945972005 2945968032 Bacteria 4111363
228 2946033616 2946033335 Bacteria 3835514
229 2946080774 2946080515 Bacteria 4310960
230 2964329485 2964326757 Bacteria 3290868
231 2966922335 2966921586 Bacteria 3092803
232 2966925013 2966924647 Bacteria 3268643
233 2974297209 2974294766 Bacteria 3767688
234 2974326558 2974324384 Bacteria 3750535
235 2977231442 2977228692 Bacteria 3450105
236 2977240216 2977236895 Bacteria 3569373
237 2977253871 2977251589 Bacteria 2952848
238 2977266654 2977264416 Bacteria 3750737
239 2984545506 2984542743 Bacteria 3569378
240 2984580951 2984580707 Bacteria 3351387
241 8004185014 8004182704 Bacteria 3391155
242 8004214342 8004212874 Bacteria 2861420
243 8016257523 8016254467 Bacteria 3797036
244 8045831610 8045830549 Bacteria 4444727
245 8046356236 8046352972 Bacteria 3613806
246 8056039511 8056037122 Bacteria 3854319
247 8057348882 8057345674 Bacteria 4160394
248 Ga0495638_0054072
249 Ga0006562J51391_1163932
250 Ga0006562J51391_1163933
251 Ga0055527_1000001
252 Ga0055529_1000018
253 Ga0070658_10000122
254 Ga0070658_10024474
255 Ga0070659_100131883
256 Ga0070667_100064375
257 Ga0068855_100052480
258 Ga0075365_10000821
259 Ga0075365_10010281
260 Ga0075365_10060063
261 Ga0075364_10004915
262 Ga0075364_10011085
263 Ga0075364_10012084
264 Ga0075367_10002793
265 Ga0075369_10002918
266 Ga0157371_10000825
267 Ga0157370_10004863
268 Ga0157369_10041280
269 Ga0171462_1003
270 Ga0157372_10380340
271 Ga0157380_10112384
272 Ga0206353_10309306
273 Ga0209672_100006
274 Ga0209147_100868
275 Ga0207427_100329
276 Ga0209437_100739
277 Ga0209646_1000071
278 Ga0209148_1000015
279 Ga0209233_1000001
280 Ga0209455_1000013
281 Ga0207655_1001264
282 Ga0207655_1013457
283 Ga0207705_10000006
284 Ga0207690_10077224
285 Ga0207667_10068052
286 Ga0207658_10004569
287 Ga0207678_10088024
288 Ga0207708_10278549
289 Ga0307405_10157002
290 Ga0307406_10000123
291 Ga0307406_10000833
292 Ga0307406_10021190
293 Ga0307412_10131981
294 Ga0307414_10031186
295 Ga0307414_10085967
296 Ga0395899_0000786
297 Ga0395900_0012475
298 Ga0395900_0017190
299 Ga0395898_0000752
300 Ga0466972_0071576
301 Ga0466965_0000007
302 Ga0466965_0136595
303 Ga0466970_0088600
304 Ga0466960_0026803
305 Ga0466960_0065700
306 Ga0495627_003056
307 Ga0496102_0008335
308 Ga0496105_0027056
309 Ga0496105_0094108
310 Ga0496105_0116803
311 Ga0496107_0039950
312 Ga0496110_0199402
313 Ga0496114_0022162
314 Ga0496114_0029021
315 Ga0496114_0072803
316 Ga0496114_0130365
317 Ga0496116_0015871
318 Ga0496117_0000053
319 Ga0496117_0000235
320 Ga0496117_0001321
321 Ga0496117_0010509
322 Ga0496117_0021676
323 Ga0496117_0021815
324 Ga0496118_0004020
325 Ga0496118_0009005
326 Ga0496118_0011404
327 Ga0496118_0179321
328 Ga0496119_0001919
329 Ga0496119_0006925
330 Ga0496119_0007470
331 Ga0496119_0014544
332 Ga0496120_0000567
333 Ga0496120_0001497
334 Ga0496120_0005583
335 Ga0496120_0013371
336 Ga0496121_0111467
337 Ga0496122_0000030
338 Ga0496122_0000200
339 Ga0496122_0005148
340 Ga0496122_0005464
341 Ga0496122_0006392
342 Ga0496122_0007477
343 Ga0496122_0028194
344 Ga0496123_0000024
345 Ga0496123_0000076
346 Ga0496123_0001137
347 Ga0496123_0008576
348 Ga0496123_0045043
349 Ga0496124_0005229
350 Ga0496124_0018523
351 Ga0496125_0000061
352 Ga0496125_0003878
353 Ga0496125_0008942
354 Ga0496125_0010555
355 Ga0496125_0013003
356 Ga0496125_0127056
357 Ga0496126_0006116
358 Ga0496126_0015806
359 Ga0496126_0024882
360 Ga0496126_0071372
361 Ga0496126_0250394
362 Ga0501031_0009585
363 Ga0501032_0021670
364 Ga0501032_0146398
365 Ga0501033_0045148
366 Ga0501034_0001058
367 Ga0501034_0008673
368 Ga0501034_0026658
369 Ga0501034_0037614
370 Ga0501034_0058590
371 Ga0501036_0017172
372 Ga0501037_0020133
373 Ga0501037_0027691
374 Ga0501038_0022798
375 Ga0501038_0024555
376 Ga0501039_0022670
377 Ga0501042_0004387
378 Ga0501042_0051188
379 Ga0501043_0002084
380 Ga0501043_0066652
381 Ga0501043_0103334
382 Ga0501043_0136744
383 Ga0501046_0007020
384 Ga0501046_0016535
385 Ga0501047_0018254
386 Ga0501047_0041426
387 Ga0501048_0008758
388 Ga0501068_0005470
389 Ga0501069_0024324
390 Ga0501070_0000088
391 Ga0501070_0002121
392 Ga0501070_0003134
393 Ga0501073_0004953
394 Ga0501073_0018727
395 Ga0501073_0032310
396 Ga0501080_0004313
397 Ga0501080_0064706
398 Ga0501083_0000052
399 Ga0501083_0005872
400 Ga0501083_0008200
401 Ga0501035_0044861
402 Ga0501035_0200523
403 Ga0501044_0019735
404 Ga0501045_0024257
405 nmdc:mga00v17_14524_c1
406 nmdc:mga00v17_37931_c1
407 nmdc:mga00v17_9571_c1
408 nmdc:mga0yw44_105304_c1
409 nmdc:mga0yw44_8845_c1
410 nmdc:mga07m45_12088_c1
411 Ga0500559_0000156
412 Ga0500568_0000026
413 Ga0500568_0000172
414 Ga0500568_0002072
415 Ga0500573_0000013
416 Ga0500573_0002729
417 Ga0500616_0000088
418 Ga0500616_0000156
419 Ga0500616_0001006
420 Ga0500616_0024134
421 Ga0500645_005906
422 Ga0501084_0057156
423 Ga0587084_003129
424 2587862591
425 2588108524
426 2643733507
427 2643752300
428 2643785997
429 2643848271
430 2643875421
431 2643885404
432 2643995712
433 2644095960
434 2644110756
435 2644170082
436 2644382476
437 2644680413
438 2730229867
439 2747953452
440 2758226102
441 2774380357
442 2774384539
443 2808631170
444 2808885662
445 2808902305
446 2809227457
447 2812323132
448 2821270026
449 2833710975
450 2844842367
451 2852634218
452 2852645665
453 2852647488
454 2852665419
455 2857721626
456 2857724041
457 2857729988
458 2857739692
459 2862995855
460 2870623766
461 2870630374
462 2895661513
463 2904511974
464 2908680890
465 2919071552
466 2919398785
467 2919445979
468 2928092273
469 2928123210
470 2928155970
471 2935412713
472 2939658257
473 2939661301
474 2945972005
475 2946033616
476 2946080774
477 2964329485
478 2966922335
479 2966925013
480 2974297209
481 2974326558
482 2977231442
483 2977240216
484 2977253871
485 2977266654
486 2984545506
487 2984580951
488 8004185014
489 8004214342
490 8016257523
491 8045831610
492 8046356236
493 8056039511
494 8057348882

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13286

HD_assoc

Phosphohydrolase-associated domain

310

402

0.98

PF01966

HD

HD domain

64

216

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dqb-assembly1.cif.gz_B crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8639 26 424
2dqb-assembly1.cif.gz_C crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8469 26 424
2dqb-assembly1.cif.gz_D crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8452 26 424
2dqb-assembly1.cif.gz_E crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8339 26 424
2dqb-assembly1.cif.gz_A crystal structure of dntp triphosphohydrolase from thermus thermophilus hb8, which is homologous to dgtp triphosphohydrolase 0.8311 26 424
ID Description Score Start End Superfamily
af_P9WNY7_7_418_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9509 18 417 1.10.3210.10
af_P9WNY7_7_418_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9215 18 417 1.10.3210.10
2dqbE00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8277 26 424 1.10.3210.10
2dqbE00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.765 26 424 1.10.3210.10
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7183 51 224 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A1X7NDV4-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase-like protein 0.9821 18 424 GO:0006203
GO:0008832
AF-A0A162GRG6-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase-like protein 0.9764 218 424 GO:0016787
AF-A0A6J6KDQ4-F1-model_v4 Unannotated protein 0.9741 305 425
AF-A0A1Q3T8L8-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase-like protein 0.9738 14 443 GO:0006203
GO:0008832
AF-A0A0N7I3W9-F1-model_v4 Deoxyguanosinetriphosphate triphosphohydrolase-like protein 0.9651 6 456 GO:0006203
GO:0008832

Map