F358701

General Info

Members Datasets Scaffolds Average Seq Length
247 140 494 211

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10000026|Ga0070658_10000026118
Length 224
Sequence MNRKLKNPPSGGKGVRPFIIGIAGGSGSGKTFFLKCFLEHFSTDEVCLVSQDDYYHPVADGMTAEENILYNFDLPETINNEQFVADINSLINNETIYKKEYTFNNPNLTPKILEIKPAPILIVEGLFIFHFREIAEKLDLKIFIEANEDVALSRRLKRDLEERGYSHDGVMYKWLNHVVPAYNEYLLPYRDECHQVIVNNTHQADDIIVVTAAISGELRKKVLV

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
102 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
125 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
128 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
129 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
130 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
131 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
132 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
133 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
134 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
135 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
136 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
137 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
138 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
139 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
140 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 0
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.26
Nodule 0
Rhizoplane 0.4
Rhizosphere 86.64
Stem 0
Stem Tuber 0
Unclassified 5.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000026 3300005327 Bacteria 171716
2 JGI24736J21556_1016672 3300001904 Bacteria 1167
3 JGI24740J21852_10044247 3300001979 Bacteria 1322
4 JGI24740J21852_10054683 3300001979 Bacteria 1126
5 JGI24737J22298_10000092 3300001990 Bacteria 26419
6 JGI24735J21928_10000006 3300002067 Bacteria 339303
7 JGI24744J21845_10018323 3300002077 Unclassified 1388
8 JGI25162J39368_1001400 3300002737 Bacteria 13179
9 JGI25164J39214_1001307 3300002772 Bacteria 6283
10 JGI25165J46597_1000855 3300003214 Bacteria 22032
11 rootH1_10060985 3300003316 Bacteria 3154
12 rootH1_10072982 3300003316 Bacteria 7424
13 rootH2_10001334 3300003320 Bacteria 238709
14 rootH2_10089634 3300003320 Bacteria 1783
15 rootL2_10192676 3300003322 Bacteria 2277
16 rootH1_10002772 3300003323 Bacteria 26216
17 rootH1_10168445 3300003323 Bacteria 3043
18 rootH1_10216274 3300003323 Bacteria 1710
19 Ga0065714_10005409 3300005288 Bacteria 5102
20 Ga0070658_10028102 3300005327 Bacteria 4515
21 Ga0070658_10084727 3300005327 Bacteria 2606
22 Ga0070676_10001812 3300005328 Bacteria 10867
23 Ga0070680_100013176 3300005336 Bacteria 6437
24 Ga0068868_100034503 3300005338 Bacteria 3906
25 Ga0068868_100107000 3300005338 Bacteria 2269
26 Ga0070660_100025924 3300005339 Unclassified 4361
27 Ga0070660_100569975 3300005339 Unclassified 945
28 Ga0070673_100010025 3300005364 Bacteria 6393
29 Ga0070659_100241101 3300005366 Bacteria 1496
30 Ga0070662_100000093 3300005457 Bacteria 49418
31 Ga0070662_100092259 3300005457 Bacteria 2276
32 Ga0070681_10024087 3300005458 Bacteria 6128
33 Ga0068867_100000834 3300005459 Bacteria 20744
34 Ga0070679_100259740 3300005530 Bacteria 1692
35 Ga0068853_100046991 3300005539 Bacteria 3704
36 Ga0068853_100077701 3300005539 Bacteria 2900
37 Ga0070672_100244742 3300005543 Unclassified 1509
38 Ga0070665_100000003 3300005548 Bacteria 811857
39 Ga0068855_100004855 3300005563 Bacteria 16414
40 Ga0068855_100015590 3300005563 Bacteria 9144
41 Ga0068855_100049734 3300005563 Bacteria 4943
42 Ga0068856_100001155 3300005614 Bacteria 27745
43 Ga0068856_100016916 3300005614 Bacteria 7067
44 Ga0068856_100116676 3300005614 Bacteria 2670
45 Ga0068856_100332857 3300005614 Bacteria 1536
46 Ga0068852_100005543 3300005616 Bacteria 9051
47 Ga0068852_100419852 3300005616 Bacteria 1319
48 Ga0068858_100044822 3300005842 Bacteria 4099
49 Ga0068858_100466051 3300005842 Bacteria 1218
50 Ga0075366_10000123 3300006195 Bacteria 32043
51 Ga0097621_100002096 3300006237 Bacteria 13664
52 Ga0068871_100000196 3300006358 Bacteria 41550
53 Ga0068865_100000022 3300006881 Bacteria 102976
54 Ga0105240_10003724 3300009093 Bacteria 23554
55 Ga0105240_10006944 3300009093 Bacteria 16540
56 Ga0105240_10026711 3300009093 Bacteria 7572
57 Ga0105240_10252849 3300009093 Bacteria 2037
58 Ga0105240_10300821 3300009093 Bacteria 1835
59 Ga0105240_10479490 3300009093 Bacteria 1387
60 Ga0105240_10506376 3300009093 Bacteria 1342
61 Ga0105240_10857928 3300009093 Bacteria 979
62 Ga0105240_11084362 3300009093 Bacteria 853
63 Ga0105245_10858890 3300009098 Bacteria 948
64 Ga0105241_10000238 3300009174 Bacteria 41677
65 Ga0105242_10165656 3300009176 Unclassified 1939
66 Ga0105237_10001823 3300009545 Bacteria 27486
67 Ga0105237_10006067 3300009545 Bacteria 13516
68 Ga0105237_10018370 3300009545 Bacteria 7236
69 Ga0105237_10018921 3300009545 Bacteria 7119
70 Ga0105237_10054779 3300009545 Bacteria 3996
71 Ga0105238_10008082 3300009551 Bacteria 10522
72 Ga0105238_10653183 3300009551 Bacteria 1062
73 Ga0105239_10000005 3300010375 Bacteria 496066
74 Ga0105239_10000013 3300010375 Bacteria 327371
75 Ga0105239_10004534 3300010375 Bacteria 16549
76 Ga0105239_10004850 3300010375 Bacteria 15914
77 Ga0105239_10022560 3300010375 Bacteria 6941
78 Ga0105239_10043744 3300010375 Bacteria 4910
79 Ga0105239_10073693 3300010375 Bacteria 3753
80 Ga0105239_10156032 3300010375 Bacteria 2549
81 Ga0105239_10290147 3300010375 Bacteria 1842
82 Ga0105246_10180333 3300011119 Bacteria 1626
83 Ga0105246_10348689 3300011119 Bacteria 1212
84 Ga0157373_10002419 3300013100 Bacteria 14191
85 Ga0157371_10007776 3300013102 Bacteria 8616
86 Ga0157371_10128732 3300013102 Bacteria 1801
87 Ga0157371_10178804 3300013102 Bacteria 1517
88 Ga0157371_10335814 3300013102 Bacteria 1098
89 Ga0157370_10054544 3300013104 Bacteria 3810
90 Ga0157370_10060281 3300013104 Bacteria 3603
91 Ga0157369_10000039 3300013105 Bacteria 188947
92 Ga0157369_10063369 3300013105 Bacteria 3983
93 Ga0157369_10169051 3300013105 Bacteria 2304
94 Ga0157369_10656290 3300013105 Bacteria 1082
95 Ga0157374_10000456 3300013296 Bacteria 37266
96 Ga0157374_10001622 3300013296 Bacteria 18852
97 Ga0157374_10003352 3300013296 Bacteria 13449
98 Ga0157374_10303592 3300013296 Unclassified 1579
99 Ga0157378_10003085 3300013297 Bacteria 14806
100 Ga0157378_10012682 3300013297 Bacteria 7374
101 Ga0157378_10045121 3300013297 Bacteria 3916
102 Ga0163162_10000024 3300013306 Bacteria 188515
103 Ga0163162_10000882 3300013306 Bacteria 27892
104 Ga0163162_10295996 3300013306 Bacteria 1750
105 Ga0157372_10000001 3300013307 Bacteria 791349
106 Ga0157372_10001070 3300013307 Bacteria 29934
107 Ga0157372_10026771 3300013307 Bacteria 6277
108 Ga0157372_10065184 3300013307 Bacteria 4089
109 Ga0157372_10891678 3300013307 Bacteria 1032
110 Ga0157372_11017215 3300013307 Bacteria 960
111 Ga0157375_10016319 3300013308 Bacteria 6667
112 Ga0157375_10208205 3300013308 Unclassified 2113
113 Ga0157377_10010916 3300014745 Bacteria 4514
114 Ga0157376_10706575 3300014969 Bacteria 1014
115 Ga0182006_1004469 3300015261 Bacteria 6885
116 Ga0163161_10000394 3300017792 Bacteria 36483
117 Ga0163161_10009053 3300017792 Bacteria 6887
118 Ga0163161_10185443 3300017792 Bacteria 1597
119 Ga0213872_10009172 3300021361 Bacteria 4756
120 Ga0207427_100106 3300025231 Bacteria 117041
121 Ga0209437_100077 3300025233 Bacteria 286656
122 Ga0209437_100226 3300025233 Bacteria 100303
123 Ga0209026_1000963 3300025250 Bacteria 14377
124 Ga0209233_1000089 3300025261 Bacteria 316381
125 Ga0207647_10000354 3300025904 Bacteria 37206
126 Ga0207647_10262371 3300025904 Bacteria 989
127 Ga0207645_10000500 3300025907 Bacteria 32432
128 Ga0207705_10000040 3300025909 Bacteria 185735
129 Ga0207705_10039334 3300025909 Bacteria 3389
130 Ga0207705_10291562 3300025909 Unclassified 1250
131 Ga0207705_10540721 3300025909 Bacteria 906
132 Ga0207654_10004895 3300025911 Bacteria 6777
133 Ga0207654_10212067 3300025911 Unclassified 1280
134 Ga0207654_10221953 3300025911 Bacteria 1254
135 Ga0207707_10029445 3300025912 Bacteria 4800
136 Ga0207695_10009387 3300025913 Bacteria 12100
137 Ga0207695_10012640 3300025913 Bacteria 10113
138 Ga0207695_10049264 3300025913 Bacteria 4443
139 Ga0207695_10315246 3300025913 Bacteria 1454
140 Ga0207695_10341655 3300025913 Bacteria 1384
141 Ga0207695_10383279 3300025913 Bacteria 1291
142 Ga0207671_10003333 3300025914 Bacteria 16132
143 Ga0207671_10004426 3300025914 Bacteria 13457
144 Ga0207671_10005736 3300025914 Bacteria 11317
145 Ga0207671_10009466 3300025914 Bacteria 8141
146 Ga0207671_10031117 3300025914 Bacteria 3979
147 Ga0207660_10026732 3300025917 Bacteria 3932
148 Ga0207657_10033865 3300025919 Unclassified 4600
149 Ga0207657_10128167 3300025919 Bacteria 2082
150 Ga0207652_10003659 3300025921 Bacteria 12652
151 Ga0207694_10021079 3300025924 Bacteria 4935
152 Ga0207694_10902281 3300025924 Bacteria 747
153 Ga0207644_10004161 3300025931 Bacteria 9381
154 Ga0207690_10206258 3300025932 Bacteria 1496
155 Ga0207706_10000442 3300025933 Bacteria 44334
156 Ga0207704_10000011 3300025938 Bacteria 180140
157 Ga0207691_10392921 3300025940 Unclassified 1183
158 Ga0207667_10000020 3300025949 Bacteria 374770
159 Ga0207667_10043970 3300025949 Bacteria 4737
160 Ga0207667_10045470 3300025949 Bacteria 4650
161 Ga0207667_10045761 3300025949 Bacteria 4634
162 Ga0207667_10334505 3300025949 Bacteria 1546
163 Ga0207651_10003816 3300025960 Bacteria 7468
164 Ga0207677_10019037 3300026023 Unclassified 4136
165 Ga0207677_10032396 3300026023 Unclassified 3360
166 Ga0207639_10003710 3300026041 Bacteria 10275
167 Ga0207639_10010901 3300026041 Bacteria 6303
168 Ga0207702_10001532 3300026078 Bacteria 22854
169 Ga0207702_10117972 3300026078 Bacteria 2370
170 Ga0207641_10961005 3300026088 Bacteria 850
171 Ga0207648_10001059 3300026089 Bacteria 30821
172 Ga0207698_10004269 3300026142 Bacteria 8698
173 Ga0268266_10000380 3300028379 Bacteria 67791
174 Ga0307517_10001632 3300028786 Bacteria 37097
175 Ga0307515_10000280 3300028794 Bacteria 125330
176 Ga0307515_10022378 3300028794 Bacteria 11140
177 Ga0307515_10109673 3300028794 Bacteria 3239
178 Ga0307509_10087070 3300031507 Bacteria 3210
179 Ga0307408_100002024 3300031548 Bacteria 14624
180 Ga0307408_100018198 3300031548 Bacteria 4715
181 Ga0307408_100018484 3300031548 Bacteria 4679
182 Ga0307412_10002120 3300031911 Bacteria 11000
183 Ga0307416_100233936 3300032002 Bacteria 1774
184 Ga0307507_10000052 3300033179 Bacteria 168303
185 Ga0307510_10008290 3300033180 Bacteria 12386
186 Ga0395899_0000717 3300037312 Bacteria 33215
187 Ga0395899_0000735 3300037312 Bacteria 32677
188 Ga0395899_0007644 3300037312 Bacteria 8337
189 Ga0395900_0000014 3300037418 Bacteria 386513
190 Ga0395900_0052327 3300037418 Bacteria 4204
191 Ga0395898_0024455 3300037466 Bacteria 6093
192 Ga0395905_0000037 3300037471 Bacteria 261808
193 Ga0395905_0001611 3300037471 Bacteria 26826
194 Ga0395901_0000219 3300038443 Bacteria 71884
195 Ga0395901_1321204 3300038443 Bacteria 682
196 Ga0436361_0351371 3300039447 Bacteria 6023
197 Ga0439445_0093992 3300042004 Bacteria 846
198 Ga0439448_0018527 3300042005 Bacteria 2135
199 Ga0453683_0046535 3300044673 Bacteria 2720
200 Ga0466966_0022793 3300044684 Bacteria 4104
201 Ga0453684_0148032 3300044712 Bacteria 2794
202 Ga0466959_0103053 3300045049 Bacteria 2042
203 Ga0451576_0062552 3300045051 Bacteria 3880
204 Ga0451576_0867539 3300045051 Bacteria 947
205 Ga0451576_1383394 3300045051 Bacteria 732
206 Ga0495592_0196944 3300046454 Bacteria 1362
207 Ga0495585_0000806 3300046492 Bacteria 27323
208 Ga0495596_0050101 3300046500 Bacteria 1637
209 Ga0495583_0113856 3300046506 Bacteria 1144
210 Ga0495630_0398037 3300046517 Unclassified 1055
211 Ga0495631_0009565 3300046518 Bacteria 4838
212 Ga0495648_0008887 3300046524 Bacteria 7853
213 Ga0495652_0023951 3300046529 Bacteria 5408
214 Ga0495652_0436811 3300046529 Bacteria 919
215 Ga0495654_0082356 3300046530 Bacteria 1506
216 Ga0495633_0000029 3300046558 Bacteria 200381
217 Ga0495668_0000021 3300046616 Bacteria 381308
218 Ga0495668_0213029 3300046616 Bacteria 1058
219 Ga0495625_0000601 3300046660 Bacteria 52410
220 Ga0495625_0021222 3300046660 Bacteria 5004
221 Ga0495625_0194665 3300046660 Bacteria 1341
222 Ga0495661_0104563 3300046665 Bacteria 1587
223 Ga0495649_0202611 3300046694 Bacteria 1030
224 Ga0495600_0241730 3300046809 Bacteria 1150
225 Ga0495687_001685 3300047443 Bacteria 19718
226 Ga0495687_028649 3300047443 Bacteria 2587
227 Ga0495677_0127162 3300047445 Bacteria 974
228 Ga0495681_0065091 3300047470 Bacteria 1668
229 Ga0495686_0000194 3300047472 Bacteria 113904
230 Ga0495686_0018337 3300047472 Bacteria 4699
231 Ga0495686_0032372 3300047472 Bacteria 3384
232 Ga0495686_0124910 3300047472 Bacteria 1530
233 Ga0495678_001759 3300049459 Bacteria 16052
234 Ga0495682_0105417 3300049460 Bacteria 1011
235 Ga0500635_0001803 3300053080 Bacteria 5223
236 Ga0500608_000637 3300053122 Bacteria 12928
237 Ga0500608_054800 3300053122 Bacteria 1913
238 Ga0500618_000266 3300053125 Bacteria 40517
239 Ga0500561_0068475 3300053137 Bacteria 1010
240 2599476838 2599185184 Bacteria 6430550
241 2852623319 2852623160 Bacteria 4376875
242 2884937803 2884933994 Bacteria 4535041
243 2919438790 2919437846 Bacteria 6199444
244 2928078748 2928078545 Bacteria 6534839
245 2928151575 2928147474 Bacteria 6512076
246 2932084199 2932082852 Bacteria 6563563
247 2977233671 2977232053 Bacteria 5485925
248 Ga0070658_10000026
249 JGI24736J21556_1016672
250 JGI24740J21852_10044247
251 JGI24740J21852_10054683
252 JGI24737J22298_10000092
253 JGI24735J21928_10000006
254 JGI24744J21845_10018323
255 JGI25162J39368_1001400
256 JGI25164J39214_1001307
257 JGI25165J46597_1000855
258 rootH1_10060985
259 rootH1_10072982
260 rootH2_10001334
261 rootH2_10089634
262 rootL2_10192676
263 rootH1_10002772
264 rootH1_10168445
265 rootH1_10216274
266 Ga0065714_10005409
267 Ga0070658_10028102
268 Ga0070658_10084727
269 Ga0070676_10001812
270 Ga0070680_100013176
271 Ga0068868_100034503
272 Ga0068868_100107000
273 Ga0070660_100025924
274 Ga0070660_100569975
275 Ga0070673_100010025
276 Ga0070659_100241101
277 Ga0070662_100000093
278 Ga0070662_100092259
279 Ga0070681_10024087
280 Ga0068867_100000834
281 Ga0070679_100259740
282 Ga0068853_100046991
283 Ga0068853_100077701
284 Ga0070672_100244742
285 Ga0070665_100000003
286 Ga0068855_100004855
287 Ga0068855_100015590
288 Ga0068855_100049734
289 Ga0068856_100001155
290 Ga0068856_100016916
291 Ga0068856_100116676
292 Ga0068856_100332857
293 Ga0068852_100005543
294 Ga0068852_100419852
295 Ga0068858_100044822
296 Ga0068858_100466051
297 Ga0075366_10000123
298 Ga0097621_100002096
299 Ga0068871_100000196
300 Ga0068865_100000022
301 Ga0105240_10003724
302 Ga0105240_10006944
303 Ga0105240_10026711
304 Ga0105240_10252849
305 Ga0105240_10300821
306 Ga0105240_10479490
307 Ga0105240_10506376
308 Ga0105240_10857928
309 Ga0105240_11084362
310 Ga0105245_10858890
311 Ga0105241_10000238
312 Ga0105242_10165656
313 Ga0105237_10001823
314 Ga0105237_10006067
315 Ga0105237_10018370
316 Ga0105237_10018921
317 Ga0105237_10054779
318 Ga0105238_10008082
319 Ga0105238_10653183
320 Ga0105239_10000005
321 Ga0105239_10000013
322 Ga0105239_10004534
323 Ga0105239_10004850
324 Ga0105239_10022560
325 Ga0105239_10043744
326 Ga0105239_10073693
327 Ga0105239_10156032
328 Ga0105239_10290147
329 Ga0105246_10180333
330 Ga0105246_10348689
331 Ga0157373_10002419
332 Ga0157371_10007776
333 Ga0157371_10128732
334 Ga0157371_10178804
335 Ga0157371_10335814
336 Ga0157370_10054544
337 Ga0157370_10060281
338 Ga0157369_10000039
339 Ga0157369_10063369
340 Ga0157369_10169051
341 Ga0157369_10656290
342 Ga0157374_10000456
343 Ga0157374_10001622
344 Ga0157374_10003352
345 Ga0157374_10303592
346 Ga0157378_10003085
347 Ga0157378_10012682
348 Ga0157378_10045121
349 Ga0163162_10000024
350 Ga0163162_10000882
351 Ga0163162_10295996
352 Ga0157372_10000001
353 Ga0157372_10001070
354 Ga0157372_10026771
355 Ga0157372_10065184
356 Ga0157372_10891678
357 Ga0157372_11017215
358 Ga0157375_10016319
359 Ga0157375_10208205
360 Ga0157377_10010916
361 Ga0157376_10706575
362 Ga0182006_1004469
363 Ga0163161_10000394
364 Ga0163161_10009053
365 Ga0163161_10185443
366 Ga0213872_10009172
367 Ga0207427_100106
368 Ga0209437_100077
369 Ga0209437_100226
370 Ga0209026_1000963
371 Ga0209233_1000089
372 Ga0207647_10000354
373 Ga0207647_10262371
374 Ga0207645_10000500
375 Ga0207705_10000040
376 Ga0207705_10039334
377 Ga0207705_10291562
378 Ga0207705_10540721
379 Ga0207654_10004895
380 Ga0207654_10212067
381 Ga0207654_10221953
382 Ga0207707_10029445
383 Ga0207695_10009387
384 Ga0207695_10012640
385 Ga0207695_10049264
386 Ga0207695_10315246
387 Ga0207695_10341655
388 Ga0207695_10383279
389 Ga0207671_10003333
390 Ga0207671_10004426
391 Ga0207671_10005736
392 Ga0207671_10009466
393 Ga0207671_10031117
394 Ga0207660_10026732
395 Ga0207657_10033865
396 Ga0207657_10128167
397 Ga0207652_10003659
398 Ga0207694_10021079
399 Ga0207694_10902281
400 Ga0207644_10004161
401 Ga0207690_10206258
402 Ga0207706_10000442
403 Ga0207704_10000011
404 Ga0207691_10392921
405 Ga0207667_10000020
406 Ga0207667_10043970
407 Ga0207667_10045470
408 Ga0207667_10045761
409 Ga0207667_10334505
410 Ga0207651_10003816
411 Ga0207677_10019037
412 Ga0207677_10032396
413 Ga0207639_10003710
414 Ga0207639_10010901
415 Ga0207702_10001532
416 Ga0207702_10117972
417 Ga0207641_10961005
418 Ga0207648_10001059
419 Ga0207698_10004269
420 Ga0268266_10000380
421 Ga0307517_10001632
422 Ga0307515_10000280
423 Ga0307515_10022378
424 Ga0307515_10109673
425 Ga0307509_10087070
426 Ga0307408_100002024
427 Ga0307408_100018198
428 Ga0307408_100018484
429 Ga0307412_10002120
430 Ga0307416_100233936
431 Ga0307507_10000052
432 Ga0307510_10008290
433 Ga0395899_0000717
434 Ga0395899_0000735
435 Ga0395899_0007644
436 Ga0395900_0000014
437 Ga0395900_0052327
438 Ga0395898_0024455
439 Ga0395905_0000037
440 Ga0395905_0001611
441 Ga0395901_0000219
442 Ga0395901_1321204
443 Ga0436361_0351371
444 Ga0439445_0093992
445 Ga0439448_0018527
446 Ga0453683_0046535
447 Ga0466966_0022793
448 Ga0453684_0148032
449 Ga0466959_0103053
450 Ga0451576_0062552
451 Ga0451576_0867539
452 Ga0451576_1383394
453 Ga0495592_0196944
454 Ga0495585_0000806
455 Ga0495596_0050101
456 Ga0495583_0113856
457 Ga0495630_0398037
458 Ga0495631_0009565
459 Ga0495648_0008887
460 Ga0495652_0023951
461 Ga0495652_0436811
462 Ga0495654_0082356
463 Ga0495633_0000029
464 Ga0495668_0000021
465 Ga0495668_0213029
466 Ga0495625_0000601
467 Ga0495625_0021222
468 Ga0495625_0194665
469 Ga0495661_0104563
470 Ga0495649_0202611
471 Ga0495600_0241730
472 Ga0495687_001685
473 Ga0495687_028649
474 Ga0495677_0127162
475 Ga0495681_0065091
476 Ga0495686_0000194
477 Ga0495686_0018337
478 Ga0495686_0032372
479 Ga0495686_0124910
480 Ga0495678_001759
481 Ga0495682_0105417
482 Ga0500635_0001803
483 Ga0500608_000637
484 Ga0500608_054800
485 Ga0500618_000266
486 Ga0500561_0068475
487 2599476838
488 2852623319
489 2884937803
490 2919438790
491 2928078748
492 2928151575
493 2932084199
494 2977233671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00485

PRK

Phosphoribulokinase / Uridine kinase family

19

205

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n55-assembly2.cif.gz_G crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidouridine 0.879 11 214
3w34-assembly1.cif.gz_A ternary complex of thermus thermophilus hb8 uridine-cytidine kinase with substrates 0.878 10 215
3w8r-assembly1.cif.gz_B mutant structure of thermus thermophilus hb8 uridine-cytidine kinase 0.8736 10 215
6n55-assembly2.cif.gz_B crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidouridine 0.8656 10 213
6n55-assembly1.cif.gz_H crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidouridine 0.8651 10 213
ID Description Score Start End Superfamily
af_P0A8F4_7_213_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8713 10 210 3.40.50.300
af_Q2FXW6_1_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8686 10 210 3.40.50.300
af_Q54R62_51_230_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8662 12 196 3.40.50.300
af_I1JJM2_43_250_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8649 7 213 3.40.50.300
af_Q5ANN6_93_307_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.859 10 215 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A520D6H4-F1-model_v4 Uridine kinase 0.9565 64 215 GO:0005524
GO:0016301
AF-A0A7W8ZP20-F1-model_v4 Uridine kinase (EC 2.7.1.48) 0.9555 6 216 GO:0004849
GO:0005524
AF-A0A381QJE9-F1-model_v4 Phosphoribulokinase/uridine kinase domain-containing protein 0.9438 68 214 GO:0005524
GO:0016301
AF-A0A7T9I6J4-F1-model_v4 deleted 0.9374 10 216
AF-A0A7K3WK23-F1-model_v4 AAA family ATPase 0.9344 4 214 GO:0005524
GO:0016301

Map